Methods for Preparing Rebaudioside I and Uses

20170275666 · 2017-09-28

Assignee

Inventors

Cpc classification

International classification

Abstract

Methods of preparing rebaudioside I, including highly purified rebaudioside I, are described herein. The methods utilize biocatalysts for converting rebaudioside A to rebaudioside I. Compositions and consumables comprising rebaudioside I, including sweetener compositions and flavor enhancing composition, are also provided.

Claims

1. A method for preparing a rebaudioside I composition, comprising: a. contacting a starting composition comprising rebaudioside A with a biocatalyst capable of converting rebaudioside A to rebaudioside I to provide a composition comprising rebaudioside I.

2. The method of claim 1, wherein the biocatalyst is a UDP-glycosyltransferase (UGT).

3. The method of claim 2, wherein the UGT is UGT76G1 or a variant thereof containing about 75% amino acid sequence identity or greater.

4. The method of claim 3, wherein the UGT76G1 variant is selected from the group consisting of UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

5. The method of claim 3, wherein the UGT76G1 variant contains one or more of the following point mutations: Q266E, P272A, R334K, G348P, L379G, S42A, F46I, I190L, S274G, I295M, K303G, F314S, K316R, K393R, V394I, I407V, N409K, N409R, Q425E, Q432E, S447A, S456L, I46L, I295M, S119A, S274G, K334R, F314S, K303G, K316R, K393R, I190L, Q425E, Q432E, N138G, V394I, F182L, V407I, A272P, V264C, E449D and A352G.

6. The method of claim 5, wherein the UGT variant contains the following point mutations: Q266E, P272A, R334K, G348P and L379G.

7. (canceled)

8. (canceled)

9. The method of claim 2, wherein the UGT is provided in the form selected from the group consisting of purified form, a crude lysate and a whole cell suspension.

10. The method of claim 2, wherein the UGT is provided in a microorganism.

11. (canceled)

12. The method of claim 1, wherein rebaudioside A is provided in a steviol glycoside mixture or Stevia extract containing at least about 50% rebaudioside A by weight.

13. The method of claim 12, wherein rebaudioside A is provided in a steviolglycoside mixture or Stevia extract containing at least about 80% rebaudioside A by weight.

14. The method of claim 1, wherein the rebaudioside I composition comprises greater than about 1% rebaudioside I by weight.

15. The method of claim 1, further comprising separating rebaudioside I to provide a separated rebaudioside I composition.

16. The method of claim 15, further comprising purifying the separated rebaudioside I composition to provide highly purified rebaudioside I.

17. The method of claim 15, further comprising purifying the separated rebaudioside I composition to provide pure rebaudioside I.

18. A method for preparing a highly purified rebaudioside I composition, comprising: a. contacting a starting composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to form a composition comprising rebaudioside I, and optionally concomitantly recycling UDP-glucose by providing sucrose synthase and sucrose; b. separating rebaudioside I to form a separated rebaudioside I composition; and, c. purifying the separated rebaudioside I composition to provide a highly purified rebaudioside I composition.

19. The method of claim 18, wherein the highly purified rebaudioside I comprises greater than about 80% rebaudioside I by weight.

20. The method of claim 18, further comprising: a. contacting a composition comprising stevioside with UGT76G1 and UDP-glucose to provide a composition comprising rebaudioside A, and b. separating rebaudioside A.

21. The method of claim 20, further comprising: a. contacting a composition comprising rubusoside with UGT91D2, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising stevioside; and b. separating stevioside.

22.-30. (canceled)

31. A consumable comprising a mixture comprising rebaudioside I, wherein rebaudioside I is present in the mixture in an amount from about 50% to about 99% by weight on a dry basis and the consumable is selected from the group consisting of pharmaceutical compositions, edible gel mixes or compositions, dental compositions, confections, condiment compositions, chewing gum compositions, cereal compositions, baked goods, dairy products, tabletop sweetener compositions, beverages and beverage products.

32.-34. (canceled)

35. The consumable of claim 31, wherein the consumable is a beverage.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0019] The accompanying drawings are included to provide a further understanding of the invention. The drawings illustrate embodiments of the invention and together with the description serve to explain the principles of the embodiments of the invention.

[0020] FIG. 1 shows the biocatalytic production of rebaudioside I.

[0021] FIG. 2 shows the biocatalytic production of rebaudioside A from stevioside using the enzyme UGT76G1 and concomitant recycling of UDP to UDP glucose via sucrose synthase.

[0022] FIG. 3 shows the UGT76G1 catalyzed transformation of stevioside to rebaudioside A.

[0023] FIG. 4 shows the reaction profile of UGT76G1-R1-F12 catalyzed transformation of rebaudioside A to rebaudioside I.

[0024] FIG. 5 shows the activity of UGT mutants for conversion of rebaudioside A to rebaudioside I.

[0025] FIG. 6 shows the HPLC trace of rebaudioside I prior to purification.

[0026] FIG. 7 shows sensory attributes of rebaudioside I to rebaudioside M at 400 ppm in water at 4° C.

DETAILED DESCRIPTION

[0027] Methods for Preparing Rebaudioside I

[0028] The present invention provides a biocatalytic process for preparing a rebaudioside I composition by contacting a starting composition comprising rebaudioside A with a biocatalyst capable of converting rebaudioside A to rebaudioside I. The rebaudioside I composition may optionally be further processed to provide highly purified rebaudioside I or even pure rebaudioside I.

[0029] As used herein, “starting composition” refers to any composition containing rebaudioside A. Generally, the starting composition is an aqueous solution.

[0030] The starting composition can be purified rebaudioside A, a steviol glycoside mixture or a Stevia extract. Steviolglycoside mixtures and Stevia extracts containing rebaudioside A, as well as highly purified rebaudioside A, are commercially available from various suppliers or can be readily prepared via processes provided in the literature. For example, U.S. Pat. No. 8,791,253 to The Coca-Cola Company (the contents of which are incorporated fully herein by reference) provides methods of obtaining rebaudioside A having greater than 95% purity.

[0031] In one embodiment, the starting composition is purified rebaudioside A, i.e. >99% by weight.

[0032] In another embodiment, the starting composition is a steviol glycoside mixture. The identity of the steviol glycoside mixture is not particularly limited and may contain naturally occurring steviol glycosides, e.g. steviolmonoside, steviolbioside, rubusoside, dulcoside B, dulcoside A, rebaudioside B, rebaudioside G, stevioside, rebaudioside C, rebaudioside F, rebaudioside A, rebaudioside I, rebaudioside E, rebaudioside H, rebaudioside L, rebaudioside K, rebaudioside J, rebaudioside M, rebaudioside M2, rebaudioside D, rebaudioside D2, rebaudioside N, rebaudioside O; synthetic steviol glycosides, e.g. enzymatically glucosylated steviol glycosides and combinations thereof.

[0033] In some embodiments, the starting composition is a steviol glycoside mixture or Stevia extract that contains rebaudioside A in an amount of about 1% or greater by weight, such as, for example, about 20% or greater, about 30% or greater, about 40% or greater, about 50% or greater, about 60% or greater, about 70% or greater, about 80% or greater or about 90% or greater.

[0034] In a particular embodiment, the starting composition is a steviol glycoside mixture or Stevia extract contains rebaudioside A in an amount of about 50% or greater by weight.

[0035] In another particular embodiment, the starting composition is a steviol glycoside mixture or Stevia extract contains rebaudioside A in an amount of about 80% or greater by weight.

[0036] In still another particular embodiment, the starting composition is a steviol glycoside mixture or Stevia extract contains rebaudioside A in an amount of about 90% or greater by weight.

[0037] In yet another particular embodiment, the starting composition is a steviol glycoside mixture or Stevia extract contains rebaudioside A in an amount of about 95% or greater by weight, such as, for example, about 96%, about 97%, about 98% or about 99%.

[0038] Notably, the starting composition may contain some amount of rebaudioside I. For example, the starting composition is a Stevia extract or steviol glycoside mixture. Contacting the biocatalyst with the starting composition produces a rebaudioside I composition that contains an increased amount of rebaudioside I compared to the amount of rebaudioside I present—if any—in the starting composition. The increase in rebaudioside I is attributed to the action of the biocatalyst.

[0039] In a particular embodiment, the amount of rebaudioside I in the rebaudioside composition, i.e., the composition resulting from the method of the present invention, is about 0.5, about 1, about 3, about 5, about 10, about 15, about 20, about 25, about 30, about 35, about 40, about 45, about 50, about 55, about 60 or about 65, about 70 or about 75% or greater than the amount of rebaudioside I present in the starting composition.

[0040] The starting composition is contacted with the biocatalyst in an aqueous medium comprising water, and, e.g. various components selected from the including carbon sources, energy sources, nitrogen sources, microelements, vitamins, nucleosides, nucleoside phosphates, nucleoside diphosphates, nucleoside triphosphates, organic and inorganic salts, organic and mineral acids, bases etc. Carbon sources include glycerol, glucose, carbon dioxide, carbonates, bicarbonates. Nitrogen sources can include nitrates, nitrites, amino acids, peptides, peptones, or proteins.

[0041] In a particular embodiment, the medium comprises buffer. Suitable buffers include, but are not limited to, PIPES buffer, acetate buffer and phosphate buffer. In a particular embodiment, the medium comprises phosphate buffer.

[0042] In one embodiment, the medium can also include an organic solvent, e.g. methanol, ethanol, propanol and the like.

[0043] As used herein, “biocatalyst” refers to an enzyme capable of converting rebaudioside A to rebaudioside I. The enzyme can be naturally occurring or a recombinant protein. At least one biocatalyst is used for the present method of converting rebaudioside A to rebaudioside I. However, multiple biocatalysts can be used, as necessary. Accordingly, in some embodiments, two or more biocatalysts are utilized, such as, for example, three or more biocatalysts, four or more biocatalysts or five or more biocatalysts.

[0044] The biocatalyst can be provided in the form of a whole cell suspension, a crude lysate, purified or a combination thereof. In one embodiment, the biocatalyst is provided in purified form, i.e., as a purified enzyme. In another embodiment, the biocatalyst is provided in the form of a crude lysate. In still another embodiment, the biocatalyst is provided in the form of a whole cell suspension.

[0045] In another embodiment, the biocatalyst is provided in the form of one or more cells, i.e., the biocatalysts is associated with a cell(s). The biocatalyst can be located on the surface of the cell, inside the cell, or both on the surface of the cell and inside the cell.

[0046] In another embodiment, the biocatalyst is provided in the form of a microorganism, i.e., the biocatalysts is associated with a microorganism. The microorganism can be any microorganism possessing the necessary biocatalyst(s)/enzyme(s) for converting rebaudioside A to rebaudioside I. Suitable microorganisms include, but are not limited to, E. coli, Saccharomyces sp., Aspergillus sp., Pichia sp., Bacillus sp., Yarrowia sp. etc.

[0047] In one embodiment, the microorganism is free (i.e., not immobilized) when contacted with the starting composition.

[0048] In another embodiment, the microorganism is immobilized when contacted with the starting composition. For example, the microorganism may be immobilized to a solid support made from inorganic or organic materials. Non-limiting examples of solid supports suitable to immobilize the microorganism include derivatized cellulose or glass, ceramics, metal oxides or membranes. The microorganism may be immobilized to the solid support, for example, by covalent attachment, adsorption, cross-linking, entrapment or encapsulation.

[0049] In still another embodiment, the biocatalyst is secreted by the microorganism into the reaction medium.

[0050] Suitable biocatalysts for converting rebaudioside A to rebaudioside I include, but are not limited to, steviol biosynthesis enzymes and UDP-glycosyltransferases (UGTs).

[0051] In one embodiment, the biocatalyst is a steviol biosynthesis enzyme, for example, a mevalonate (MVA) pathway enzyme.

[0052] In another embodiment, the biocatalyst is a steviol biosynthesis enzyme, for example, a non-mevalonate 2-C-methyl-D-erythritol-4-phosphate pathway (MEP/DOXP) enzyme.

[0053] In one embodiment, the biocatalyst is a steviol biosynthesis enzyme is selected from the group consisting of geranylgeranyl diphosphate synthase, copalyl diphosphate synthase, kaurene synthase, kaurene oxidase, kaurenoic acid 13-hydroxylase (KAH), steviol synthetase, deoxyxylulose 5-phosphate synthase (DXS), D-1-deoxyxylulose 5-phosphate reductoisomerase (DXR), 4-diphosphocytidyl-2-C-methyl-D-erythritol synthase (CMS), 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK), 4-diphosphocytidyl-2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MCS), 1-hydroxy-2-methyl-2(E)-butenyl 4-diphosphate synthase (HDS), 1-hydroxy-2-methyl-2(E)-butenyl 4-diphosphate reductase (HDR), acetoacetyl-CoA thiolase, truncated HMG-CoA reductase, mevalonate kinase, phosphomevalonate kinase, mevalonate pyrophosphate decarboxylase and cytochrome P450 reductase.

[0054] In one embodiment, the biocatalyst is a UGT capable of adding at least one glucose unit to rebaudioside A to provide rebaudioside I. In one embodiment, the UGT is UGT76G1 or a variant thereof, wherein the variant contains about 75% amino acid sequence identity or greater to UGT76G1. Exemplary UGT76G1 variants include, but are not limited to, UGTSL, UGTSL2, UGTLB, UGT91D2, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0055] In another embodiment, the biocatalyst is a UGT is selected from the following listing of GenInfo identifier numbers, preferably from the group presented in Table 1, and more preferably the group presented in Table 2.

TABLE-US-00001 397567 30680413 115480946 147798902 218193594 225443294 454245 32816174 116310259 147811764 218193942 225444853 1359905 32816178 116310985 147827151 219885307 225449296 1685003 34393978 116788066 147836230 222615927 225449700 1685005 37993665 116788606 147839909 222619587 225454338 2191136 37993671 116789315 147846163 222623142 225454340 2501497 37993675 119394507 147855977 222625633 225454342 2911049 39104603 119640480 148905778 222625635 225454473 4218003 41469414 122209731 148905999 222636620 225454475 4314356 41469452 125526997 148906835 222636621 225458362 13492674 42566366 125534279 148907340 222636628 225461551 13492676 42570280 125534461 148908935 222636629 225461556 15217773 42572855 125540090 148909182 224053242 225461558 15217796 44890129 125541516 148909920 224053386 225469538 15223396 46806235 125545408 148910082 224055535 225469540 15223589 50284482 125547340 148910154 224056138 226316457 15227766 51090402 125547520 148910612 224056160 226492603 15230017 51090594 125554547 148910769 224067918 226494221 15231757 52839682 125557592 156138791 224072747 226495389 15234056 56550539 125557593 156138797 224080189 226495945 15234195 62734263 125557608 156138799 224091845 226502400 15234196 62857204 125559566 156138803 224094703 226507980 15238503 62857206 125563266 165972256 224100653 226531147 15239523 62857210 125571055 168016721 224100657 226532094 15239525 62857212 125579728 171674071 224101569 238477377 15239543 75265643 125588307 171906258 224103105 240254512 15239937 75285934 125589492 183013901 224103633 242032615 15240305 75288884 125599469 183013903 224103637 242032621 15240534 77550661 125601477 186478321 224109218 242038423 15982889 77556148 126635837 187373030 224114583 242043290 18086351 82791223 126635845 187373042 224116284 242044836 18418378 83778990 126635847 190692175 224120552 242051252 18418380 89953335 126635863 194701936 224121288 242056217 18418382 110741436 126635867 195620060 224121296 242056219 19743740 110743955 126635883 209954691 224121300 242056663 19911201 115438196 126635887 209954719 224130358 242059339 20149064 115438785 133874210 209954725 224140703 242059341 20260654 115441237 133874212 209954733 224143404 242060922 21435782 115454819 145358033 210063105 224143406 242067411 21553613 115456047 147772508 210063107 224144306 242067413 21593514 115457492 147776893 212275846 224285244 242076258 22759895 115459312 147776894 216296854 225431707 242076396 23955910 115464719 147776895 217074506 225435532 242084750 26452040 115471069 147786916 218185693 225436321 242091005 28393204 115471071 147798900 218187075 225440041 242095206 30679796 115474009 147798901 218189427 225441116 242345159 242345161 297724601 326492035 356523945 357140904 359486938 255536859 297725463 326493430 356523957 357165849 359487055 255538228 297728331 326500410 356523959 357165852 359488135 255541676 297738632 326506816 356523961 357168415 359488708 255547075 297745347 326507826 356523963 357437837 359493630 255552620 297745348 326508394 356524387 357442755 359493632 255552622 297795735 326509445 356524403 357442757 359493634 255555343 297796253 326511261 356527181 357445729 359493636 255555361 297796257 326511866 356533209 357445731 359493815 255555363 297796261 326512412 356533852 357445733 359495856 255555365 297797587 326517673 356534718 357446799 359495858 255555369 297798502 326518800 356535480 357446805 359495869 255555373 297799226 326521124 356542996 357452779 359495871 255555377 297805988 326525567 356543136 357452781 359497638 255556812 297807499 326525957 356543932 357452783 359807261 255556818 297809125 326526607 356549841 357452787 374256637 255563008 297809127 326527141 356549843 357452789 377655465 255564074 297811403 326530093 356554358 357452791 378405177 255564531 297820040 326534036 356554360 357452797 378829085 255572878 297821483 326534312 356558606 357452799 387135070 255577901 297825217 332071132 356560333 357470367 387135072 255583249 297832276 339715876 356560599 357472193 387135078 255583253 297832280 342306012 356560749 357472195 387135092 255583255 297832518 342306016 356566018 357474295 387135094 255585664 297832520 343457675 356566169 357474493 387135098 255585666 297840825 343457677 356566173 357474497 387135100 255634688 297840827 350534960 356567761 357474499 387135134 255644801 297847402 356498085 356574704 357490035 387135136 255645821 297849372 356499771 356576401 357493567 387135174 255647456 300078590 356499777 356577660 357497139 387135176 255648275 300669727 356499779 357114993 357497581 387135184 260279126 302142947 356501328 357115447 357497671 387135186 260279128 302142948 356502523 357115451 357500579 387135188 261343326 302142950 356503180 357115453 357504663 387135190 283132367 302142951 356503184 357116080 357504691 387135192 283362112 302765302 356503295 357116928 357504699 387135194 289188052 302796334 356504436 357117461 357504707 387135282 295841350 302811470 356504523 357117463 357505859 387135284 296088529 302821107 356504765 357117829 357510851 387135294 296090415 302821679 356511113 357117839 357516975 387135298 296090524 319759260 356515120 357125059 359477003 387135300 296090526 319759266 356517088 357126015 359477998 387135302 297599503 320148814 356520732 357134488 359478043 387135304 297601531 326489963 356522586 357135657 359478286 387135312 297611791 326490273 356522588 357138503 359484299 387135314 297722841 326491131 356522590 357139683 359486936 387135316 387135318 449440433 460376293 460413408 462423864 475546199 387135320 449445896 460378310 460416351 470101924 475556485 387135322 449446454 460380744 462394387 470102280 475559699 387135324 449447657 460381726 462394433 470102858 475578293 387135326 449449002 460382093 462394557 470104211 475591753 387135328 449449004 460382095 462395646 470104264 475593742 388493506 449449006 460382754 462395678 470104266 475612072 388495496 449451379 460384935 462396388 470106317 475622476 388498446 449451589 460384937 462396389 470106357 475622507 388499220 449451591 460385076 462396419 470115448 475623787 388502176 449451593 460385872 462396542 470130404 482550481 388517521 449453712 460386018 462397507 470131550 482550499 388519407 449453714 460389217 462399998 470136482 482550740 388521413 449453716 460394872 462400798 470136484 482550999 388827901 449453732 460396139 462401217 470136488 482552352 388827903 449457075 460397862 462402118 470136492 482554970 388827907 449467555 460397864 462402237 470137933 482555336 388827909 449468742 460398541 462402284 470137937 482555478 388827913 449495638 460403139 462402416 470140422 482556454 393887637 449495736 460403141 462404228 470140426 482557289 393887646 449499880 460403143 462406358 470140908 482558462 393887649 449502786 460403145 462408262 470141232 482558508 393990627 449503471 460405998 462409325 470142008 482558547 397746860 449503473 460407578 462409359 470142010 482561055 397789318 449515857 460407590 462409777 470142012 482561555 413924864 449518643 460409128 462411467 470143607 482562795 414590349 449519559 460409134 462414311 470143939 482562850 414590661 449522783 460409136 462414416 470145404 482565074 414591157 449524530 460409459 462414476 473923244 482566269 414879558 449524591 460409461 462415526 474114354 482566296 414879559 449528823 460409463 462415603 474143634 482566307 414879560 449528825 460409465 462415731 474202268 482568689 414888074 449534021 460409467 462416307 474299266 482570049 431812559 460365546 460410124 462416920 474363119 482570572 449432064 460366882 460410126 462416922 474366157 482575121 449432066 460369823 460410128 462416923 474429346 449433069 460369829 460410130 462416924 475432777 449436944 460369831 460410132 462417401 475473002 449438665 460369833 460410134 462419769 475489790 449438667 460370755 460410213 462420317 475511330 449440431 460374714 460411200 462423366 475516200

TABLE-US-00002 TABLE 1 GI number Accession Origin 190692175 ACE87855.1 Stevia rebaudiana 41469452 AAS07253.1 Oryza sativa 62857204 BAD95881.1 Ipomoea nil 62857206 BAD95882.1 Ipomoea purperea 56550539 BAD77944.1 Bellis perennis 115454819 NP_001051010.1 Oryza sativa Japonica Group 115459312 NP_001053256.1 Oryza sativa Japonica Group 115471069 NP_001059133.1 Oryza sativa Japonica Group 115471071 NP_001059134.1 Oryza sativa Japonica Group 116310985 CAH67920.1 Oryza sativa Indica Group 116788066 ABK24743.1 Picea sitchensis 122209731 Q2V6J9.1 Fragaria × ananassa 125534461 EAY81009.1 Oryza sativa Indica Group 125559566 EAZ05102.1 Oryza sativa Indica Group 125588307 EAZ28971.1 Oryza sativa Japonica Group 148907340 ABR16806.1 Picea sitchensis 148910082 ABR18123.1 Picea sitchensis 148910612 ABR18376.1 Picea sitchensis 15234195 NP_194486.1 Arabidopsis thaliana 15239523 NP_200210.1 Arabidopsis thaliana 15239937 NP_196793.1 Arabidopsis thaliana 1685005 AAB36653.1 Nicotiana tabacum 183013903 ACC38471.1 Medicago truncatula 186478321 NP_172511.3 Arabidopsis thaliana 187373030 ACD03249.1 Avena strigosa 194701936 ACF85052.1 Zea mays 19743740 AAL92461.1 Solanum lycopersicum 212275846 NP_001131009.1 Zea mays 222619587 EEE55719.1 Oryza sativa Japonica Group 224055535 XP_002298527.1 Populus trichocarpa 224101569 XP_002334266.1 Populus trichocarpa 224120552 XP_002318358.1 Populus trichocarpa 224121288 XP_002330790.1 Populus trichocarpa 225444853 XP_002281094 Vitis vinifera 225454342 XP_002275850.1 Vitis vinifera 225454475 XP_002280923.1 Vitis vinifera 225461556 XP_002285222 Vitis vinifera 225469540 XP_002270294.1 Vitis vinifera 226495389 NP_001148083.1 Zea mays 226502400 NP_001147674.1 Zea mays 238477377 ACR43489.1 Triticum aestivum 240254512 NP_565540.4 Arabidopsis thaliana 2501497 Q43716.1 Petunia × hybrida 255555369 XP_002518721.1 Ricinus communis 26452040 BAC43110.1 Arabidopsis thaliana 296088529 CBI37520.3 Vitis vinifera 297611791 NP_001067852.2 Oryza sativa Japonica Group 297795735 XP_002865752.1 Arabidopsis lyrata subsp. lyrata 297798502 XP_002867135.1 Arabidopsis lyrata subsp. lyrata 297820040 XP_002877903.1 Arabidopsis lyrata subsp. lyrata 297832276 XP_002884020.1 Arabidopsis lyrata subsp. lyrata 302821107 XP_002992218.1 Selaginella moellendorffii 30680413 NP_179446.2 Arabidopsis thaliana 319759266 ADV71369.1 Pueraria montana var. lobata 326507826 BAJ86656.1 Hordeum vulgare subsp. Vulgare 343457675 AEM37036.1 Brassica rapa subsp. oleifera 350534960 NP_001234680.1 Solanum lycopersicum 356501328 XP_003519477.1 Glycine max 356522586 XP_003529927.1 Glycine max 356535480 XP_003536273.1 Glycine max 357445733 XP_003593144.1 Medicago truncatula 357452783 XP_003596668.1 Medicago truncatula 357474493 XP_003607531.1 Medicago truncatula 357500579 XP_003620578.1 Medicago truncatula 357504691 XP_003622634.1 Medicago truncatula 359477998 XP_003632051.1 Vitis vinifera 359487055 XP_002271587 Vitis vinifera 359495869 XP_003635104.1 Vitis vinifera 387135134 AFJ52948.1 Linum usitatissimum 387135176 AFJ52969.1 Linum usitatissimum 387135192 AFJ52977.1 Linum usitatissimum 387135282 AFJ53022.1 Linum usitatissimum 387135302 AFJ53032.1 Linum usitatissimum 387135312 AFJ53037.1 Linum usitatissimum 388519407 AFK47765.1 Medicago truncatula 393887646 AFN26668.1 Barbarea vulgaris subsp. arcuata 414888074 DAA64088.1 Zea mays 42572855 NP_974524.1 Arabidopsis thaliana 449440433 XP_004137989.1 Cucumis sativus 449446454 XP_004140986.1 Cucumis sativus 449449004 XP_004142255.1 Cucumis sativus 449451593 XP_004143546.1 Cucumis sativus 449515857 XP_004164964.1 Cucumis sativus 460382095 XP_004236775.1 Solanum lycopersicum 460409128 XP_004249992.1 Solanum lycopersicum 460409461 XP_004250157.1 Solanum lycopersicum 460409465 XP_004250159.1 Solanum lycopersicum 462396388 EMJ02187.1 Prunus persica 462402118 EMJ07675.1 Prunus persica 462409359 EMJ14693.1 Prunus persica 462416923 EMJ21660.1 Prunus persica 46806235 BAD17459.1 Oryza sativa Japonica Group 470104266 XP_004288529.1 Fragaria vesca subsp. vesca 470142008 XP_004306714.1 Fragaria vesca subsp. vesca 475432777 EMT01232.1 Aegilops tauschii 51090402 BAD35324.1 Oryza sativa Japonica Group

TABLE-US-00003 TABLE 2 Internal GI number Accession Origin reference 460409128 XP.004249992.1 Solanum lycopersicum UGTSL 460386018 XP.004238697.1 Solanum lycopersicum — 460409134 XP.004249995.1 Solanum lycopersicum — 460410132 XP.004250485.1 Solanum lycopersicum UGTSL2 460410130 XP.004250484.1 Solanum lycopersicum — 460410128 XP.004250483.1 Solanum lycopersicum — 460378310 XP.004234916.1 Solanum lycopersicum — 209954733 BAG80557.1 Lycium barbarum UGTLB 209954725 BAG80553.1 Lycium barbarum

[0056] In one embodiment, the biocatalyst is a UGT76G1 variant that contains one or more point mutations found to improve conversion of rebaudioside A to rebaudioside I at least about 5% compared to use of the non-mutated UGT76G1 under the same conditions (wherein the results are normalized). In another embodiment, the biocatalyst is a UGT76G1 variant that contains one or more point mutations found to improve conversion of rebaudioside D to rebaudioside M at least about 5% compared to use of the non-mutated UGT76G1 under the same conditions (wherein the results are normalized).

[0057] In one embodiment, the biocatalyst is a purified UGT76G1 variant, i.e., a UGT76G1 provided in the form of a purified enzyme. In another particular embodiment, the biocatalysts is a UGT76G1 variant provided in the form of a crude lysate. In still another particular embodiment, the biocatalyst is a UGT76G1 variant provided in the form of a whole cell suspension.

[0058] In a particular embodiment, the biocatatlyst is purified UGT76G1containing one or more of the following point mutations: Q266E, P272A, R334K, G348P and L379G. In a more particular embodiment, the biocatalyst is UGT76G1 containing all of the following mutations: Q266E, P272A, R334K, G348P and L379G, i.e. the biocatalyst is UGT76G1-R1-F12. In a particular embodiment, the biocatalyst is UGT76G1-R1-F12 provided in the form of a purified enzyme. In another particular embodiment, the biocatalyst is UGT76G1-R1-F12 provided in the form of a crude lysate. In still another particular embodiment, the biocatalyst is UGT76G1-R1-F12 provided in the form of a whole cell suspension.

[0059] In another particular embodiment, the biocatalyst is UGT76G1 containing one or more of the following point mutations: Q266E, P272A, R334K, G348P, L379G, S42A, F46I, I190L, S274G, I295M, K303G, F314S, K316R, K393R, V394I, I407V, N409K, N409R, Q425E, Q432E, S447A and S456L. In a more particular embodiment, the biocatalyst is a UGT76G1 variant containing all of the above mutations, i.e. the biocatalyst is UGT76G1-R2-B9. In a particular embodiment, the biocatalyst is purified UGT76G1-R2-B9, i.e., UGT76G1-R2-B9 provided in the form of a purified enzyme. In another particular embodiment, the biocatalyst is UGT76G1-R2-B9 provided in the form of a lysate. In still another particular embodiment, the biocatalyst is UGT76G1-R2-B9 provided in the form of a whole cell suspension.

[0060] In still another particular embodiment, the biocatalyst is a UGT76G1 variant containing one or more of the following point mutations: Q266E, P272A, R334K, G348P, L379G, S42A, F46I, I190L, S274G, I295M, K303G, F314S, K316R, K393R, V394I, I407V, N409K, N409R, Q425E, Q432E, S447A, S456L, I46L, I295M, S119A, S274G, K334R, F314S, K303G, K316R, K393R, I190L, Q425E, Q432E, N138G, V394I, F182L, V407I, A272P, V264C, E449D and A352G. In a more particular embodiment, the biocatalyst is a UGT76G1 variant containing all of the above mutations, i.e. the biocatalyst is UGT76G1-R3-G3. In a particular embodiment, the biocatalyst is purified UGT76G1-R3-G3, i.e., UGT76G1-R3-G3 provided in the form of a purified enzyme. In another particular embodiment, the biocatalyst is UGT76G1-R3-G3 provided in the form of a crude lysate. In still another particular embodiment, the biocatalyst is UGT76G1-R3-G3 provided in the form of a whole cell suspension.

[0061] Utilization of a UGT76G1 variant as the biocatalyst in the method of the present invention results in increased conversion of rebaudioside A to rebaudioside I of at least about 5% compared to use of the non-mutated UGT76G1 under the same conditions (wherein the results are normalized). In preferred embodiments, conversion is increased from about 5% to about 1,000,000%, such as, for example, from about 5% to about 100,000%, from about 5% to about 10,000%, from about 5% to about 1,000%, from about 5% to about 500%, from about 5% to about 250%, from about 5% to about 100%, from about 50%, from about 20% to about 50%, from about 30% to about 50% or about 40% to about 50%.

[0062] Optionally, the methods of the present invention further comprise recycling UDP to provide UDP-glucose. Accordingly, the methods comprise concomitantly recycling UDP by providing a recycling catalyst, i.e., a catalyst capable of UDP-glucose overproduction, and a recycling substrate, such that the conversion of rebaudioside A to rebaudioside I is carried out using catalytic amounts of UDP-glucosyltransferase and UDP-glucose (FIG. 2).

[0063] In one embodiment, the UDP-glucose recycling catalyst is sucrose synthase and the recycling substrate is sucrose.

[0064] In a particular embodiment, the method of the present invention provides rebaudioside I composition comprising rebaudioside I in an amount of about 1% or greater by weight, such as, for example, about 5% or greater, about 10% or greater, about 20% or greater, about 30% or greater, about 40% or greater, about 50% or greater, about 60% or greater, about 70% or greater, about 80% or greater or about 90% or greater by weight.

[0065] In a particular embodiment, the method provides a composition comprising rebaudioside I in an amount of about 50% or greater by weight.

[0066] In another particular embodiment, the method provides a composition comprising rebaudioside I in an amount of about 80% or greater by weight.

[0067] In still another particular embodiment, the method provides a composition comprising rebaudioside I in an amount of about 90% or greater by weight.

[0068] In yet another particular embodiment, the method provides a composition comprising rebaudioside I in an amount of about 95% or greater by weight, such as, for example, about 96%, about 97%, about 98% or about 99% by weight.

[0069] Optionally, the method of the present invention further comprises separating rebaudioside I from the medium. Any suitable method separation method can be used, such as, for example, lysis, crystallization, separation by membranes, centrifugation, extraction (liquid or solid phase), chromatographic separation, HPLC (preparative or analytical) or a combination of such methods. In a particular embodiment, isolation can be achieved by lysis and centrifugation.

[0070] In one embodiment, rebaudioside I is continuously removed from the medium while the conversion progresses. In another embodiment, rebaudioside I is separated—and optionally purified—from the medium after completion of the reaction.

[0071] Separation from the medium can results in compositions having a lower rebaudioside I content than desired and/or the composition may contain additional components, e.g., non-desirable steviol glycosides (in identity or content) and/or residual reaction products. Accordingly, the composition can be further purified to provide a highly purified rebaudioside I composition. The term “highly purified”, as used herein, refers to a composition having greater than about 80% by weight rebaudioside I on a dry basis. In one embodiment, the highly purified rebaudioside I composition contains greater than about 90% rebaudioside I by weight, such as, for example, greater than about 91%, greater than about 92%, greater than about 93%, greater than about 94%, greater than about 95%, greater than about 96%, greater than about 97%, greater than about 98% or about 99% by rebaudioside I by weight. In exemplary embodiments, the composition can be further purified to provide a pure rebaudioside I, i.e., >99% by weight rebaudioside I on a dry basis.

[0072] Purification can be affected by any means known to one of skill in the art including, but not limited to, crystallization, separation by membranes, centrifugation, extraction (liquid or solid phase), chromatographic separation, HPLC (preparative or analytical) or a combination of such methods. In a particular embodiment, HPLC is used to purify rebaudioside I. In a more particular embodiment, semi-preparative HPLC is used to purify rebaudioside I.

[0073] In one embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a starting composition comprising rebaudioside A with an enzyme capable of transforming rebaudioside A to rebaudioside I to provide a composition comprising rebaudioside I and (b) separating rebaudioside I to provide a rebaudioside I composition (i.e., a separated rebaudioside I composition).

[0074] In a more particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a starting composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to form a composition comprising rebaudioside I and (b) separating rebaudioside I to provide a separated rebaudioside I composition. Exemplary UGT variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3. Optionally, the method comprises concomitant UDP-glucose recycling by providing sucrose synthase and sucrose in (a).

[0075] In another more particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a medium containing a starting composition comprising rebaudioside A with at least with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to form a composition comprising rebaudioside I and (b) separating rebaudioside I from the medium to provide separated rebaudioside I composition. Exemplary UGT variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3. Optionally, the method comprises concomitant UDP-glucose recycling by providing sucrose synthase and sucrose in (a).

[0076] In another embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a starting composition comprising rebaudioside A with an enzyme capable of transforming rebaudioside A to rebaudioside I to provide a composition comprising rebaudioside I, (b) separating rebaudioside I to provide a separated rebaudioside I composition and (c) purifying the separated rebaudioside I composition to provide a highly purified rebaudioside I composition.

[0077] In a still more particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a starting composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to form a composition comprising rebaudioside I, (b) separating rebaudioside I to provide a separated rebaudioside I composition and (c) purifying the separated rebaudioside I composition to provide a highly purified rebaudioside I composition. Optionally, the method comprises concomitant UDP-glucose recycling by providing sucrose synthase and sucrose in (a). Exemplary UGT variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0078] In another more particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a medium containing a starting composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to form a composition comprising rebaudioside I, (b) separating rebaudioside I from the medium to provide a separated rebaudioside I composition and (c) purifying the separated rebaudioside I composition to provide a highly purified rebaudioside I composition. Optionally, the method comprises concomitant UDP-glucose recycling by providing sucrose synthase and sucrose in (a). Exemplary UGT variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0079] In another embodiment, the present invention provides a method for preparing a highly purified rebaudioside I composition, comprising (a) contacting a starting composition comprising rebaudioside A with an enzyme capable of transforming rebaudioside A to rebaudioside I to provide a composition comprising rebaudioside I and (b) purifying the composition comprising rebaudioside I to provide a highly purified rebaudioside I composition.

[0080] In yet another particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a starting composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to form a composition comprising rebaudioside I and (b) purifying the composition comprising rebaudioside I to provide a highly purified rebaudioside I composition. Optionally, the method comprises concomitant UDP-glucose recycling by providing sucrose synthase and sucrose in (a). Exemplary UGT variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0081] In yet another particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a medium containing a starting composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to form a composition comprising rebaudioside I and (b) purifying the composition comprising rebaudioside I to provide a highly purified rebaudioside I composition. Optionally, the method comprises concomitant UDP-glucose recycling by providing sucrose synthase and sucrose in (a). Exemplary UGT variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0082] Fermentation can also be used for de-novo synthesis of rebaudioside I. For example, a method of producing a rebaudioside I composition, which comprises (a) contacting glucose with a microorganism containing at least one enzyme capable of converting glucose to rebaudioside I to provide a rebaudioside I composition, and (b) separating rebaudioside I to provide a separated rebaudioside I composition. Optionally, the method further comprises purifying rebaudioside I to provide highly purified rebaudioside I.

[0083] Fermentation and biocatalytic steps can be used sequentially. For example, fermentation of a composition comprising glucose with a microorganism containing at least one enzyme capable of converting glucose to a target steviol glycoside, e.g. rebaudioside A, can be performed first. The target steviol glycoside, e.g. rebaudioside A (which now becomes the starting material for the purposes of the next bioconversion), can then be contacted with a biocatalyst capable of converting it to the next target steviol glycoside, e.g. rebaudioside I.

[0084] Between each conversion the target steviol glycoside may optionally be separated from the medium prior to contacting with the next biocatalyst.

[0085] In one embodiment, the rebaudioside A of the starting composition for the present method is prepared by contacting stevioside with an enzyme capable of converting stevioside to rebaudioside A. In a particular embodiment, the enzyme is any UDP-glucosyltransferase capable of adding at least one glucose unit thereto, thereby producing rebaudioside A. The UDP-glucosyltransferase may be, for example, UGT76G1.

[0086] Accordingly, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a composition comprising stevioside with an enzyme capable of transforming stevioside to rebaudioside A to provide a composition comprising rebaudioside A, (b) separating rebaudioside A, (c) contacting a composition comprising rebaudioside A with an enzyme capable of transforming rebaudioside A to rebaudioside I to provide a composition comprising rebaudioside I and (d) separating rebaudioside I to provide a separated rebaudioside I composition. The method may further comprise purifying the separated rebaudioside I composition to provide highly purified rebaudioside I.

[0087] In a more particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a composition comprising stevioside with UGT76G1 and UDP-glucose to provide a composition comprising rebaudioside A, (b) separating rebaudioside A, (c) contacting a composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising rebaudioside I and (d) separating rebaudioside I to provide a separated rebaudioside I composition. The method may further comprise purifying the separated rebaudioside I composition to provide a highly purified rebaudioside I composition. Optionally, the method comprises concomitant UDP-glucose recycling in one or both of the contacting steps by providing sucrose synthase and sucrose. Exemplary UGT variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0088] In another more particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a medium containing a composition comprising stevioside with UGT76G1 and UDP-glucose to provide a composition comprising rebaudioside A, (b) separating rebaudioside A from the medium, (c) contacting a medium containing a composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising rebaudioside I and (d) separating rebaudioside I from the medium to provide a separated rebaudioside I composition. The method may further comprise purifying the separated rebaudioside I composition to provide a highly purified rebaudioside I composition. Optionally, the method comprises concomitant UDP-glucose recycling in one or both of the contacting steps by providing sucrose synthase and sucrose. Exemplary UGT variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0089] In another embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a composition comprising glucose with a microorganism comprising at least one enzyme capable of converting glucose to rebaudioside A to provide a composition comprising rebaudioside A, (b) separating rebaudioside A, (c) contacting a composition comprising rebaudioside A an enzyme capable of transforming rebaudioside A to rebaudioside I to provide a composition comprising rebaudioside I and (d) separating rebaudioside I from the medium to provide a separated rebaudioside I composition. The method may further comprise purifying the separated rebaudioside I composition to provide a highly purified rebaudioside I composition.

[0090] In a more particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a composition comprising glucose with a microorganism comprising at least one enzyme capable of converting glucose to rebaudioside A to provide a composition comprising rebaudioside A, (b) separating rebaudioside A, (c) contacting a composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising rebaudioside I and (d) separating rebaudioside I to provide a separated rebaudioside I composition. The method may further comprise purifying the separated rebaudioside I composition to provide highly purified rebaudioside I. Optionally, the method comprises concomitant UDP-glucose recycling in one or both of the contacting steps by providing sucrose synthase and sucrose. Exemplary UGT variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0091] In another more particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a medium containing a composition comprising glucose with a microorganism comprising at least one enzyme capable of converting glucose to rebaudioside A to provide a composition comprising rebaudioside A, (b) separating rebaudioside A from the medium, (c) contacting a medium containing a composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising rebaudioside I and (d) separating rebaudioside I from the medium to provide a separated rebaudioside I composition. The method may further comprise purifying the separated rebaudioside I composition to provide highly purified rebaudioside I. Optionally, the method comprises concomitant UDP-glucose recycling in one or both of the contacting steps by providing sucrose synthase and sucrose. Exemplary UGT variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0092] In one embodiment, the stevioside is prepared by contacting rubusoside with an enzyme capable of converting rubusoside to stevioside. In a particular embodiment, the enzyme is any UDP-glucosyltransferase capable adding at least one glucose unit to rubusoside, thereby producing stevioside. The UDP-glucosyltransferase may be, for example, UGT91D2 or variants thereof having about 75% or greater amino acid sequence identity. Exemplary UGT91D2 variants include, but are not limited to, UGTSL and UGTSL2.

[0093] Accordingly, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a composition comprising rubusoside with an enzyme capable of transforming rubusoside to stevioside, (b) separating stevioside, (c) contacting a composition comprising stevioside with an enzyme capable of transforming stevioside to rebaudioside A to provide a composition comprising rebaudioside A, (d) separating rebaudioside A, (e) contacting a composition comprising rebaudioside A with an enzyme capable of transforming rebaudioside A to rebaudioside I to provide a composition comprising rebaudioside I and (d) separating rebaudioside I to provide a separated rebaudioside I composition. The method may further comprise purifying the separated rebaudioside I composition to provide highly purified rebaudioside I.

[0094] In a more particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a composition comprising rubusoside with UGT91D2, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising stevioside, (b) separating stevioside, (c) contacting a composition comprising stevioside with UGT76G1 and UDP-glucose to provide a composition comprising rebaudioside A, (d) separating rebaudioside A, (e) contacting a composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising rebaudioside I and (f) separating rebaudioside I to provide a separated rebaudioside I composition. The method may further comprise purifying the separated rebaudioside I composition to provide a highly purified rebaudioside I composition. Optionally, the method comprises concomitant UDP-glucose recycling in any or all of the contacting steps by providing sucrose synthase and sucrose. Exemplary UGT91D2 variants include, but are not limited to, UGTSL and UGTSL2. Exemplary UGT76G1 variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0095] In another more particular embodiment, the present invention provides a method for preparing a rebaudioside I composition, comprising (a) contacting a medium containing a composition comprising rubusoside with UGT91D2, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising stevioside, (b) separating stevioside from the medium, (c) contacting a medium containing a composition comprising stevioside with UGT76G1 and UDP-glucose to provide a composition comprising rebaudioside A, (d) separating rebaudioside A from the medium, (e) contacting a medium containing a composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising rebaudioside I and (f) separating rebaudioside I from the medium. The method may further comprise purifying the separated rebaudioside I composition to provide highly purified rebaudioside I. Optionally, the method comprises concomitant UDP-glucose recycling in any or all of the contacting steps by providing sucrose synthase and sucrose. Exemplary UGT91D2 variants include, but are not limited to, UGTSL and UGTSL2. Exemplary UGT76G1 variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0096] The present invention also provides a method for preparing a rebaudioside I composition, comprising (a) contacting a composition comprising glucose with a microorganism capable of converting glucose to rubusoside, (b) separating rubusoside, (c) contacting a composition comprising rubusoside with an enzyme capable of converting rubusoside to stevioside to provide a composition comprising stevioside, (d) separating stevioside, (e) contacting a composition comprising stevioside with an enzyme capable of converting stevioside to rebaudioside A to provide a composition comprising rebaudioside A, (f) separating rebaudioside A, (g) contacting a composition comprising rebaudioside A with an enzyme capable of converting rebaudioside A to rebaudioside I to provide a composition comprising rebaudioside I and (h) separating rebaudioside I. The method may further comprise purifying the separated rebaudioside I composition to provide highly purified rebaudioside I.

[0097] In a more particular embodiment, the present invention also provides a method for preparing a rebaudioside I composition, comprising (a) contacting a composition comprising glucose with a microorganism capable of converting glucose to rubusoside, (b) separating rubusoside, (c) contacting a composition comprising rubusoside with UGT91D2, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising stevioside, (d) separating stevioside, (e) contacting a composition comprising stevioside with UGT76G1 and UDP-glucose to provide a composition comprising rebaudioside A, (f) separating rebaudioside A, (g) contacting a composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising rebaudioside I and (h) separating rebaudioside I to provide a separated rebaudioside I composition. The method may further comprise purifying the separated rebaudioside I composition to provide highly purified rebaudioside I. Optionally, the method comprises concomitant UDP-glucose recycling in one, two or all of the contacting steps by providing sucrose synthase and sucrose. Exemplary UGT91D2 variants include, but are not limited to, UGTSL and UGTSL2. Exemplary UGT76G1 variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0098] In another more particular embodiment, the present invention also provides a method for preparing a rebaudioside I composition, comprising (a) contacting a medium containing a composition comprising glucose with a microorganism capable of converting glucose to rubusoside, (b) separating rubusoside from the medium, (c) contacting a medium containing a composition comprising rubusoside with UGT91D2, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising stevioside, (d) separating stevioside from the medium, (e) contacting a medium containing a composition comprising stevioside with UGT76G1 and UDP-glucose to provide a composition comprising rebaudioside A, (f) separating rebaudioside A from the medium, (g) contacting a medium containing composition comprising rebaudioside A with UGT76G1, or a variant thereof having about 75% or greater amino acid sequence identity, and UDP-glucose to provide a composition comprising rebaudioside I and (h) separating rebaudioside I from the medium to provide a separated rebaudioside I composition. The method may further comprise purifying the separated rebaudioside I composition to provide highly purified rebaudioside I. Optionally, the method comprises concomitant UDP-glucose recycling in any or all of the contacting steps by providing sucrose synthase and sucrose. Exemplary UGT91D2 variants include, but are not limited to, UGTSL and UGTSL2. Exemplary UGT76G1 variants include, but are not limited to, UGT76G1-R1-F12, UGT76G1-R2-B9 and UGT76G1-R3-G3.

[0099] Compounds and Compositions

[0100] The present invention provides rebaudioside I having the following formula:

##STR00001##

(13-[(2-β-D-D-glucopyranosyl-3-O-β-D-glucopyranosyl)-β-D-glucopyranosyl)oxy]ent-kaur-16-en-19-oic acid-(3-O-β-D-glucopyranosyl)-β-D-glucopyranosyl) ester] (Rebaudioside I)

[0101] In exemplary embodiments, the rebaudioside I may be isolated and pure (i.e., >99% rebaudioside I by weight on a dry basis) or isolated and highly purified (i.e., greater than about 80% by weight on a dry basis).

[0102] The present invention includes compositions, particularly consumables, comprising rebaudioside I.

[0103] In one embodiment, the composition comprises rebaudioside I provided as part of a mixture. In a particular embodiment, the mixture is selected from the group consisting of a mixture of steviol glycosides, a Stevia extract, by-products of other steviol glycosides' isolation and purification processes, or any combination thereof. In one embodiment, the mixture contains rebaudioside I in an amount that ranges from about 1% to about 99% by weight on a dry basis, such as, for example, from about 2% to about 99%, from about 3% to about 99%, from about 4% to about 99%, from about 5% to about 99%, from about 10% to about 99%, from about 20% to about 99%, from about 30% to about 99%, from about 40% to about 99%, from about 50% to about 99%, from about 60% to about 99%, from about 70% to about 99%, from about 80% to about 99% and from about 90% to about 99%. In a particular embodiment, the mixture contains rebaudioside I in an amount greater than about 90% by weight on a dry basis, for example, greater than about 91%, greater than about 92%, greater than about 93%, greater than about 94%, greater than about 95%, greater than about 96%, greater than about 97%, greater than about 98% and greater than about 99%.

[0104] In one embodiment, the composition comprises rebaudioside I, provided in the form of a Stevia extract. The Stevia extract contains one or more additional steviol glycosides including, but not limited to, naturally occurring steviol glycosides, e.g. steviolmonoside, steviolbioside, rubusoside, dulcoside B, dulcoside A, rebaudioside B, rebaudioside G, stevioside, rebaudioside C, rebaudioside F, rebaudioside A, rebaudioside I, rebaudioside E, rebaudioside H, rebaudioside L, rebaudioside K, rebaudioside J, rebaudioside M, rebaudioside M2, rebaudioside D, rebaudioside D2, rebaudioside N, rebaudioside O, synthetic steviol glycosides, e.g. enzymatically glucosylated steviol glycosides and combinations thereof.

[0105] In still another embodiment, the present invention provides rebaudioside I as a pure compound, i.e. >99% purity on a dry basis.

[0106] Rebaudioside I can be present in the composition in an amount effective to provide a concentration from about 1 ppm to about 10,000 ppm when the composition is added to a consumable, such as, for example, from about 5 ppm to about 10,000 ppm, from about 10 ppm to about 10,000 ppm, from about 15 ppm to about 10,000 ppm, from about 20 ppm to about 10,000 ppm, from about 25 ppm to about 10,000 ppm, from about 50 ppm to about 10,000 ppm, from about 100 ppm to about 10,000 ppm, from about 200 ppm to about 10,000 ppm, from about 300 ppm to about 10,000 ppm, from about 400 ppm to about 10,000 ppm, from about 500 ppm to about 10,000 ppm, from about 600 ppm to about 10,000 ppm, from about 700 ppm to about 10,000 ppm, from about 800 to about 10,000 ppm, from about 900 ppm to about 10,000 ppm, from about 1,000 ppm to about 10,000 ppm, from about 2,000 ppm to about 10,000 ppm, from about 3,000 ppm to about 10,000 ppm, from about 4,000 ppm to about 10,000 ppm, from about 5,000 ppm to about 10,000 ppm.

[0107] In another embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration from about 10 ppm to about 1,000 ppm when the composition is added to a consumable, such as, for example, from about 10 ppm to about 800 ppm, from about 50 ppm to about 800 ppm, from about 50 ppm to about 600 ppm or from about 200 ppm to about 250 ppm. In a particular embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration from about 300 ppm to about 600 ppm when the composition is added to a consumable.

[0108] In a particular embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration from about 50 ppm to about 800 ppm when the composition is added to a consumable, such as, for example, from about 50 ppm to about 100 ppm, about 100 ppm to about 150 ppm, about 200 ppm to about 250 ppm, about 250 ppm to about 300 ppm, from about 300 ppm to about 350 ppm, about 350 ppm to about 400 ppm, from about 400 ppm to about 450 ppm, about 450 ppm to about 500 ppm, about 500 ppm to about 550 ppm, about 550 ppm to about 600 ppm, about 600 ppm to about 650 ppm, about 650 ppm to about 700 ppm, about 700 ppm to about 750 ppm or about 750 ppm to about 800 ppm.

[0109] In an exemplary embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration of between about 200 ppm and about 300 ppm when the composition is added to a beverage.

[0110] In an exemplary embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration of between about 500 ppm and about 600 ppm when the composition is added to a beverage.

[0111] In another particular embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration about 50 ppm, about 100 ppm, about 150 ppm, about 200 ppm, about 250 ppm, about 300 ppm, about 350 ppm, about 400 ppm, about 450 ppm, about 500 ppm, about 550 ppm, about 600 ppm, about 650 ppm, about 700 ppm, about 750 ppm or about 800 pm when the composition is added to a consumable.

[0112] In an exemplary embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration of about 200 ppm when the composition is added to a beverage.

[0113] In an exemplary embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration of about 275 ppm when the composition is added to a beverage.

[0114] In an exemplary embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration of about 550 ppm when the composition is added to a beverage.

[0115] In an exemplary embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration of about 600 ppm when the composition is added to a beverage.

[0116] In exemplary embodiments, the isolated and purified rebaudioside I or the composition containing rebaudioside I exhibit less sweet linger intensity than rebaudioside M. In a particular embodiment, isolated and purified rebaudioside I or a composition containing rebaudioside I exhibit about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45% or about 50% less sweetness linger intensity than rebaudioside M.

[0117] Sweetener Compositions

[0118] In one embodiment, the present invention is a sweetener composition comprising rebaudioside I. In a more particular embodiment, the present invention is a sweetener composition comprising highly purified or pure rebaudioside I.

[0119] “Sweetener composition,” as used herein, refers to a composition useful to sweeten a sweetenable composition (i.e. a composition that can be sweetened) that contains at least one sweet component in combination with at least one other substance.

[0120] In one embodiment, rebaudioside I is the sole sweetener in the sweetener composition, i.e. rebaudioside I is the only compound present in the sweetener composition that provides a detectable sweetness. In another embodiment, the sweetener composition includes a compound of rebaudioside I in combination with one or more sweetener compounds.

[0121] In an exemplary embodiment, the sweetner composition comprises rebaudioside I and compound selected from the group consisting of Reb A, B, C, D, E, M, N, O, M2, D2, glycosylated steviol glycosides, Mogroside V, erythritol, allulose, Stevia Extract, Luo Han Guo extract and combinations thereof.

[0122] The amount of rebaudioside I in the sweetener composition may vary. In one embodiment, rebaudioside I is present in a sweetener composition in any amount to impart the desired sweetness when the sweetener composition is added to a sweetenable composition or sweetenable consumable.

[0123] The sweetness of a non-sucrose sweetener can also be measured against a sucrose reference by determining the non-sucrose sweetener's sucrose equivalence. Typically, taste panelists are trained to detect sweetness of reference sucrose solutions containing between 1-15% sucrose (w/v). Other non-sucrose sweeteners are then tasted at a series of dilutions to determine the concentration of the non-sucrose sweetener that is as sweet as a given percent sucrose reference. For example, if a 1% solution of a sweetener is as sweet as a 10% sucrose solution, then the sweetener is said to be 10 times as potent as sucrose.

[0124] In one embodiment, rebaudioside I is present in the sweetener composition in an amount effective to provide a sucrose equivalence of greater than about 10% (w/v) when the sweetener composition is added to a sweetenable composition or sweetenable consumable, such as, for example, greater than about 11%, greater than about 12%, greater than about 13% or greater than about 14%.

[0125] The amount of sucrose, and thus another measure of sweetness, in a reference solution may be described in degrees Brix (° Bx). One degree Brix is 1 gram of sucrose in 100 grams of solution and represents the strength of the solution as percentage by weight (% w/w) (strictly speaking, by mass). In one embodiment, a sweetener composition comprises rebaudioside I in an amount effective to provide sweetness equivalent from about 0.50 to 14 degrees Brix of sugar when present in a sweetened composition, such as, for example, from about 5 to about 11 degrees Brix, from about 4 to about 7 degrees Brix, or about 5 degrees Brix. In yet another embodiment a composition comprising rebaudioside I is present with at least one other sweetener in an amount effective to provide any one of the sweetness equivalents listed above.

[0126] In one embodiment, rebaudioside I is present in the sweetener composition in an amount effective to provide a concentration from about 1 ppm to about 10,000 ppm when the sweetener composition is added to a consumable (e.g. a beverage), such as, for example, from about 5 ppm to about 10,000 ppm, from about 10 ppm to about 10,000 ppm, from about 15 ppm to about 10,000 ppm, from about 20 ppm to about 10,000 ppm, from about 25 ppm to about 10,000 ppm, from about 50 ppm to about 10,000 ppm, from about 100 ppm to about 10,000 ppm, from about 200 ppm to about 10,000 ppm, from about 300 ppm to about 10,000 ppm, from about 400 ppm to about 10,000 ppm, from about 500 ppm to about 10,000 ppm, from about 600 ppm to about 10,000 ppm, from about 700 ppm to about 10,000 ppm, from about 800 to about 10,000 ppm, from about 900 ppm to about 10,000 ppm, from about 1,000 ppm to about 10,000 ppm, from about 2,000 ppm to about 10,000 ppm, from about 3,000 ppm to about 10,000 ppm, from about 4,000 ppm to about 10,000 ppm, from about 5,000 ppm to about 10,000 ppm. In another embodiment, rebaudioside I is present in the sweetener composition in an amount effective to provide a concentration from about 10 ppm to about 1,000 ppm when the sweetener composition is added to a consumable, such as, for example, from about 10 ppm to about 800 ppm, from about 50 ppm to about 800 ppm, from about 50 ppm to about 600 ppm or from about 200 ppm to about 250 ppm. In a particular embodiment, rebaudioside I is present in the sweetener composition in an amount effective to provide a concentration from about 300 ppm to about 600 ppm when the sweetener composition is added to a consumable.

[0127] In one embodiment, rebaudioside I is present in the sweetener composition in an amount effective to provide a concentration of about between about 400 and about 800 ppm when the sweetner composition is added to a consumable, such as, for example, from about 50 ppm to about 100 ppm, about 100 ppm to about 150 ppm, about 200 ppm to about 250 ppm, about 250 ppm to about 300 ppm, from about 300 ppm to about 350 ppm, about 350 ppm to about 400 ppm, from about 400 ppm to about 450 ppm, about 450 ppm to about 500 ppm, about 500 ppm to about 550 ppm, about 550 ppm to about 600 ppm, about 600 ppm to about 650 ppm, about 650 ppm to about 700 ppm, about 700 ppm to about 750 ppm or about 750 ppm to about 800 ppm.

[0128] In an exemplary embodiment, rebaudioside I is present in the sweetener composition in an amount effective to provide a concentration of about between about 400 and about 800 ppm when the sweetener composition is added to a beverage.

[0129] In an exemplary embodiment, rebaudioside I is present in the sweetener composition in an amount effective to provide a concentration of about between about 500 and about 600 ppm when the sweetener composition is added to a beverage.

[0130] Where the sweetener composition includes rebaudioside I in combination with one or more sweetener compounds, the amount of the sweetener compound may vary. In one embodiment, the sweetener composition is present in the sweetener composition in an amount effective to provide a concentration of between about 1% and about 20% when the sweetener compound is added to a consumable, such as, for example, between about 1% and about 5%, between about 5% and about 10%, between about 10% and about 15%, between about 15% and about 20%, or more particularly, about 1%, about 2%, about 3%, about 4% or about 5%.

[0131] In an exemplary embodiment, the present invention provides a sweetener composition comprising (i) rebaudioside I in an amount effective to provide a concentration of about between about 500 and about 600 ppm when the sweetener composition is added to a beverage; and (ii) a compound selected from the group consisting of Reb A, B, C, D, E, M, N, O, M2, D2, glycosylated steviol glycosides, Mogroside V, erythritol, allulose, Stevia Extract, Luo Han Guo extract and combinations thereof.

[0132] In an exemplary embodiment, the present invention provides a sweetener composition comprising (i) rebaudioside I in an amount effective to provide a concentration of about between about 500 and about 600 ppm when the sweetener composition is added to a beverage; and (ii) allulose in an amount effective to provide a concentration of between about 1% and about 5% when the sweetener composition is added to the beverage.

[0133] In another embodiment, is present in the sweetener composition in an amount effective to provide a concentration about 50 ppm, about 100 ppm, about 150 ppm, about 200 ppm, about 250 ppm, about 300 ppm, about 350 ppm, about 400 ppm, about 450 ppm, about 500 ppm, about 550 ppm, about 600 ppm, about 650 ppm, about 700 ppm, about 750 ppm or about 800 pm when the sweetener composition is added to a consumable.

[0134] In an exemplary embodiment, rebaudioside I is present in the sweetener composition in an amount effective to provide a concentration of about 550 ppm when the composition is added to a beverage. Optionally, the sweetener composition also includes allulose, for example, between about 1% and about 5%, or more particularly, about 3.5%.

[0135] In an exemplary embodiment, rebaudioside I is present in the sweetener composition in an amount effective to provide a concentration of about 600 ppm when the composition is added to a beverage. Optionally, the sweetener composition also includes allulose, for example, between about 1% and about 5%, or more particularly, about 3.5%.

[0136] In exemplary embodiments, the sweetener composition comprising rebaudioside I exhibit less sweet linger intensity than rebaudioside M, or a sweetener composition comprising the same. In a particular embodiment, isolated and purified rebaudioside I or a composition containing rebaudioside I exhibit about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45% or about 50% less sweetness linger intensity than rebaudioside M, or a sweetener composition comprising the same.

[0137] In some embodiments, rebaudioside I is present in the sweetener composition in an amount effective to provide a concentration of the compound that is above, at or below its threshold sweetener recognition level when the sweetener composition is added to a consumable (e.g., a beverage).

[0138] Flavor Enhancing Compositions

[0139] In one aspect, the present invention is a flavor enhancing composition comprising rebaudioside I. In a particular embodiment, the present invention is a flavor enhancing composition comprising isolated and purified rebaudioside I.

[0140] “Flavor enhancer compositions,” as used herein, refers to a composition capable of enhancing or intensifying the perception of a particular flavor in a consumable. The terms “flavor enhancing compositions” or “flavor enhancer” are synonymous with the terms “flavor potentiator,” “flavor amplifier,” and “flavor intensifier.” Generally, the flavor enhancing composition provided herein may enhance or potentiate the taste of flavor ingredients, i.e. any substance that provides sweetness, sourness, saltiness, savoriness, bitterness, metallic taste, astringency, sweet lingering aftertaste, sweetness onset, etc. Without being bound by any theory, the flavor enhancing composition likely does not contribute any noticeable taste to the consumable to which it is added because rebaudioside I is present in the consumable in a concentration at or below its flavor recognition threshold concentration.

[0141] “Flavor recognition threshold concentration,” as used herein, refers to the lowest concentration at which the particular flavor or off-taste of a component (e.g., a compound) is perceptible in a consumable. The flavor recognition threshold concentration varies for different compounds, and may be varied with respect to the individual perceiving the flavor or the particular consumable.

[0142] In one embodiment, the flavor enhancing composition comprises rebaudioside I in an amount effective to provide a concentration that is at or below the threshold flavor recognition concentration of rebaudioside I when the flavor enhancing composition is added to a consumable.

[0143] In a particular embodiment, rebaudioside I is present in the flavor-enhancing composition in an amount effective to provide a concentration that is below the threshold flavor recognition concentration of rebaudioside I when the flavor enhancing composition is added to a consumable.

[0144] In certain embodiment, rebaudioside I is present in the flavor enhancing composition in an amount effective to provide a concentration that is at least about 1%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45% or at least about 50% or more below the threshold flavor recognition concentration when the flavor enhancing composition is added to a consumable.

[0145] In some embodiments, rebaudioside I is present in the flavor enhancing composition in an amount that, when added to the consumable (e.g. a beverage), will provide a concentration of ranging from 1 ppm to about 10,000 ppm, such as, for example, from about 5 ppm to about 10,000 ppm, from about 10 ppm to about 10,000 ppm, from about 15 ppm to about 10,000 ppm, from about 20 ppm to about 10,000 ppm, from about 25 ppm to about 10,000 ppm, from about 50 ppm to about 10,000 ppm, from about 100 ppm to about 10,000 ppm, from about 200 ppm to about 10,000 ppm, from about 300 ppm to about 10,000 ppm, from about 400 ppm to about 10,000 ppm, from about 500 ppm to about 10,000 ppm, from about 600 ppm to about 10,000 ppm, from about 700 ppm to about 10,000 ppm, from about 800 to about 10,000 ppm, from about 900 ppm to about 10,000 ppm, from about 1,000 ppm to about 10,000 ppm, from about 2,000 ppm to about 10,000 ppm, from about 3,000 ppm to about 10,000 ppm, from about 4,000 ppm to about 10,000 ppm, from about 5,000 ppm to about 10,000 ppm. In some embodiments, rebaudioside I is present in the flavor enhancing composition in an amount that, when added to the consumable (e.g. a beverage), will provide a concentration of ranging from 1 ppm to about 1,000 ppm, such as, for example, from about 5 ppm to about 1,000 ppm, from about 10 ppm to about 1,000 ppm, from about 20 ppm to about 1,000 ppm, from about 30 ppm to about 1,000 ppm, from about 40 ppm to about 1,000 ppm, from about 50 ppm to about 1,000 ppm, from about 100 ppm to about 1,000 ppm, from about 200 ppm to about 1,000 ppm, from about 300 ppm to about 1,000 ppm, from about 400 ppm to about 1,000 ppm and from about 500 ppm to about 1,000 ppm.

[0146] A person of skill in the art will be able to select the concentration of rebaudioside I in the flavor enhancing composition so that it may impart an enhanced flavor to a consumable comprising at least one flavor ingredient. For example, a skilled artisan may select a concentration for rebaudioside I in the flavor enhancing composition so that the flavor enhancing composition and/or the rebaudioside I does not impart any perceptible flavor to a consumable when the flavor enhancing composition is added thereto.

[0147] In one embodiment, addition of the flavor enhancing composition increases the detected flavor of the at least one flavor ingredient in the consumable compared to the detected flavor of the same ingredient in the consumable in the absence of the flavor enhancer.

[0148] Suitable flavor ingredients include, but are not limited to, vanillin, vanilla extract, mango extract, cinnamon, citrus, coconut, ginger, viridiflorol, almond, menthol (including menthol without mint), grape skin extract, and grape seed extract. “Flavorant” and “flavoring ingredient” are synonymous and can include natural or synthetic substances or combinations thereof. Flavorants also include any other substance which imparts flavor and may include natural or non-natural (synthetic) substances which are safe for human or animals when used in a generally accepted range. Non-limiting examples of proprietary flavorants include Döhler™ Natural Flavoring Sweetness Enhancer K14323 (Döhler™, Darmstadt, Germany), Symrise™ Natural Flavor Mask for Sweeteners 161453 and 164126 (Symrise™, Holzminden, Germany), Natural Advantage™ Bitterness Blockers 1, 2, 9 and 10 (Natural Advantage™, Freehold, N.J., U.S.A.), and Sucramask™ (Creative Research Management, Stockton, Calif., U.S.A.).

[0149] In another embodiment, the flavor enhancer composition comprising rebaudioside I enhances flavors (either individual flavors or the overall flavor) when added to the consumable. Alternatively, rebaudioside I may be added directly to the consumable, i.e., not provided in the form of a composition, to enhance flavor. In this embodiment, rebaudioside I is a flavor enhancer and it is added to the consumable at a concentration at or below its threshold flavor recognition concentration.

[0150] In a particular embodiment, the flavor enhancing composition is a sweetness enhancing composition. “Sweetness enhancing composition,” as used herein, refers to a composition capable of enhancing or intensifying the perception of sweet taste of a consumable, such as a beverage. The term “sweetness enhancer” is synonymous with the terms “sweet taste potentiator,” “sweetness potentiator,” “sweetness amplifier,” and “sweetness intensifier.”

[0151] “Sweetness recognition threshold concentration,” as used herein, is the lowest known concentration of a sweet compound that is perceivable by the human sense of taste. Generally, the sweetness enhancing composition of the present invention may enhance or potentiate the sweet taste of a consumable without providing any noticeable sweet taste itself because the concentration of rebaudioside I in the sweetness enhancing composition is at or below its sweetness recognition threshold concentration, either in the sweetness enhancing compositions, the consumable after the sweetness enhancing composition has been added, or both. The sweetness recognition threshold concentration is specific for a particular compound, and can vary based on temperature, matrix, ingredients and/or flavor system.

[0152] In one embodiment, a sweetness enhancing composition comprises rebaudioside I in an amount effective to provide a concentration that is at or below the threshold sweetness recognition concentration of rebaudioside I when the sweetness enhancing composition is added to a consumable.

[0153] In a particular embodiment, a sweetness enhancing composition comprises rebaudioside I in an amount effective to provide a concentration that is below the threshold sweetness recognition concentration of rebaudioside I when the sweetness enhancing composition is added to a consumable.

[0154] In certain embodiments, rebaudioside I is present in the sweetness enhancing composition in an amount effective to provide a concentration that is at least about 1%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45% or at least about 50% or more below the threshold sweetness recognition concentration of rebaudioside I when the sweetness enhancing composition is added to a consumable.

[0155] In some embodiments, rebaudioside I is present in the sweetness enhancing composition in an amount that, when added to the consumable (e.g. a beverage), will provide a concentration from about 1 ppm to about 10,000 ppm, such as, for example, from about 5 ppm to about 10,000 ppm, from about 10 ppm to about 10,000 ppm, from about 15 ppm to about 10,000 ppm, from about 20 ppm to about 10,000 ppm, from about 25 ppm to about 10,000 ppm, from about 50 ppm to about 10,000 ppm, from about 100 ppm to about 10,000 ppm, from about 200 ppm to about 10,000 ppm, from about 300 ppm to about 10,000 ppm, from about 400 ppm to about 10,000 ppm, from about 500 ppm to about 10,000 ppm, from about 600 ppm to about 10,000 ppm, from about 700 ppm to about 10,000 ppm, from about 800 to about 10,000 ppm, from about 900 ppm to about 10,000 ppm, from about 1,000 ppm to about 10,000 ppm, from about 2,000 ppm to about 10,000 ppm, from about 3,000 ppm to about 10,000 ppm, from about 4,000 ppm to about 10,000 ppm, from about 5,000 ppm to about 10,000 ppm. In some embodiments, rebaudioside I is present in the sweetness enhancing composition in an amount that, when added to the consumable (e.g. a beverage), will provide a concentration of ranging from 1 ppm to about 1,000 ppm, such as, for example, from about 5 ppm to about 1,000 ppm, from about 10 ppm to about 1,000 ppm, from about 20 ppm to about 1,000 ppm, from about 30 ppm to about 1,000 ppm, from about 40 ppm to about 1,000 ppm, from about 50 ppm to about 1,000 ppm, from about 100 ppm to about 1,000 ppm, from about 200 ppm to about 1,000 ppm, from about 300 ppm to about 1,000 ppm, from about 400 ppm to about 1,000 ppm and from about 500 ppm to about 1,000 ppm.

[0156] Alternatively, rebaudioside I may be added directly to the consumable, i.e., not provided in the form of a composition, to enhance sweetness. In this embodiment, rebaudioside I is a sweetness enhancer and it is added to the consumable at a concentration at or below its sweetness recognition threshold concentration.

[0157] The sweetness of a given composition is typically measured with reference to a solution of sucrose. See generally “A Systematic Study of Concentration-Response Relationships of Sweeteners,” G. E. DuBois, D. E. Walters, S. S. Schiffman, Z. S. Warwick, B. J. Booth, S. D. Pecore, K. Gibes, B. T. Carr, and L. M. Brands, in Sweeteners: Discovery, Molecular Design and Chemoreception, D. E. Walters, F. T. Orthoefer, and G. E. DuBois, Eds., American Chemical Society, Washington, D.C. (1991), pp 261-276.

[0158] It is contemplated that the sweetness enhancing composition can include one or more sweetness enhancers in addition to rebaudioside I. In one embodiment, the sweetness enhancing composition can include one additional sweetness enhancer. In other embodiments, the sweetness enhancing composition can include two or more additional sweetness enhancers. In embodiments where two or more sweetness enhancers are utilized, each sweetness enhancer should be present below its respective sweetness recognition threshold concentration.

[0159] Suitable sweetness enhancers include, but are not limited to, the group consisting of 2-hydroxybenzoic acid, 3-hydroxybenzoic acid, 4-hydroxybenzoic acid, 2,4-dihydroxybenzoic acid, 3,4-dihydroxybenzoic acid, 2,5-dihydroxybenzoic acid, 2,6-dihydroxybenzoic acid, 2,3,4-trihydroxybenzoic acid, 2,4,6-trihydroxybenzoic acid, 3-aminobenzoic acid, 4-aminobenzoic acid, FEMA GRAS enhancer 4469, FEMA GRAS enhancer 4701, FEMA GRAS enhancer 4720, FEMA GRAS enhancer 4774, FEMA GRAS enhancer 4708, FEMA GRAS enhancer 4728, FEMA GRAS enhancer 4601 and combinations thereof.

[0160] In one embodiment, addition of the sweetness enhancer(s) increases the detected sucrose equivalence of the at least one sweetener in a consumable compared to the sucrose equivalence of the same consumable in the absence of the sweetness enhancer.

[0161] More specifically, use of the rebaudioside I and, optionally, one or more other sweetness enhancers (alone or in the form of a composition) in a consumable (e.g. a beverage), provides a detected sucrose equivalence at least about 0.5% greater than the sucrose equivalence of a corresponding consumable (e.g. a beverage) in the absence of the rebaudioside I and, optionally, one or more other sweetness enhancers. For example, the detected sucrose equivalence of a consumable (e.g. a beverage) containing rebaudioside I and, optionally, one or more other sweetness enhancers (alone or in the form of a composition) may be at least about 1.0%, about 1.5%, about 2.0%, about 2.5%, about 3.0%, about 3.5%, about 4.5%, about 5.0% or about 5.5% or more greater than the sucrose equivalence of a corresponding consumable in the absence of the rebaudioside I and, optionally, one or more other sweetness enhancers.

[0162] Suitable sweeteners include, but are not limited to, sucrose, glyceraldehyde, dihydroxyacetone, erythrose, threose, erythrulose, arabinose, lyxose, ribose, xylose, ribulose, xylulose, allose, altrose, galactose, glucose, gulose, idose, mannose, talose, fructose, psicose, sorbose, tagatose, mannoheptulose, sedoheltulose, octolose, fucose, rhamnose, arabinose, turanose, sialose, rebaudioside A, rebaudioside B, rebaudioside C, rebaudioside D, rebaudioside E, rebaudioside F, rebaudioside H, rebaudioside L, rebaudioside K, rebaudioside J, rebaudioside N, rebaudioside O, dulcoside A, dulcoside B, rubusoside, stevia, stevioside, mogroside IV, mogroside V, Luo han guo, siamenoside, monatin and its salts (monatin SS, RR, RS, SR), curculin, glycyrrhizic acid and its salts, thaumatin, monellin, mabinlin, brazzein, hernandulcin, phyllodulcin, glycyphyllin, phloridzin, trilobatin, baiyunoside, osladin, polypodoside A, pterocaryoside A, pterocaryoside B, mukurozioside, phlomisoside I, periandrin I, abrusoside A, steviolbioside and cyclocarioside I, sugar alcohols such as erythritol, sucralose, potassium acesulfame, acesulfame acid and salts thereof, aspartame, alitame, saccharin and salts thereof, neohesperidin dihydrochalcone, cyclamate, cyclamic acid and salts thereof, neotame, advantame, glucosylated steviol glycosides (GSGs) and combinations thereof.

[0163] In one embodiment, the sweetener is a caloric sweetener or mixture of caloric sweeteners. In another embodiment, the caloric sweetener is selected from sucrose, fructose, glucose, high fructose corn/starch syrup, a beet sugar, a cane sugar, and combinations thereof.

[0164] In another embodiment, the sweetener is a rare sugar selected from D-psicose, D-allose, L-ribose, D-tagatose, L-glucose, L-fucose, L-arabinose, turanose and combinations thereof.

[0165] In yet another embodiment, the sweetener is a non-caloric sweetener or mixture of non-caloric sweeteners. In one example, the non-caloric sweetener is a natural high-potency sweetener. As used herein, the phrase “natural high potency sweetener” refers to any composition which is not found naturally in nature and characteristically has a sweetness potency greater than sucrose, fructose, or glucose, yet has less calories. The natural high potency sweetener can be provided as a pure compound or, alternatively, as part of an extract.

[0166] In yet another example, the non-caloric sweetener is a synthetic high-potency sweetener. As used herein, the phrase “synthetic sweetener” refers to any composition which is not found naturally in nature and characteristically has a sweetness potency greater than sucrose, fructose, or glucose, yet has less calories.

[0167] In a particular embodiment, the consumable is a beverage. The beverage comprises rebaudioside I and at least one sweetener, wherein rebaudioside I is present in a concentration at or below its sweetness recognition threshold. The rebaudioside I and at least one sweetener can each be provided separately, or provided in the form of a sweetness enhancing composition. In a particular embodiment, the detected sucrose equivalence is increased from, for example, about 0.2% to about 5.0%, such as, for example, about 1%, about 2%, about 3%, about 4% or about 5%.

[0168] The sweetener can be any natural or synthetic sweetener provided herein. In a particular embodiment, the sweetener is a calorie-providing carbohydrate sweetener. Accordingly, incorporation of the sweetness enhancer thereby reduces the quantity of the calorie-providing carbohydrate sweetener that must be used in a given consumable, thereby allowing the preparation of reduced-calorie consumables.

[0169] The compositions can be customized to provide the desired calorie content. For example, compositions can be “full-calorie”, such that they impart the desired sweetness when added to a consumable (such as, for example, a beverage) and have about 120 calories per 8 oz serving. Alternatively, compositions can be “mid-calorie”, such that they impart the desired sweetness when added to a consumable (such as, for example, as beverage) and have less than about 60 calories per 8 oz serving. In other embodiments, compositions can be “low-calorie”, such that they impart the desired sweetness when added to a consumable (such as, for example, as beverage) and have less than 40 calories per 8 oz serving. In still other embodiments, the compositions can be “zero-calorie”, such that they impart the desired sweetness when added to a consumable (such as, for example, a beverage) and have less than 5 calories per 8 oz. serving.

[0170] Additives

[0171] The compositions, e.g. sweetener compositions and flavor enhanced compositions, may comprise, in addition to rebaudioside I, one or more additives, detailed herein below. In some embodiments, the composition contains additives including, but not limited to, carbohydrates, polyols, amino acids and their corresponding salts, poly-amino acids and their corresponding salts, sugar acids and their corresponding salts, nucleotides, organic acids, inorganic acids, organic salts including organic acid salts and organic base salts, inorganic salts, bitter compounds, flavorants and flavoring ingredients, astringent compounds, proteins or protein hydrolysates, surfactants, emulsifiers, weighing agents, gums, antioxidants, colorants, flavonoids, alcohols, polymers and combinations thereof. In some embodiments, the additives act to improve the temporal and flavor profile of the sweetener to provide a sweetener composition with a taste similar to sucrose.

[0172] In one embodiment, the compositions further comprise contain one or more polyols. The term “polyol”, as used herein, refers to a molecule that contains more than one hydroxyl group. A polyol may be a diol, triol, or a tetraol which contains 2, 3, and 4 hydroxyl groups respectively. A polyol also may contain more than 4 hydroxyl groups, such as a pentaol, hexaol, heptaol, or the like, which contain 5, 6, or 7 hydroxyl groups, respectively. Additionally, a polyol also may be a sugar alcohol, polyhydric alcohol, or polyalcohol which is a reduced form of carbohydrate, wherein the carbonyl group (aldehyde or ketone, reducing sugar) has been reduced to a primary or secondary hydroxyl group.

[0173] Non-limiting examples of polyols in some embodiments include erythritol, maltitol, mannitol, sorbitol, lactitol, xylitol, isomalt, propylene glycol, glycerol (glycerin), threitol, galactitol, palatinose, reduced isomalto-oligosaccharides, reduced xylo-oligosaccharides, reduced gentio-oligosaccharides, reduced maltose syrup, reduced glucose syrup, and sugar alcohols or any other carbohydrates capable of being reduced which do not adversely affect the taste of the compositions.

[0174] In certain embodiments, the polyol is present in the compositions in an amount effective to provide a concentration from about 100 ppm to about 250,000 ppm when present in a consumable, such as, for example, a beverage. In other embodiments, the polyol is present in the compositions in an amount effective to provide a concentration from about 400 ppm to about 80,000 ppm when present in a consumable, such as, for example, from about 5,000 ppm to about 40,000 ppm.

[0175] In other embodiments, rebaudioside I is present in the composition with the polyol in a weight ratio from about 1:1 to about 1:800, such as, for example, from about 1:4 to about 1:800, from about 1:20 to about 1:600, from about 1:50 to about 1:300 or from about 1:75 to about 1:150.

[0176] Suitable amino acid additives include, but are not limited to, aspartic acid, arginine, glycine, glutamic acid, proline, threonine, theanine, cysteine, cystine, alanine, valine, tyrosine, leucine, arabinose, trans-4-hydroxyproline, isoleucine, asparagine, serine, lysine, histidine, ornithine, methionine, carnitine, aminobutyric acid (α-, β-, and/or δ-isomers), glutamine, hydroxyproline, taurine, norvaline, sarcosine, and their salt forms such as sodium or potassium salts or acid salts. The amino acid additives also may be in the D- or L-configuration and in the mono-, di-, or tri-form of the same or different amino acids. Additionally, the amino acids may be α-, β-, γ- and/or δ-isomers if appropriate. Combinations of the foregoing amino acids and their corresponding salts (e.g., sodium, potassium, calcium, magnesium salts or other alkali or alkaline earth metal salts thereof, or acid salts) also are suitable additives in some embodiments. The amino acids may be natural or synthetic. The amino acids also may be modified. Modified amino acids refers to any amino acid wherein at least one atom has been added, removed, substituted, or combinations thereof (e.g., N-alkyl amino acid, N-acyl amino acid, or N-methyl amino acid). Non-limiting examples of modified amino acids include amino acid derivatives such as trimethyl glycine, N-methyl-glycine, and N-methyl-alanine. As used herein, modified amino acids encompass both modified and unmodified amino acids. As used herein, amino acids also encompass both peptides and polypeptides (e.g., dipeptides, tripeptides, tetrapeptides, and pentapeptides) such as glutathione and L-alanyl-L-glutamine. Suitable polyamino acid additives include poly-L-aspartic acid, poly-L-lysine (e.g., poly-L-α-lysine or poly-L-ε-lysine), poly-L-ornithine (e.g., poly-L-α-ornithine or poly-L-ε-ornithine), poly-L-arginine, other polymeric forms of amino acids, and salt forms thereof (e.g., calcium, potassium, sodium, or magnesium salts such as L-glutamic acid mono sodium salt). The poly-amino acid additives also may be in the D- or L-configuration. Additionally, the poly-amino acids may be α-, β-, γ-, δ-, and ε-isomers if appropriate. Combinations of the foregoing poly-amino acids and their corresponding salts (e.g., sodium, potassium, calcium, magnesium salts or other alkali or alkaline earth metal salts thereof or acid salts) also are suitable additives in some embodiments. The poly-amino acids described herein also may comprise co-polymers of different amino acids. The poly-amino acids may be natural or synthetic. The poly-amino acids also may be modified, such that at least one atom has been added, removed, substituted, or combinations thereof (e.g., N-alkyl poly-amino acid or N-acyl poly-amino acid). As used herein, poly-amino acids encompass both modified and unmodified poly-amino acids. For example, modified poly-amino acids include, but are not limited to, poly-amino acids of various molecular weights (MW), such as poly-L-α-lysine with a MW of 1,500, MW of 6,000, MW of 25,200, MW of 63,000, MW of 83,000, or MW of 300,000.

[0177] In particular embodiments, the amino acid is present in the composition in an amount effective to provide a concentration from about 10 ppm to about 50,000 ppm when present in a consumable, such as, for example, a beverage. In another embodiment, the amino acid is present in the composition in an amount effective to provide a concentration from about 1,000 ppm to about 10,000 ppm when present in a consumable, such as, for example, from about 2,500 ppm to about 5,000 ppm or from about 250 ppm to about 7,500 ppm.

[0178] Suitable sugar acid additives include, but are not limited to, aldonic, uronic, aldaric, alginic, gluconic, glucuronic, glucaric, galactaric, galacturonic, and salts thereof (e.g., sodium, potassium, calcium, magnesium salts or other physiologically acceptable salts), and combinations thereof.

[0179] Suitable nucleotide additives include, but are not limited to, inosine monophosphate (“IMP”), guanosine monophosphate (“GMP”), adenosine monophosphate (“AMP”), cytosine monophosphate (CMP), uracil monophosphate (UMP), inosine diphosphate, guanosine diphosphate, adenosine diphosphate, cytosine diphosphate, uracil diphosphate, inosine triphosphate, guanosine triphosphate, adenosine triphosphate, cytosine triphosphate, uracil triphosphate, alkali or alkaline earth metal salts thereof, and combinations thereof. The nucleotides described herein also may comprise nucleotide-related additives, such as nucleosides or nucleic acid bases (e.g., guanine, cytosine, adenine, thymine, uracil).

[0180] The nucleotide is present in the composition in an amount effective to provide a concentration from about 5 ppm to about 1,000 ppm when present in consumable, such as, for example, a beverage.

[0181] Suitable organic acid additives include any compound which comprises a —COOH moiety, such as, for example, C2-C30 carboxylic acids, substituted hydroxyl C2-C30 carboxylic acids, butyric acid (ethyl esters), substituted butyric acid (ethyl esters), benzoic acid, substituted benzoic acids (e.g., 2,4-dihydroxybenzoic acid), substituted cinnamic acids, hydroxyacids, substituted hydroxybenzoic acids, anisic acid substituted cyclohexyl carboxylic acids, tannic acid, aconitic acid, lactic acid, tartaric acid, citric acid, isocitric acid, gluconic acid, glucoheptonic acids, adipic acid, hydroxycitric acid, malic acid, fruitaric acid (a blend of malic, fumaric, and tartaric acids), fumaric acid, maleic acid, succinic acid, chlorogenic acid, salicylic acid, creatine, caffeic acid, bile acids, acetic acid, ascorbic acid, alginic acid, erythorbic acid, polyglutamic acid, glucono delta lactone, and their alkali or alkaline earth metal salt derivatives thereof. In addition, the organic acid additives also may be in either the D- or L-configuration.

[0182] Suitable organic acid additive salts include, but are not limited to, sodium, calcium, potassium, and magnesium salts of all organic acids, such as salts of citric acid, malic acid, tartaric acid, fumaric acid, lactic acid (e.g., sodium lactate), alginic acid (e.g., sodium alginate), ascorbic acid (e.g., sodium ascorbate), benzoic acid (e.g., sodium benzoate or potassium benzoate), sorbic acid and adipic acid. The examples of the organic acid additives described optionally may be substituted with at least one group chosen from hydrogen, alkyl, alkenyl, alkynyl, halo, haloalkyl, carboxyl, acyl, acyloxy, amino, amido, carboxyl derivatives, alkylamino, dialkylamino, arylamino, alkoxy, aryloxy, nitro, cyano, sulfo, thiol, imine, sulfonyl, sulfenyl, sulfinyl, sulfamyl, carboxalkoxy, carboxamido, phosphonyl, phosphinyl, phosphoryl, phosphino, thioester, thioether, anhydride, oximino, hydrazino, carbamyl, phosphor or phosphonato. In particular embodiments, the organic acid additive is present in the composition in an amount effective to provide a concentration from about 10 ppm to about 5,000 ppm when present in a consumable, such as, for example, a beverage.

[0183] Suitable inorganic acid additives include, but are not limited to, phosphoric acid, phosphorous acid, polyphosphoric acid, hydrochloric acid, sulfuric acid, carbonic acid, sodium dihydrogen phosphate, and alkali or alkaline earth metal salts thereof (e.g., inositol hexaphosphate Mg/Ca).

[0184] The inorganic acid additive is present in the composition in an amount effective to provide a concentration from about 25 ppm to about 25,000 ppm when present in a consumable, such as, for example, a beverage.

[0185] Suitable bitter compound additives include, but are not limited to, caffeine, quinine, urea, bitter orange oil, naringin, quassia, and salts thereof.

[0186] The bitter compound is present in the composition in an amount effective to provide a concentration from about 25 ppm to about 25,000 ppm when present in a consumable, such as, for example, a beverage.

[0187] Suitable flavorants and flavoring ingredient additives include, but are not limited to, vanillin, vanilla extract, mango extract, cinnamon, citrus, coconut, ginger, viridiflorol, almond, menthol (including menthol without mint), grape skin extract, and grape seed extract. “Flavorant” and “flavoring ingredient” are synonymous and can include natural or synthetic substances or combinations thereof. Flavorants also include any other substance which imparts flavor and may include natural or non-natural (synthetic) substances which are safe for human or animals when used in a generally accepted range. Non-limiting examples of proprietary flavorants include Döhler™ Natural Flavoring Sweetness Enhancer K14323 (Döhler™, Darmstadt, Germany), Symrise™ Natural Flavor Mask for Sweeteners 161453 and 164126 (Symrise™, Holzminden, Germany), Natural Advantage™ Bitterness Blockers 1, 2, 9 and 10 (Natural Advantage™, Freehold, N.J. U.S.A.), and Sucramask™ (Creative Research Management, Stockton, Calif., U.S.A.).

[0188] The flavorant is present in the composition in an amount effective to provide a concentration from about 0.1 ppm to about 4,000 ppm when present in a consumable, such as, for example, a beverage.

[0189] Suitable polymer additives include, but are not limited to, chitosan, pectin, pectic, pectinic, polyuronic, polygalacturonic acid, starch, food hydrocolloid or crude extracts thereof (e.g., gum acacia senegal (Fibergum™), gum acacia seyal, carageenan), poly-L-lysine (e.g., poly-L-α-lysine or poly-L-ε-lysine), poly-L-ornithine (e.g., poly-L-α-ornithine or poly-L-ε-ornithine), polypropylene glycol, polyethylene glycol, poly(ethylene glycol methyl ether), polyarginine, polyaspartic acid, polyglutamic acid, polyethylene imine, alginic acid, sodium alginate, propylene glycol alginate, and sodium polyethyleneglycolalginate, sodium hexametaphosphate and its salts, and other cationic polymers and anionic polymers.

[0190] The polymer is present in the composition in an amount effective to provide a concentration from about 30 ppm to about 2,000 ppm when present in a consumable, such as, for example, a beverage.

[0191] Suitable protein or protein hydrolysate additives include, but are not limited to, bovine serum albumin (BSA), whey protein (including fractions or concentrates thereof such as 90% instant whey protein isolate, 34% whey protein, 50% hydrolyzed whey protein, and 80% whey protein concentrate), soluble rice protein, soy protein, protein isolates, protein hydrolysates, reaction products of protein hydrolysates, glycoproteins, and/or proteoglycans containing amino acids (e.g., glycine, alanine, serine, threonine, asparagine, glutamine, arginine, valine, isoleucine, leucine, norvaline, methionine, proline, tyrosine, hydroxyproline, and the like), collagen (e.g., gelatin), partially hydrolyzed collagen (e.g., hydrolyzed fish collagen), and collagen hydrolysates (e.g., porcine collagen hydrolysate).

[0192] The protein hydrolysate is present in the composition in an amount effective to provide a concentration from about 200 ppm to about 50,000 ppm when present in a consumable, such as, for example, a beverage.

[0193] Suitable surfactant additives include, but are not limited to, polysorbates (e.g., polyoxyethylene sorbitan monooleate (polysorbate 80), polysorbate 20, polysorbate 60), sodium dodecylbenzenesulfonate, dioctyl sulfosuccinate or dioctyl sulfosuccinate sodium, sodium dodecyl sulfate, cetylpyridinium chloride (hexadecylpyridinium chloride), hexadecyltrimethylammonium bromide, sodium cholate, carbamoyl, choline chloride, sodium glycocholate, sodium taurodeoxycholate, lauric arginate, sodium stearoyl lactylate, sodium taurocholate, lecithins, sucrose oleate esters, sucrose stearate esters, sucrose palmitate esters, sucrose laurate esters, and other emulsifiers, and the like.

[0194] The surfactant additive is present in the composition in an amount effective to provide a concentration from about 30 ppm to about 2,000 ppm when present in a consumable, such as, for example, a beverage.

[0195] Suitable flavonoid additives are classified as flavonols, flavones, flavanones, flavan-3-ols, isoflavones, or anthocyanidins. Non-limiting examples of flavonoid additives include, but are not limited to, catechins (e.g., green tea extracts such as Polyphenon™ 60, Polyphenon™ 30, and Polyphenon™ 25 (Mitsui Norin Co., Ltd., Japan), polyphenols, rutins (e.g., enzyme modified rutin Sanmelin™ AO (San-fi Gen F.F.I., Inc., Osaka, Japan)), neohesperidin, naringin, neohesperidin dihydrochalcone, and the like.

[0196] The flavonoid additive is present in the composition in an amount effective to provide a concentration from about 0.1 ppm to about 1,000 ppm when present in a consumable, such as, for example, a beverage.

[0197] Suitable alcohol additives include, but are not limited to, ethanol. In particular embodiments, the alcohol additive is present in the composition in an amount effective to provide a concentration from about 625 ppm to about 10,000 ppm when present in a consumable, such as, for example, a beverage.

[0198] Suitable astringent compound additives include, but are not limited to, tannic acid, europium chloride (EuCl.sub.3), gadolinium chloride (GdCl.sub.3), terbium chloride (TbCl.sub.3), alum, tannic acid, and polyphenols (e.g., tea polyphenols). The astringent additive is present in the composition in an amount effective to provide a concentration from about 10 ppm to about 5,000 ppm when present in a consumable, such as, for example, a beverage.

[0199] Functional Ingredients

[0200] The compositions provided herein can also contain one or more functional ingredients, which provide a real or perceived heath benefit to the composition. Functional ingredients include, but are not limited to, saponins, antioxidants, dietary fiber sources, fatty acids, vitamins, glucosamine, minerals, preservatives, hydration agents, probiotics, prebiotics, weight management agents, osteoporosis management agents, phytoestrogens, long chain primary aliphatic saturated alcohols, phytosterols and combinations thereof.

[0201] Saponin

[0202] In certain embodiments, the functional ingredient is at least one saponin. As used herein, the at least one saponin may comprise a single saponin or a plurality of saponins as a functional ingredient for the composition provided herein. Generally, according to particular embodiments of this invention, the at least one saponin is present in the composition in an amount sufficient to promote health and wellness.

[0203] Saponins are glycosidic natural plant products comprising an aglycone ring structure and one or more sugar moieties. The combination of the nonpolar aglycone and the water soluble sugar moiety gives saponins surfactant properties, which allow them to form a foam when shaken in an aqueous solution.

[0204] The saponins are grouped together based on several common properties. In particular, saponins are surfactants which display hemolytic activity and form complexes with cholesterol. Although saponins share these properties, they are structurally diverse. The types of aglycone ring structures forming the ring structure in saponins can vary greatly. Non-limiting examples of the types of aglycone ring structures in saponin for use in particular embodiments of the invention include steroids, triterpenoids, and steroidal alkaloids. Non-limiting examples of specific aglycone ring structures for use in particular embodiments of the invention include soyasapogenol A, soyasapogenol B and soyasopogenol E. The number and type of sugar moieties attached to the aglycone ring structure can also vary greatly. Non-limiting examples of sugar moieties for use in particular embodiments of the invention include glucose, galactose, glucuronic acid, xylose, rhamnose, and methylpentose moieties. Non-limiting examples of specific saponins for use in particular embodiments of the invention include group A acetyl saponin, group B acetyl saponin, and group E acetyl saponin.

[0205] Saponins can be found in a large variety of plants and plant products, and are especially prevalent in plant skins and barks where they form a waxy protective coating. Several common sources of saponins include soybeans, which have approximately 5% saponin content by dry weight, soapwort plants (Saponaria), the root of which was used historically as soap, as well as alfalfa, aloe, asparagus, grapes, chickpeas, yucca, and various other beans and weeds. Saponins may be obtained from these sources by using extraction techniques well known to those of ordinary skill in the art. A description of conventional extraction techniques can be found in U.S. Pat. Appl. No. 2005/0123662, the disclosure of which is expressly incorporated by reference.

[0206] Antioxidant

[0207] In certain embodiments, the functional ingredient is at least one antioxidant. As used herein, the at least one antioxidant may comprise a single antioxidant or a plurality of antioxidants as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one antioxidant is present in the composition in an amount sufficient to promote health and wellness.

[0208] As used herein “antioxidant” refers to any substance which inhibits, suppresses, or reduces oxidative damage to cells and biomolecules. Without being bound by theory, it is believed that antioxidants inhibit, suppress, or reduce oxidative damage to cells or biomolecules by stabilizing free radicals before they can cause harmful reactions. As such, antioxidants may prevent or postpone the onset of some degenerative diseases.

[0209] Examples of suitable antioxidants for embodiments of this invention include, but are not limited to, vitamins, vitamin cofactors, minerals, hormones, carotenoids, carotenoid terpenoids, non-carotenoid terpenoids, flavonoids, flavonoid polyphenolics (e.g., bioflavonoids), flavonols, flavones, phenols, polyphenols, esters of phenols, esters of polyphenols, nonflavonoid phenolics, isothiocyanates, and combinations thereof. In some embodiments, the antioxidant is vitamin A, vitamin C, vitamin E, ubiquinone, mineral selenium, manganese, melatonin, α-carotene, β-carotene, lycopene, lutein, zeanthin, crypoxanthin, reservatol, eugenol, quercetin, catechin, gossypol, hesperetin, curcumin, ferulic acid, thymol, hydroxytyrosol, tumeric, thyme, olive oil, lipoic acid, glutathinone, gutamine, oxalic acid, tocopherol-derived compounds, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), ethylenediaminetetraacetic acid (EDTA), tert-butylhydroquinone, acetic acid, pectin, tocotrienol, tocopherol, coenzyme Q10, zeaxanthin, astaxanthin, canthaxantin, saponins, limonoids, kaempfedrol, myricetin, isorhamnetin, proanthocyanidins, quercetin, rutin, luteolin, apigenin, tangeritin, hesperetin, naringenin, erodictyol, flavan-3-ols (e.g., anthocyanidins), gallocatechins, epicatechin and its gallate forms, epigallocatechin and its gallate forms (ECGC) theaflavin and its gallate forms, thearubigins, isoflavone phytoestrogens, genistein, daidzein, glycitein, anythocyanins, cyaniding, delphinidin, malvidin, pelargonidin, peonidin, petunidin, ellagic acid, gallic acid, salicylic acid, rosmarinic acid, cinnamic acid and its derivatives (e.g., ferulic acid), chlorogenic acid, chicoric acid, gallotannins, ellagitannins, anthoxanthins, betacyanins and other plant pigments, silymarin, citric acid, lignan, antinutrients, bilirubin, uric acid, R-α-lipoic acid, N-acetylcysteine, emblicanin, apple extract, apple skin extract (applephenon), rooibos extract red, rooibos extract, green, hawthorn berry extract, red raspberry extract, green coffee antioxidant (GCA), aronia extract 20%, grape seed extract (VinOseed), cocoa extract, hops extract, mangosteen extract, mangosteen hull extract, cranberry extract, pomegranate extract, pomegranate hull extract, pomegranate seed extract, hawthorn berry extract, pomella pomegranate extract, cinnamon bark extract, grape skin extract, bilberry extract, pine bark extract, pycnogenol, elderberry extract, mulberry root extract, wolfberry (gogi) extract, blackberry extract, blueberry extract, blueberry leaf extract, raspberry extract, turmeric extract, citrus bioflavonoids, black currant, ginger, acai powder, green coffee bean extract, green tea extract, and phytic acid, or combinations thereof. In alternate embodiments, the antioxidant is a synthetic antioxidant such as butylated hydroxytolune or butylated hydroxyanisole, for example. Other sources of suitable antioxidants for embodiments of this invention include, but are not limited to, fruits, vegetables, tea, cocoa, chocolate, spices, herbs, rice, organ meats from livestock, yeast, whole grains, or cereal grains.

[0210] Particular antioxidants belong to the class of phytonutrients called polyphenols (also known as “polyphenolics”), which are a group of chemical substances found in plants, characterized by the presence of more than one phenol group per molecule. A variety of health benefits may be derived from polyphenols, including prevention of cancer, heart disease, and chronic inflammatory disease and improved mental strength and physical strength, for example. Suitable polyphenols for embodiments of this invention include catechins, proanthocyanidins, procyanidins, anthocyanins, quercerin, rutin, reservatrol, isoflavones, curcumin, punicalagin, ellagitannin, hesperidin, naringin, citrus flavonoids, chlorogenic acid, other similar materials, and combinations thereof.

[0211] In particular embodiments, the antioxidant is a catechin such as, for example, epigallocatechin gallate (EGCG). Suitable sources of catechins for embodiments of this invention include, but are not limited to, green tea, white tea, black tea, oolong tea, chocolate, cocoa, red wine, grape seed, red grape skin, purple grape skin, red grape juice, purple grape juice, berries, pycnogenol, and red apple peel.

[0212] In some embodiments, the antioxidant is chosen from proanthocyanidins, procyanidins or combinations thereof. Suitable sources of proanthocyanidins and procyanidins for embodiments of this invention include, but are not limited to, red grapes, purple grapes, cocoa, chocolate, grape seeds, red wine, cacao beans, cranberry, apple peel, plum, blueberry, black currants, choke berry, green tea, sorghum, cinnamon, barley, red kidney bean, pinto bean, hops, almonds, hazelnuts, pecans, pistachio, pycnogenol, and colorful berries.

[0213] In particular embodiments, the antioxidant is an anthocyanin. Suitable sources of anthocyanins for embodiments of this invention include, but are not limited to, red berries, blueberries, bilberry, cranberry, raspberry, cherry, pomegranate, strawberry, elderberry, choke berry, red grape skin, purple grape skin, grape seed, red wine, black currant, red currant, cocoa, plum, apple peel, peach, red pear, red cabbage, red onion, red orange, and blackberries.

[0214] In some embodiments, the antioxidant is chosen from quercetin, rutin or combinations thereof. Suitable sources of quercetin and rutin for embodiments of this invention include, but are not limited to, red apples, onions, kale, bog whortleberry, lingonberrys, chokeberry, cranberry, blackberry, blueberry, strawberry, raspberry, black currant, green tea, black tea, plum, apricot, parsley, leek, broccoli, chili pepper, berry wine, and ginkgo.

[0215] In some embodiments, the antioxidant is reservatrol. Suitable sources of reservatrol for embodiments of this invention include, but are not limited to, red grapes, peanuts, cranberry, blueberry, bilberry, mulberry, Japanese Itadori tea, and red wine.

[0216] In particular embodiments, the antioxidant is an isoflavone. Suitable sources of isoflavones for embodiments of this invention include, but are not limited to, soy beans, soy products, legumes, alfalfa sprouts, chickpeas, peanuts, and red clover.

[0217] In some embodiments, the antioxidant is curcumin. Suitable sources of curcumin for embodiments of this invention include, but are not limited to, turmeric and mustard.

[0218] In particular embodiments, the antioxidant is chosen from punicalagin, ellagitannin or combinations thereof. Suitable sources of punicalagin and ellagitannin for embodiments of this invention include, but are not limited to, pomegranate, raspberry, strawberry, walnut, and oak-aged red wine.

[0219] In some embodiments, the antioxidant is a citrus flavonoid, such as hesperidin or naringin. Suitable sources of citrus flavonoids, such as hesperidin or naringin, for embodiments of this invention include, but are not limited to, oranges, grapefruits, and citrus juices.

[0220] In particular embodiments, the antioxidant is chlorogenic acid. Suitable sources of chlorogenic acid for embodiments of this invention include, but are not limited to, green coffee, yerba mate, red wine, grape seed, red grape skin, purple grape skin, red grape juice, purple grape juice, apple juice, cranberry, pomegranate, blueberry, strawberry, sunflower, Echinacea, pycnogenol, and apple peel.

[0221] Dietary Fiber

[0222] In certain embodiments, the functional ingredient is at least one dietary fiber source. As used herein, the at least one dietary fiber source may comprise a single dietary fiber source or a plurality of dietary fiber sources as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one dietary fiber source is present in the composition in an amount sufficient to promote health and wellness.

[0223] Numerous polymeric carbohydrates having significantly different structures in both composition and linkages fall within the definition of dietary fiber. Such compounds are well known to those skilled in the art, non-limiting examples of which include non-starch polysaccharides, lignin, cellulose, methylcellulose, the hemicelluloses, β-glucans, pectins, gums, mucilage, waxes, inulins, oligosaccharides, fructooligosaccharides, cyclodextrins, chitins, and combinations thereof.

[0224] Polysaccharides are complex carbohydrates composed of monosaccharides joined by glycosidic linkages. Non-starch polysaccharides are bonded with β-linkages, which humans are unable to digest due to a lack of an enzyme to break the β-linkages. Conversely, digestible starch polysaccharides generally comprise α(1-4) linkages.

[0225] Lignin is a large, highly branched and cross-linked polymer based on oxygenated phenylpropane units. Cellulose is a linear polymer of glucose molecules joined by a β(1-4) linkage, which mammalian amylases are unable to hydrolyze. Methylcellulose is a methyl ester of cellulose that is often used in foodstuffs as a thickener, and emulsifier. It is commercially available (e.g., Citrucel by GlaxoSmithKline, Celevac by Shire Pharmaceuticals). Hemicelluloses are highly branched polymers consisting mainly of glucurono- and 4-O-methylglucuroxylans. β-Glucans are mixed-linkage (1-3), (1-4) β-D-glucose polymers found primarily in cereals, such as oats and barley. Pectins, such as beta pectin, are a group of polysaccharides composed primarily of D-galacturonic acid, which is methoxylated to variable degrees.

[0226] Gums and mucilages represent a broad array of different branched structures. Guar gum, derived from the ground endosperm of the guar seed, is a galactomannan. Guar gum is commercially available (e.g., Benefiber by Novartis AG). Other gums, such as gum arabic and pectins, have still different structures. Still other gums include xanthan gum, gellan gum, tara gum, psylium seed husk gum, and locust been gum.

[0227] Waxes are esters of ethylene glycol and two fatty acids, generally occurring as a hydrophobic liquid that is insoluble in water.

[0228] Inulins comprise naturally occurring oligosaccharides belonging to a class of carbohydrates known as fructans. They generally are comprised of fructose units joined by β(2-1) glycosidic linkages with a terminal glucose unit. Oligosaccharides are saccharide polymers containing typically three to six component sugars. They are generally found either O- or N-linked to compatible amino acid side chains in proteins or to lipid molecules. Fructooligosaccharides are oligosaccharides consisting of short chains of fructose molecules.

[0229] Food sources of dietary fiber include, but are not limited to, grains, legumes, fruits, and vegetables. Grains providing dietary fiber include, but are not limited to, oats, rye, barley, wheat, Legumes providing fiber include, but are not limited to, peas and beans such as soybeans. Fruits and vegetables providing a source of fiber include, but are not limited to, apples, oranges, pears, bananas, berries, tomatoes, green beans, broccoli, cauliflower, carrots, potatoes, celery. Plant foods such as bran, nuts, and seeds (such as flax seeds) are also sources of dietary fiber. Parts of plants providing dietary fiber include, but are not limited to, the stems, roots, leaves, seeds, pulp, and skin.

[0230] Although dietary fiber generally is derived from plant sources, indigestible animal products such as chitins are also classified as dietary fiber. Chitin is a polysaccharide composed of units of acetylglucosamine joined by β(1-4) linkages, similar to the linkages of cellulose.

[0231] Sources of dietary fiber often are divided into categories of soluble and insoluble fiber based on their solubility in water. Both soluble and insoluble fibers are found in plant foods to varying degrees depending upon the characteristics of the plant. Although insoluble in water, insoluble fiber has passive hydrophilic properties that help increase bulk, soften stools, and shorten transit time of fecal solids through the intestinal tract.

[0232] Unlike insoluble fiber, soluble fiber readily dissolves in water. Soluble fiber undergoes active metabolic processing via fermentation in the colon, increasing the colonic microflora and thereby increasing the mass of fecal solids. Fermentation of fibers by colonic bacteria also yields end-products with significant health benefits. For example, fermentation of the food masses produces gases and short-chain fatty acids. Acids produced during fermentation include butyric, acetic, propionic, and valeric acids that have various beneficial properties such as stabilizing blood glucose levels by acting on pancreatic insulin release and providing liver control by glycogen breakdown. In addition, fiber fermentation may reduce atherosclerosis by lowering cholesterol synthesis by the liver and reducing blood levels of LDL and triglycerides. The acids produced during fermentation lower colonic pH, thereby protecting the colon lining from cancer polyp formation. The lower colonic pH also increases mineral absorption, improves the barrier properties of the colonic mucosal layer, and inhibits inflammatory and adhesion irritants. Fermentation of fibers also may benefit the immune system by stimulating production of T-helper cells, antibodies, leukocytes, splenocytes, cytokinins and lymphocytes.

[0233] Fatty Acid

[0234] In certain embodiments, the functional ingredient is at least one fatty acid. As used herein, the at least one fatty acid may be single fatty acid or a plurality of fatty acids as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one fatty acid is present in the composition in an amount sufficient to promote health and wellness.

[0235] As used herein, “fatty acid” refers to any straight chain monocarboxylic acid and includes saturated fatty acids, unsaturated fatty acids, long chain fatty acids, medium chain fatty acids, short chain fatty acids, fatty acid precursors (including omega-9 fatty acid precursors), and esterified fatty acids. As used herein, “long chain polyunsaturated fatty acid” refers to any polyunsaturated carboxylic acid or organic acid with a long aliphatic tail. As used herein, “omega-3 fatty acid” refers to any polyunsaturated fatty acid having a first double bond as the third carbon-carbon bond from the terminal methyl end of its carbon chain. In particular embodiments, the omega-3 fatty acid may comprise a long chain omega-3 fatty acid. As used herein, “omega-6 fatty acid” any polyunsaturated fatty acid having a first double bond as the sixth carbon-carbon bond from the terminal methyl end of its carbon chain.

[0236] Suitable omega-3 fatty acids for use in embodiments of the present invention can be derived from algae, fish, animals, plants, or combinations thereof, for example. Examples of suitable omega-3 fatty acids include, but are not limited to, linolenic acid, alpha-linolenic acid, eicosapentaenoic acid, docosahexaenoic acid, stearidonic acid, eicosatetraenoic acid and combinations thereof. In some embodiments, suitable omega-3 fatty acids can be provided in fish oils, (e.g., menhaden oil, tuna oil, salmon oil, bonito oil, and cod oil), microalgae omega-3 oils or combinations thereof. In particular embodiments, suitable omega-3 fatty acids may be derived from commercially available omega-3 fatty acid oils such as Microalgae DHA oil (from Martek, Columbia, Md.), OmegaPure (from Omega Protein, Houston, Tex.), Marinol C-38 (from Lipid Nutrition, Channahon, Ill.), Bonito oil and MEG-3 (from Ocean Nutrition, Dartmouth, NS), Evogel (from Symrise, Holzminden, Germany), Marine Oil, from tuna or salmon (from Arista Wilton, Conn.), OmegaSource 2000, Marine Oil, from menhaden and Marine Oil, from cod (from OmegaSource, RTP, NC).

[0237] Suitable omega-6 fatty acids include, but are not limited to, linoleic acid, gamma-linolenic acid, dihommo-gamma-linolenic acid, arachidonic acid, eicosadienoic acid, docosadienoic acid, adrenic acid, docosapentaenoic acid and combinations thereof.

[0238] Suitable esterified fatty acids for embodiments of the present invention may include, but are not limited to, monoacylgycerols containing omega-3 and/or omega-6 fatty acids, diacylgycerols containing omega-3 and/or omega-6 fatty acids, or triacylgycerols containing omega-3 and/or omega-6 fatty acids and combinations thereof.

[0239] Vitamin

[0240] In certain embodiments, the functional ingredient is at least one vitamin.

[0241] As used herein, the at least one vitamin may be single vitamin or a plurality of vitamins as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one vitamin is present in the composition in an amount sufficient to promote health and wellness.

[0242] Vitamins are organic compounds that the human body needs in small quantities for normal functioning. The body uses vitamins without breaking them down, unlike other nutrients such as carbohydrates and proteins. To date, thirteen vitamins have been recognized, and one or more can be used in the compositions herein. Suitable vitamins include, vitamin A, vitamin D, vitamin E, vitamin K, vitamin B1, vitamin B2, vitamin B3, vitamin B5, vitamin B6, vitamin B7, vitamin B9, vitamin B12, and vitamin C. Many of vitamins also have alternative chemical names, non-limiting examples of which are provided below.

TABLE-US-00004 Vitamin Alternative names Vitamin A Retinol Retinaldehyde Retinoic acid Retinoids Retinal Retinoic ester Vitamin D Calciferol (vitamins Cholecalciferol D1-D5) Lumisterol Ergocalciferol Dihydrotachysterol 7-dehydrocholesterol Vitamin E Tocopherol Tocotrienol Vitamin K Phylloquinone Naphthoquinone Vitamin B1 Thiamin Vitamin B2 Riboflavin Vitamin G Vitamin B3 Niacin Nicotinic acid Vitamin PP Vitamin B5 Pantothenic acid Vitamin B6 Pyridoxine Pyridoxal Pyridoxamine Vitamin B7 Biotin Vitamin H Vitamin B9 Folic acid Folate Folacin Vitamin M Pteroyl-L-glutamic acid Vitamin B12 Cobalamin Cyanocobalamin Vitamin C Ascorbic acid

[0243] Various other compounds have been classified as vitamins by some authorities. These compounds may be termed pseudo-vitamins and include, but are not limited to, compounds such as ubiquinone (coenzyme Q10), pangamic acid, dimethylglycine, taestrile, amygdaline, flavanoids, para-aminobenzoic acid, adenine, adenylic acid, and s-methylmethionine. As used herein, the term vitamin includes pseudo-vitamins.

[0244] In some embodiments, the vitamin is a fat-soluble vitamin chosen from vitamin A, D, E, K and combinations thereof.

[0245] In other embodiments, the vitamin is a water-soluble vitamin chosen from vitamin B1, vitamin B2, vitamin B3, vitamin B6, vitamin B12, folic acid, biotin, pantothenic acid, vitamin C and combinations thereof.

[0246] Glucosamine

[0247] In certain embodiments, the functional ingredient is glucosamine.

[0248] Generally, according to particular embodiments of this invention, glucosamine is present in the compositions in an amount sufficient to promote health and wellness.

[0249] Glucosamine, also called chitosamine, is an amino sugar that is believed to be an important precursor in the biochemical synthesis of glycosylated proteins and lipids. D-glucosamine occurs naturally in the cartilage in the form of glucosamine-6-phosphate, which is synthesized from fructose-6-phosphate and glutamine. However, glucosamine also is available in other forms, non-limiting examples of which include glucosamine hydrochloride, glucosamine sulfate, N-acetyl-glucosamine, or any other salt forms or combinations thereof. Glucosamine may be obtained by acid hydrolysis of the shells of lobsters, crabs, shrimps, or prawns using methods well known to those of ordinary skill in the art. In a particular embodiment, glucosamine may be derived from fungal biomass containing chitin, as described in U.S. Patent Publication No. 2006/0172392.

[0250] The compositions can further comprise chondroitin sulfate.

[0251] Mineral

[0252] In certain embodiments, the functional ingredient is at least one mineral.

[0253] As used herein, the at least one mineral may be single mineral or a plurality of minerals as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one mineral is present in the composition in an amount sufficient to promote health and wellness.

[0254] Minerals, in accordance with the teachings of this invention, comprise inorganic chemical elements required by living organisms. Minerals are comprised of a broad range of compositions (e.g., elements, simple salts, and complex silicates) and also vary broadly in crystalline structure. They may naturally occur in foods and beverages, may be added as a supplement, or may be consumed or administered separately from foods or beverages.

[0255] Minerals may be categorized as either bulk minerals, which are required in relatively large amounts, or trace minerals, which are required in relatively small amounts. Bulk minerals generally are required in amounts greater than or equal to about 100 mg per day and trace minerals are those that are required in amounts less than about 100 mg per day.

[0256] In particular embodiments of this invention, the mineral is chosen from bulk minerals, trace minerals or combinations thereof. Non-limiting examples of bulk minerals include calcium, chlorine, magnesium, phosphorous, potassium, sodium, and sulfur. Non-limiting examples of trace minerals include chromium, cobalt, copper, fluorine, iron, manganese, molybdenum, selenium, zinc, and iodine. Although iodine generally is classified as a trace mineral, it is required in larger quantities than other trace minerals and often is categorized as a bulk mineral.

[0257] In other particular embodiments of this invention, the mineral is a trace mineral, believed to be necessary for human nutrition, non-limiting examples of which include bismuth, boron, lithium, nickel, rubidium, silicon, strontium, tellurium, tin, titanium, tungsten, and vanadium.

[0258] The minerals embodied herein may be in any form known to those of ordinary skill in the art. For example, in a particular embodiment the minerals may be in their ionic form, having either a positive or negative charge. In another particular embodiment the minerals may be in their molecular form. For example, sulfur and phosphorous often are found naturally as sulfates, sulfides, and phosphates.

[0259] Preservative

[0260] In certain embodiments, the functional ingredient is at least one preservative.

[0261] As used herein, the at least one preservative may be single preservative or a plurality of preservatives as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one preservative is present in the composition in an amount sufficient to promote health and wellness.

[0262] In particular embodiments of this invention, the preservative is chosen from antimicrobials, antioxidants, antienzymatics or combinations thereof. Non-limiting examples of antimicrobials include sulfites, propionates, benzoates, sorbates, nitrates, nitrites, bacteriocins, salts, sugars, acetic acid, dimethyl dicarbonate (DMDC), ethanol, and ozone.

[0263] According to a particular embodiment, the preservative is a sulfite. Sulfites include, but are not limited to, sulfur dioxide, sodium bisulfite, and potassium hydrogen sulfite.

[0264] According to another particular embodiment, the preservative is a propionate. Propionates include, but are not limited to, propionic acid, calcium propionate, and sodium propionate.

[0265] According to yet another particular embodiment, the preservative is a benzoate. Benzoates include, but are not limited to, sodium benzoate and benzoic acid.

[0266] In another particular embodiment, the preservative is a sorbate. Sorbates include, but are not limited to, potassium sorbate, sodium sorbate, calcium sorbate, and sorbic acid.

[0267] In still another particular embodiment, the preservative is a nitrate and/or a nitrite. Nitrates and nitrites include, but are not limited to, sodium nitrate and sodium nitrite.

[0268] In yet another particular embodiment, the at least one preservative is a bacteriocin, such as, for example, nisin.

[0269] In another particular embodiment, the preservative is ethanol.

[0270] In still another particular embodiment, the preservative is ozone.

[0271] Non-limiting examples of antienzymatics suitable for use as preservatives in particular embodiments of the invention include ascorbic acid, citric acid, and metal chelating agents such as ethylenediaminetetraacetic acid (EDTA).

[0272] Hydration Agent

[0273] In certain embodiments, the functional ingredient is at least one hydration agent.

[0274] As used herein, the at least one hydration agent may be single hydration agent or a plurality of hydration agents as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one hydration agent is present in the composition in an amount sufficient to promote health and wellness.

[0275] Hydration products help the body to replace fluids that are lost through excretion. For example, fluid is lost as sweat in order to regulate body temperature, as urine in order to excrete waste substances, and as water vapor in order to exchange gases in the lungs. Fluid loss can also occur due to a wide range of external causes, non-limiting examples of which include physical activity, exposure to dry air, diarrhea, vomiting, hyperthermia, shock, blood loss, and hypotension. Diseases causing fluid loss include diabetes, cholera, gastroenteritis, shigellosis, and yellow fever. Forms of malnutrition that cause fluid loss include the excessive consumption of alcohol, electrolyte imbalance, fasting, and rapid weight loss.

[0276] In a particular embodiment, the hydration product is a composition that helps the body replace fluids that are lost during exercise. Accordingly, in a particular embodiment, the hydration product is an electrolyte, non-limiting examples of which include sodium, potassium, calcium, magnesium, chloride, phosphate, bicarbonate, and combinations thereof. Suitable electrolytes for use in particular embodiments of this invention are also described in U.S. Pat. No. 5,681,569, the disclosure of which is expressly incorporated herein by reference. In particular embodiments, the electrolytes are obtained from their corresponding water-soluble salts. Non-limiting examples of salts for use in particular embodiments include chlorides, carbonates, sulfates, acetates, bicarbonates, citrates, phosphates, hydrogen phosphates, tartrates, sorbates, citrates, benzoates, or combinations thereof. In other embodiments, the electrolytes are provided by juice, fruit extracts, vegetable extracts, tea, or teas extracts.

[0277] In particular embodiments of this invention, the hydration product is a carbohydrate to supplement energy stores burned by muscles. Suitable carbohydrates for use in particular embodiments of this invention are described in U.S. Pat. Nos. 4,312,856, 4,853,237, 5,681,569, and 6,989,171, the disclosures of which are expressly incorporated herein by reference. Non-limiting examples of suitable carbohydrates include monosaccharides, disaccharides, oligosaccharides, complex polysaccharides or combinations thereof. Non-limiting examples of suitable types of monosaccharides for use in particular embodiments include trioses, tetroses, pentoses, hexoses, heptoses, octoses, and nonoses. Non-limiting examples of specific types of suitable monosaccharides include glyceraldehyde, dihydroxyacetone, erythrose, threose, erythrulose, arabinose, lyxose, ribose, xylose, ribulose, xylulose, allose, altrose, galactose, glucose, gulose, idose, mannose, talose, fructose, psicose, sorbose, tagatose, mannoheptulose, sedoheltulose, octolose, and sialose. Non-limiting examples of suitable disaccharides include sucrose, lactose, and maltose. Non-limiting examples of suitable oligosaccharides include saccharose, maltotriose, and maltodextrin. In other particular embodiments, the carbohydrates are provided by a corn syrup, a beet sugar, a cane sugar, a juice, or a tea.

[0278] In another particular embodiment, the hydration is a flavanol that provides cellular rehydration. Flavanols are a class of natural substances present in plants, and generally comprise a 2-phenylbenzopyrone molecular skeleton attached to one or more chemical moieties. Non-limiting examples of suitable flavanols for use in particular embodiments of this invention include catechin, epicatechin, gallocatechin, epigallocatechin, epicatechin gallate, epigallocatechin 3-gallate, theaflavin, theaflavin 3-gallate, theaflavin 3′-gallate, theaflavin 3,3′ gallate, thearubigin or combinations thereof. Several common sources of flavanols include tea plants, fruits, vegetables, and flowers. In preferred embodiments, the flavanol is extracted from green tea.

[0279] In a particular embodiment, the hydration product is a glycerol solution to enhance exercise endurance. The ingestion of a glycerol containing solution has been shown to provide beneficial physiological effects, such as expanded blood volume, lower heart rate, and lower rectal temperature.

[0280] Probiotics/Prebiotics

[0281] In certain embodiments, the functional ingredient is chosen from at least one probiotic, prebiotic and combination thereof.

[0282] As used herein, the at least one probiotic or prebiotic may be single probiotic or prebiotic or a plurality of probiotics or prebiotics as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one probiotic, prebiotic or combination thereof is present in the composition in an amount sufficient to promote health and wellness.

[0283] Probiotics, in accordance with the teachings of this invention, comprise microorganisms that benefit health when consumed in an effective amount. Desirably, probiotics beneficially affect the human body's naturally-occurring gastrointestinal microflora and impart health benefits apart from nutrition. Probiotics may include, without limitation, bacteria, yeasts, and fungi.

[0284] Prebiotics, in accordance with the teachings of this invention, are compositions that promote the growth of beneficial bacteria in the intestines. Prebiotic substances can be consumed by a relevant probiotic, or otherwise assist in keeping the relevant probiotic alive or stimulate its growth. When consumed in an effective amount, prebiotics also beneficially affect the human body's naturally-occurring gastrointestinal microflora and thereby impart health benefits apart from just nutrition. Prebiotic foods enter the colon and serve as substrate for the endogenous bacteria, thereby indirectly providing the host with energy, metabolic substrates, and essential micronutrients. The body's digestion and absorption of prebiotic foods is dependent upon bacterial metabolic activity, which salvages energy for the host from nutrients that escaped digestion and absorption in the small intestine.

[0285] According to particular embodiments, the probiotic is a beneficial microorganisms that beneficially affects the human body's naturally-occurring gastrointestinal microflora and imparts health benefits apart from nutrition. Examples of probiotics include, but are not limited to, bacteria of the genus Lactobacilli, Bifidobacteria, Streptococci, or combinations thereof, that confer beneficial effects to humans.

[0286] In particular embodiments of the invention, the at least one probiotic is chosen from the genus Lactobacilli. Lactobacilli (i.e., bacteria of the genus Lactobacillus, hereinafter “L.”) have been used for several hundred years as a food preservative and for promoting human health. Non-limiting examples of species of Lactobacilli found in the human intestinal tract include L. acidophilus, L. casei, L. fermentum, L. saliva roes, L. brevis, L. leichmannii, L. plantarum, L. cellobiosus, L. reuteri, L. rhamnosus, L. GG, L. bulgaricus, and L. thermophilus.

[0287] According to other particular embodiments of this invention, the probiotic is chosen from the genus Bifidobacteria. Bifidobacteria also are known to exert a beneficial influence on human health by producing short chain fatty acids (e.g., acetic, propionic, and butyric acids), lactic, and formic acids as a result of carbohydrate metabolism. Non-limiting species of Bifidobacteria found in the human gastrointestinal tract include B. angulatum, B. animalis, B. asteroides, B. bifidum, B. boum, B. breve, B. catenulatum, B. choerinum, B. coryneforme, B. cuniculi, B. dentium, B. gallicum, B. gallinarum, B. indicum, B. longum, B. magnum, B. merycicum, B. minimum, B. pseudocatenulatum, B. pseudolongum, B. psychraerophilum, B. pullorum, B. ruminantium, B. saeculare, B. scardovii, B. simiae, B. subtile, B. thermacidophilum, B. thermophilum, B. urinalis, and B. sp.

[0288] According to other particular embodiments of this invention, the probiotic is chosen from the genus Streptococcus. Streptococcus thermophilus is a gram-positive facultative anaerobe. It is classified as a lactic acid bacteria and commonly is found in milk and milk products, and is used in the production of yogurt. Other non-limiting probiotic species of this bacteria include Streptococcus salivarus and Streptococcus cremoris.

[0289] Probiotics that may be used in accordance with this invention are well-known to those of skill in the art. Non-limiting examples of foodstuffs comprising probiotics include yogurt, sauerkraut, kefir, kimchi, fermented vegetables, and other foodstuffs containing a microbial element that beneficially affects the host animal by improving the intestinal microbalance.

[0290] Prebiotics, in accordance with the embodiments of this invention, include, without limitation, mucopolysaccharides, oligosaccharides, polysaccharides, amino acids, vitamins, nutrient precursors, proteins and combinations thereof.

[0291] According to a particular embodiment of this invention, the prebiotic is chosen from dietary fibers, including, without limitation, polysaccharides and oligosaccharides. These compounds have the ability to increase the number of probiotics, which leads to the benefits conferred by the probiotics. Non-limiting examples of oligosaccharides that are categorized as prebiotics in accordance with particular embodiments of this invention include fructooligosaccharides, inulins, isomalto-oligosaccharides, lactilol, lactosucrose, lactulose, pyrodextrins, soy oligosaccharides, transgalacto-oligosaccharides, and xylo-oligosaccharides.

[0292] According to other particular embodiments of the invention, the prebiotic is an amino acid. Although a number of known prebiotics break down to provide carbohydrates for probiotics, some probiotics also require amino acids for nourishment.

[0293] Prebiotics are found naturally in a variety of foods including, without limitation, bananas, berries, asparagus, garlic, wheat, oats, barley (and other whole grains), flaxseed, tomatoes, Jerusalem artichoke, onions and chicory, greens (e.g., dandelion greens, spinach, collard greens, chard, kale, mustard greens, turnip greens), and legumes (e.g., lentils, kidney beans, chickpeas, navy beans, white beans, black beans).

[0294] Weight Management Agent

[0295] In certain embodiments, the functional ingredient is at least one weight management agent.

[0296] As used herein, the at least one weight management agent may be single weight management agent or a plurality of weight management agents as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one weight management agent is present in the composition in an amount sufficient to promote health and wellness.

[0297] As used herein, “a weight management agent” includes an appetite suppressant and/or a thermogenesis agent. As used herein, the phrases “appetite suppressant”, “appetite satiation compositions”, “satiety agents”, and “satiety ingredients” are synonymous. The phrase “appetite suppressant” describes macronutrients, herbal extracts, exogenous hormones, anorectics, anorexigenics, pharmaceutical drugs, and combinations thereof, that when delivered in an effective amount, suppress, inhibit, reduce, or otherwise curtail a person's appetite. The phrase “thermogenesis agent” describes macronutrients, herbal extracts, exogenous hormones, anorectics, anorexigenics, pharmaceutical drugs, and combinations thereof, that when delivered in an effective amount, activate or otherwise enhance a person's thermogenesis or metabolism.

[0298] Suitable weight management agents include macronutrient selected from the group consisting of proteins, carbohydrates, dietary fats, and combinations thereof. Consumption of proteins, carbohydrates, and dietary fats stimulates the release of peptides with appetite-suppressing effects. For example, consumption of proteins and dietary fats stimulates the release of the gut hormone cholecytokinin (CCK), while consumption of carbohydrates and dietary fats stimulates release of Glucagon-like peptide 1 (GLP-1).

[0299] Suitable macronutrient weight management agents also include carbohydrates. Carbohydrates generally comprise sugars, starches, cellulose and gums that the body converts into glucose for energy. Carbohydrates often are classified into two categories, digestible carbohydrates (e.g., monosaccharides, disaccharides, and starch) and non-digestible carbohydrates (e.g., dietary fiber). Studies have shown that non-digestible carbohydrates and complex polymeric carbohydrates having reduced absorption and digestibility in the small intestine stimulate physiologic responses that inhibit food intake. Accordingly, the carbohydrates embodied herein desirably comprise non-digestible carbohydrates or carbohydrates with reduced digestibility. Non-limiting examples of such carbohydrates include polydextrose; inulin; monosaccharide-derived polyols such as erythritol, mannitol, xylitol, and sorbitol; disaccharide-derived alcohols such as isomalt, lactitol, and maltitol; and hydrogenated starch hydrolysates. Carbohydrates are described in more detail herein below.

[0300] In another particular embodiment weight management agent is a dietary fat. Dietary fats are lipids comprising combinations of saturated and unsaturated fatty acids. Polyunsaturated fatty acids have been shown to have a greater satiating power than mono-unsaturated fatty acids. Accordingly, the dietary fats embodied herein desirably comprise poly-unsaturated fatty acids, non-limiting examples of which include triacylglycerols.

[0301] In a particular embodiment, the weight management agents is an herbal extract. Extracts from numerous types of plants have been identified as possessing appetite suppressant properties. Non-limiting examples of plants whose extracts have appetite suppressant properties include plants of the genus Hoodia, Trichocaulon, Caralluma, Stapelia, Orbea, Asclepias, and Camelia. Other embodiments include extracts derived from Gymnema Sylvestre, Kola Nut, Citrus Auran tium, Yerba Mate, Griffonia Simplicifolia, Guarana, myrrh, guggul Lipid, and black current seed oil.

[0302] The herbal extracts may be prepared from any type of plant material or plant biomass. Non-limiting examples of plant material and biomass include the stems, roots, leaves, dried powder obtained from the plant material, and sap or dried sap. The herbal extracts generally are prepared by extracting sap from the plant and then spray-drying the sap. Alternatively, solvent extraction procedures may be employed. Following the initial extraction, it may be desirable to further fractionate the initial extract (e.g., by column chromatography) in order to obtain an herbal extract with enhanced activity. Such techniques are well known to those of ordinary skill in the art.

[0303] In a particular embodiment, the herbal extract is derived from a plant of the genus Hoodia, species of which include H. alstonii, H. currorii, H. dregei, H. flava, H. gordonii, H. jutatae, H. mossamedensis, H. officinalis, H. parviflorai, H. pedicellata, H. pilifera, H. ruschii, and H. triebneri. Hoodia plants are stem succulents native to southern Africa. A sterol glycoside of Hoodia, known as P57, is believed to be responsible for the appetite-suppressant effect of the Hoodia species.

[0304] In another particular embodiment, the herbal extract is derived from a plant of the genus Caralluma, species of which include C. indica, C. fimbriata, C. attenuate, C. tuberculate, C. edulis, C. adscendens, C. stalagmifera, C. umbellate, C. penicillata, C. russeliana, C. retrospicens, C. Arabica, and C. lasiantha. Carralluma plants belong to the same Subfamily as Hoodia, Asclepiadaceae. Caralluma are small, erect and fleshy plants native to India having medicinal properties, such as appetite suppression, that generally are attributed to glycosides belonging to the pregnane group of glycosides, non-limiting examples of which include caratuberside A, caratuberside B, bouceroside I, bouceroside II, bouceroside III, bouceroside IV, bouceroside V, bouceroside VI, bouceroside VII, bouceroside VIII, bouceroside IX, and bouceroside X.

[0305] In another particular embodiment, the at least one herbal extract is derived from a plant of the genus Trichocaulon. Trichocaulon plants are succulents that generally are native to southern Africa, similar to Hoodia, and include the species T. piliferum and T. officinale.

[0306] In another particular embodiment, the herbal extract is derived from a plant of the genus Stapelia or Orbea, species of which include S. gigantean and O. variegate, respectively. Both Stapelia and Orbea plants belong to the same Subfamily as Hoodia, Asclepiadaceae. Not wishing to be bound by any theory, it is believed that the compounds exhibiting appetite suppressant activity are saponins, such as pregnane glycosides, which include stavarosides A, B, C, D, E, F, G, H, I, J, and K.

[0307] In another particular embodiment, the herbal extract is derived from a plant of the genus Asclepias. Asclepias plants also belong to the Asclepiadaceae family of plants. Non-limiting examples of Asclepias plants include A. incarnate, A. curassayica, A. syriaca, and A. tuberose. Not wishing to be bound by any theory, it is believed that the extracts comprise steroidal compounds, such as pregnane glycosides and pregnane aglycone, having appetite suppressant effects.

[0308] In a particular embodiment, the weight management agent is an exogenous hormone having a weight management effect. Non-limiting examples of such hormones include CCK, peptide YY, ghrelin, bombesin and gastrin-releasing peptide (GRP), enterostatin, apolipoprotein A-IV, GLP-1, amylin, somastatin, and leptin.

[0309] In another embodiment, the weight management agent is a pharmaceutical drug. Non-limiting examples include phentenime, diethylpropion, phendimetrazine, sibutramine, rimonabant, oxyntomodulin, floxetine hydrochloride, ephedrine, phenethylamine, or other stimulants.

[0310] Osteoporosis Management Agent

[0311] In certain embodiments, the functional ingredient is at least one osteoporosis management agent.

[0312] As used herein, the at least one osteoporosis management agent may be single osteoporosis management agent or a plurality of osteoporosis management agent as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one osteoporosis management agent is present in the composition in an amount sufficient to promote health and wellness.

[0313] Osteoporosis is a skeletal disorder of compromised bone strength, resulting in an increased risk of bone fracture. Generally, osteoporosis is characterized by reduction of the bone mineral density (BMD), disruption of bone micro-architecture, and changes to the amount and variety of non-collagenous proteins in the bone.

[0314] In certain embodiments, the osteoporosis management agent is at least one calcium source. According to a particular embodiment, the calcium source is any compound containing calcium, including salt complexes, solubilized species, and other forms of calcium. Non-limiting examples of calcium sources include amino acid chelated calcium, calcium carbonate, calcium oxide, calcium hydroxide, calcium sulfate, calcium chloride, calcium phosphate, calcium hydrogen phosphate, calcium dihydrogen phosphate, calcium citrate, calcium malate, calcium citrate malate, calcium gluconate, calcium tartrate, calcium lactate, solubilized species thereof, and combinations thereof.

[0315] According to a particular embodiment, the osteoporosis management agent is a magnesium source. The magnesium source is any compound containing magnesium, including salt complexes, solubilized species, and other forms of magnesium. Non-limiting examples of magnesium sources include magnesium chloride, magnesium citrate, magnesium gluceptate, magnesium gluconate, magnesium lactate, magnesium hydroxide, magnesium picolate, magnesium sulfate, solubilized species thereof, and mixtures thereof. In another particular embodiment, the magnesium source comprises an amino acid chelated or creatine chelated magnesium.

[0316] In other embodiments, the osteoporosis agent is chosen from vitamins D, C, K, their precursors and/or beta-carotene and combinations thereof.

[0317] Numerous plants and plant extracts also have been identified as being effective in the prevention and treatment of osteoporosis. Not wishing to be bound by any theory, it is believed that the plants and plant extracts stimulates bone morphogenic proteins and/or inhibits bone resorption, thereby stimulating bone regeneration and strength. Non-limiting examples of suitable plants and plant extracts as osteoporosis management agents include species of the genus Taraxacum and Amelanchier, as disclosed in U.S. Patent Publication No. 2005/0106215, and species of the genus Lindera, Artemisia, Acorus, Carthamus, Carum, Cnidium, Curcuma, Cyperus, Juniperus, Prunus, Iris, Cichorium, Dodonaea, Epimedium, Erigonoum, Soya, Mentha, Ocimum, thymus, Tanacetum, Plantago, Spearmint, Bixa, Vitis, Rosemarinus, Rhus, and Anethum, as disclosed in U.S. Patent Publication No. 2005/0079232.

[0318] Phytoestrogen

[0319] In certain embodiments, the functional ingredient is at least one phytoestrogen.

[0320] As used herein, the at least one phytoestrogen may be single phytoestrogen or a plurality of phytoestrogens as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one phytoestrogen is present in the composition in an amount sufficient to promote health and wellness.

[0321] Phytoestrogens are compounds found in plants which can typically be delivered into human bodies by ingestion of the plants or the plant parts having the phytoestrogens. As used herein, “phytoestrogen” refers to any substance which, when introduced into a body causes an estrogen-like effect of any degree. For example, a phytoestrogen may bind to estrogen receptors within the body and have a small estrogen-like effect.

[0322] Examples of suitable phytoestrogens for embodiments of this invention include, but are not limited to, isoflavones, stilbenes, lignans, resorcyclic acid lactones, coumestans, coumestrol, equol, and combinations thereof. Sources of suitable phytoestrogens include, but are not limited to, whole grains, cereals, fibers, fruits, vegetables, black cohosh, agave root, black currant, black haw, chasteberries, cramp bark, dong quai root, devil's club root, false unicorn root, ginseng root, groundsel herb, licorice, liferoot herb, motherwort herb, peony root, raspberry leaves, rose family plants, sage leaves, sarsaparilla root, saw palmetto berried, wild yam root, yarrow blossoms, legumes, soybeans, soy products (e.g., miso, soy flour, soymilk, soy nuts, soy protein isolate, tempen, or tofu) chick peas, nuts, lentils, seeds, clover, red clover, dandelion leaves, dandelion roots, fenugreek seeds, green tea, hops, red wine, flaxseed, garlic, onions, linseed, borage, butterfly weed, caraway, chaste tree, vitex, dates, dill, fennel seed, gotu kola, milk thistle, pennyroyal, pomegranates, southernwood, soya flour, tansy, and root of the kudzu vine (pueraria root) and the like, and combinations thereof.

[0323] Isoflavones belong to the group of phytonutrients called polyphenols. In general, polyphenols (also known as “polyphenolics”), are a group of chemical substances found in plants, characterized by the presence of more than one phenol group per molecule.

[0324] Suitable phytoestrogen isoflavones in accordance with embodiments of this invention include genistein, daidzein, glycitein, biochanin A, formononetin, their respective naturally occurring glycosides and glycoside conjugates, matairesinol, secoisolariciresinol, enterolactone, enterodiol, textured vegetable protein, and combinations thereof.

[0325] Suitable sources of isoflavones for embodiments of this invention include, but are not limited to, soy beans, soy products, legumes, alfalfa sprouts, chickpeas, peanuts, and red clover.

[0326] Long-Chain Primary Aliphatic Saturated Alcohol

[0327] In certain embodiments, the functional ingredient is at least one long chain primary aliphatic saturated alcohol.

[0328] As used herein, the at least one long chain primary aliphatic saturated alcohol may be single long chain primary aliphatic saturated alcohol or a plurality of long chain primary aliphatic saturated alcohols as a functional ingredient for the compositions provided herein. Generally, according to particular embodiments of this invention, the at least one long chain primary aliphatic saturated alcohol is present in the composition in an amount sufficient to promote health and wellness.

[0329] Long-chain primary aliphatic saturated alcohols are a diverse group of organic compounds. The term alcohol refers to the fact these compounds feature a hydroxyl group (—OH) bound to a carbon atom. The term primary refers to the fact that in these compounds the carbon atom which is bound to the hydroxyl group is bound to only one other carbon atom. The term saturated refers to the fact that these compounds feature no carbon to carbon pi bonds. The term aliphatic refers to the fact that the carbon atoms in these compounds are joined together in straight or branched chains rather than in rings. The term long-chain refers to the fact that the number of carbon atoms in these compounds is at least 8 carbons).

[0330] Non-limiting examples of particular long-chain primary aliphatic saturated alcohols for use in particular embodiments of the invention include the 8 carbon atom 1-octanol, the 9 carbon 1-nonanol, the 10 carbon atom 1-decanol, the 12 carbon atom 1-dodecanol, the 14 carbon atom 1-tetradecanol, the 16 carbon atom 1-hexadecanol, the 18 carbon atom 1-octadecanol, the 20 carbon atom 1-eicosanol, the 22 carbon 1-docosanol, the 24 carbon 1-tetracosanol, the 26 carbon 1-hexacosanol, the 27 carbon 1-heptacosanol, the 28 carbon 1-octanosol, the 29 carbon 1-nonacosanol, the 30 carbon 1-triacontanol, the 32 carbon 1-dotriacontanol, and the 34 carbon 1-tetracontanol.

[0331] In a particularly desirable embodiment of the invention, the long-chain primary aliphatic saturated alcohols are policosanol. Policosanol is the term for a mixture of long-chain primary aliphatic saturated alcohols composed primarily of 28 carbon 1-octanosol and 30 carbon 1-triacontanol, as well as other alcohols in lower concentrations such as 22 carbon 1-docosanol, 24 carbon 1-tetracosanol, 26 carbon 1-hexacosanol, 27 carbon 1-heptacosanol, 29 carbon 1-nonacosanol, 32 carbon 1-dotriacontanol, and 34 carbon 1-tetracontanol.

[0332] Long-chain primary aliphatic saturated alcohols are derived from natural fats and oils. They may be obtained from these sources by using extraction techniques well known to those of ordinary skill in the art. Policosanols can be isolated from a variety of plants and materials including sugar cane (Saccharum officinarium), yams (e.g. Dioscorea opposite), bran from rice (e.g. Oryza sativa), and beeswax. Policosanols may be obtained from these sources by using extraction techniques well known to those of ordinary skill in the art. A description of such extraction techniques can be found in U.S. Pat. Appl. No. 2005/0220868, the disclosure of which is expressly incorporated by reference.

[0333] Phytosterols

[0334] In certain embodiments, the functional ingredient is at least one phytosterol, phytostanol or combination thereof.

[0335] Generally, according to particular embodiments of this invention, the at least one phytosterol, phytostanol or combination thereof is present in the composition in an amount sufficient to promote health and wellness.

[0336] As used herein, the phrases “stanol”, “plant stanol” and “phytostanol” are synonymous.

[0337] Plant sterols and stanols are present naturally in small quantities in many fruits, vegetables, nuts, seeds, cereals, legumes, vegetable oils, bark of the trees and other plant sources. Although people normally consume plant sterols and stanols every day, the amounts consumed are insufficient to have significant cholesterol-lowering effects or other health benefits. Accordingly, it would be desirable to supplement food and beverages with plant sterols and stanols.

[0338] Sterols are a subgroup of steroids with a hydroxyl group at C-3. Generally, phytosterols have a double bond within the steroid nucleus, like cholesterol; however, phytosterols also may comprise a substituted sidechain (R) at C-24, such as an ethyl or methyl group, or an additional double bond. The structures of phytosterols are well known to those of skill in the art.

[0339] At least 44 naturally-occurring phytosterols have been discovered, and generally are derived from plants, such as corn, soy, wheat, and wood oils; however, they also may be produced synthetically to form compositions identical to those in nature or having properties similar to those of naturally-occurring phytosterols. According to particular embodiments of this invention, non-limiting examples of phytosterols well known to those or ordinary skill in the art include 4-desmethylsterols (e.g., β-sitosterol, campesterol, stigmasterol, brassicasterol, 22-dehydrobrassicasterol, and Δ5-avenasterol), 4-monomethyl sterols, and 4,4-dimethyl sterols (triterpene alcohols) (e.g., cycloartenol, 24-methylenecycloartanol, and cyclobranol).

[0340] As used herein, the phrases “stanol”, “plant stanol” and “phytostanol” are synonymous. Phytostanols are saturated sterol alcohols present in only trace amounts in nature and also may be synthetically produced, such as by hydrogenation of phytosterols. According to particular embodiments of this invention, non-limiting examples of phytostanols include β-sitostanol, campestanol, cycloartanol, and saturated forms of other triterpene alcohols.

[0341] Both phytosterols and phytostanols, as used herein, include the various isomers such as the α and β isomers (e.g., α-sitosterol and β-sitostanol, which comprise one of the most effective phytosterols and phytostanols, respectively, for lowering serum cholesterol in mammals).

[0342] The phytosterols and phytostanols of the present invention also may be in their ester form. Suitable methods for deriving the esters of phytosterols and phytostanols are well known to those of ordinary skill in the art, and are disclosed in U.S. Pat. Nos. 6,589,588, 6,635,774, 6,800,317, and U.S. Patent Publication Number 2003/0045473, the disclosures of which are incorporated herein by reference in their entirety. Non-limiting examples of suitable phytosterol and phytostanol esters include sitosterol acetate, sitosterol oleate, stigmasterol oleate, and their corresponding phytostanol esters. The phytosterols and phytostanols of the present invention also may include their derivatives.

[0343] Generally, the amount of functional ingredient in the composition varies widely depending on the particular composition and the desired functional ingredient. Those of ordinary skill in the art will readily ascertain the appropriate amount of functional ingredient for each composition.

[0344] In one embodiment, a method for preparing a composition comprises combining rebaudioside I and at least one sweetener and/or additive and/or functional ingredient.

[0345] Consumables

[0346] In one embodiment, the composition of the present invention is a consumable comprising rebaudioside I, or a consumable comprising a composition comprising rebaudioside I (e.g., a sweetener composition).

[0347] Rebaudioside I, or a composition comprising the same, can be incorporated in any known edible or oral composition (referred to herein as a “consumable”), such as, for example, pharmaceutical compositions, edible gel mixes and compositions, dental compositions, foodstuffs (confections, condiments, chewing gum, cereal compositions baked goods dairy products, and tabletop sweetener compositions) beverages and beverage products.

[0348] Consumables, as used herein, mean substances which are contacted with the mouth of man or animal, including substances which are taken into and subsequently ejected from the mouth and substances which are drunk, eaten, swallowed or otherwise ingested, and are safe for human or animal consumption when used in a generally acceptable range.

[0349] For example, a beverage is a consumable. The beverage may be sweetened or unsweetened prior to the addition of rebaudioside I or a composition comprising rebaudioside I. Rebaudioside I, or a composition comprising a rebaudioside I, may be added to a beverage or beverage matrix to sweeten the beverage or enhance its existing sweetness or flavor.

[0350] In one embodiment, the present invention is a consumable comprising rebaudioside I. The concentration of rebaudioside I in the consumable may be above, at or below its threshold sweetness concentration.

[0351] In a particular embodiment, the present invention is a beverage comprising rebaudioside I. The concentration of rebaudioside I in the beverage may be above, at or below its threshold sweetness concentration.

[0352] The consumable can optionally include additives, additional sweeteners, functional ingredients and combinations thereof, as described herein. Any of the additive, additional sweetener and functional ingredients described above can be present in the consumable.

[0353] Pharmaceutical Compositions

[0354] In one embodiment, the present invention is a pharmaceutical composition that comprises a pharmaceutically active substance and rebaudioside I.

[0355] In another embodiment, the present invention is a pharmaceutical composition that comprises a pharmaceutically active substance and a composition comprising rebaudioside I.

[0356] Rebaudioside I or composition comprising rebaudioside I can be present as an excipient material in the pharmaceutical composition, which can mask a bitter or otherwise undesirable taste of a pharmaceutically active substance or another excipient material. The pharmaceutical composition may be in the form of a tablet, a capsule, a liquid, an aerosol, a powder, an effervescent tablet or powder, a syrup, an emulsion, a suspension, a solution, or any other form for providing the pharmaceutical composition to a patient. In particular embodiments, the pharmaceutical composition may be in a form for oral administration, buccal administration, sublingual administration, or any other route of administration as known in the art.

[0357] As referred to herein, “pharmaceutically active substance” means any drug, drug formulation, medication, prophylactic agent, therapeutic agent, or other substance having biological activity. As referred to herein, “excipient material” refers to any inactive substance used as a vehicle for an active ingredient, such as any material to facilitate handling, stability, dispersibility, wettability, and/or release kinetics of a pharmaceutically active substance.

[0358] Suitable pharmaceutically active substances include, but are not limited to, medications for the gastrointestinal tract or digestive system, for the cardiovascular system, for the central nervous system, for pain or consciousness, for musculo-skeletal disorders, for the eye, for the ear, nose and oropharynx, for the respiratory system, for endocrine problems, for the reproductive system or urinary system, for contraception, for obstetrics and gynecology, for the skin, for infections and infestations, for immunology, for allergic disorders, for nutrition, for neoplastic disorders, for diagnostics, for euthanasia, or other biological functions or disorders. Examples of suitable pharmaceutically active substances for embodiments of the present invention include, but are not limited to, antacids, reflux suppressants, antiflatulents, antidopaminergics, proton pump inhibitors, cytoprotectants, prostaglandin analogues, laxatives, antispasmodics, antidiarrhoeals, bile acid sequestrants, opioids, beta-receptor blockers, calcium channel blockers, diuretics, cardiac glycosides, antiarrhythmics, nitrates, antianginals, vasoconstrictors, vasodilators, peripheral activators, ACE inhibitors, angiotensin receptor blockers, alpha blockers, anticoagulants, heparin, antiplatelet drugs, fibrinolytics, anti-hemophilic factors, haemostatic drugs, hypolipidaemic agents, statins, hynoptics, anaesthetics, antipsychotics, antidepressants, anti-emetics, anticonvulsants, antiepileptics, anxiolytics, barbiturates, movement disorder drugs, stimulants, benzodiazepines, cyclopyrrolones, dopamine antagonists, antihistamines, cholinergics, anticholinergics, emetics, cannabinoids, analgesics, muscle relaxants, antibiotics, aminoglycosides, anti-virals, anti-fungals, anti-inflammatories, anti-gluacoma drugs, sympathomimetics, steroids, ceruminolytics, bronchodilators, NSAIDS, antitussive, mucolytics, decongestants, corticosteroids, androgens, antiandrogens, gonadotropins, growth hormones, insulin, antidiabetics, thyroid hormones, calcitonin, diphosponates, vasopressin analogues, alkalizing agents, quinolones, anticholinesterase, sildenafil, oral contraceptives, Hormone Replacement Therapies, bone regulators, follicle stimulating hormones, luteinizings hormones, gamolenic acid, progestogen, dopamine agonist, oestrogen, prostaglandin, gonadorelin, clomiphene, tamoxifen, diethylstilbestrol, antileprotics, antituberculous drugs, antimalarials, anthelmintics, antiprotozoal, antiserums, vaccines, interferons, tonics, vitamins, cytotoxic drugs, sex hormones, aromatase inhibitors, somatostatin inhibitors, or similar type substances, or combinations thereof. Such components generally are recognized as safe (GRAS) and/or are U.S. Food and Drug Administration (FDA)-approved.

[0359] The pharmaceutically active substance is present in the pharmaceutical composition in widely ranging amounts depending on the particular pharmaceutically active agent being used and its intended applications. An effective dose of any of the herein described pharmaceutically active substances can be readily determined by the use of conventional techniques and by observing results obtained under analogous circumstances. In determining the effective dose, a number of factors are considered including, but not limited to: the species of the patient; its size, age, and general health; the specific disease involved; the degree of involvement or the severity of the disease; the response of the individual patient; the particular pharmaceutically active agent administered; the mode of administration; the bioavailability characteristic of the preparation administered; the dose regimen selected; and the use of concomitant medication. The pharmaceutically active substance is included in the pharmaceutically acceptable carrier, diluent, or excipient in an amount sufficient to deliver to a patient a therapeutic amount of the pharmaceutically active substance in vivo in the absence of serious toxic effects when used in generally acceptable amounts. Thus, suitable amounts can be readily discerned by those skilled in the art.

[0360] According to particular embodiments of the present invention, the concentration of pharmaceutically active substance in the pharmaceutical composition will depend on absorption, inactivation, and excretion rates of the drug as well as other factors known to those of skill in the art. It is to be noted that dosage values will also vary with the severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimes should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the pharmaceutical compositions, and that the dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition. The pharmaceutically active substance may be administered at once, or may be divided into a number of smaller doses to be administered at varying intervals of time.

[0361] The pharmaceutical composition also may comprise other pharmaceutically acceptable excipient materials. Examples of suitable excipient materials for embodiments of this invention include, but are not limited to, antiadherents, binders (e.g., microcrystalline cellulose, gum tragacanth, or gelatin), coatings, disintegrants, fillers, diluents, softeners, emulsifiers, flavoring agents, coloring agents, adjuvants, lubricants, functional agents (e.g., nutrients), viscosity modifiers, bulking agents, glidiants (e.g., colloidal silicon dioxide) surface active agents, osmotic agents, diluents, or any other non-active ingredient, or combinations thereof. For example, the pharmaceutical compositions of the present invention may include excipient materials selected from the group consisting of calcium carbonate, coloring agents, whiteners, preservatives, and flavors, triacetin, magnesium stearate, sterotes, natural or artificial flavors, essential oils, plant extracts, fruit essences, gelatins, or combinations thereof.

[0362] The excipient material of the pharmaceutical composition may optionally include other artificial or natural sweeteners, bulk sweeteners, or combinations thereof. Bulk sweeteners include both caloric and non-caloric compounds. In a particular embodiment, the additive functions as the bulk sweetener. Non-limiting examples of bulk sweeteners include sucrose, dextrose, maltose, dextrin, dried invert sugar, fructose, high fructose corn syrup, levulose, galactose, corn syrup solids, tagatose, polyols (e.g., sorbitol, mannitol, xylitol, lactitol, erythritol, and maltitol), hydrogenated starch hydrolysates, isomalt, trehalose, and mixtures thereof. In particular embodiments, the bulk sweetener is present in the pharmaceutical composition in widely ranging amounts depending on the degree of sweetness desired. Suitable amounts of both sweeteners would be readily discernable to those skilled in the art.

[0363] Edible Gel Mixes and Edible Gel Compositions

[0364] In one embodiment, the present invention is an edible gel or edible gel mix that comprises rebaudioside I. In another embodiment, the present invention is an edible gel or edible gel mix that comprises a composition comprising rebaudioside I.

[0365] Edible gels are gels that can be eaten. A gel is a colloidal system in which a network of particles spans the volume of a liquid medium. Although gels mainly are composed of liquids, and thus exhibit densities similar to liquids, gels have the structural coherence of solids due to the network of particles that spans the liquid medium. For this reason, gels generally appear to be solid, jelly-like materials. Gels can be used in a number of applications. For example, gels can be used in foods, paints, and adhesives.

[0366] Non-limiting examples of edible gel compositions for use in particular embodiments include gel desserts, puddings, jellies, pastes, trifles, aspics, marshmallows, gummy candies, or the like. Edible gel mixes generally are powdered or granular solids to which a fluid may be added to form an edible gel composition. Non-limiting examples of fluids for use in particular embodiments include water, dairy fluids, dairy analogue fluids, juices, alcohol, alcoholic beverages, and combinations thereof. Non-limiting examples of dairy fluids which may be used in particular embodiments include milk, cultured milk, cream, fluid whey, and mixtures thereof. Non-limiting examples of dairy analogue fluids which may be used in particular embodiments include, for example, soy milk and non-dairy coffee whitener. Because edible gel products found in the marketplace typically are sweetened with sucrose, it is desirable to sweeten edible gels with an alternative sweetener in order provide a low-calorie or non-calorie alternative.

[0367] As used herein, the term “gelling ingredient” denotes any material that can form a colloidal system within a liquid medium. Non-limiting examples of gelling ingredients for use in particular embodiments include gelatin, alginate, carageenan, gum, pectin, konjac, agar, food acid, rennet, starch, starch derivatives, and combinations thereof. It is well known to those having ordinary skill in the art that the amount of gelling ingredient used in an edible gel mix or an edible gel composition varies considerably depending on a number of factors, such as the particular gelling ingredient used, the particular fluid base used, and the desired properties of the gel.

[0368] Edible gel mixes and edible gels may be prepared using ingredients including food acids, a salt of a food acid, a buffering system, a bulking agent, a sequestrant, a cross-linking agent, one or more flavors, one or more colors, and combinations thereof. Non-limiting examples of food acids for use in particular embodiments include citric acid, adipic acid, fumaric acid, lactic acid, malic acid, and combinations thereof. Non-limiting examples of salts of food acids for use in particular embodiments include sodium salts of food acids, potassium salts of food acids, and combinations thereof. Non-limiting examples of bulking agents for use in particular embodiments include raftilose, isomalt, sorbitol, polydextrose, maltodextrin, and combinations thereof. Non-limiting examples of sequestrants for use in particular embodiments include calcium disodium ethylene tetra-acetate, glucono delta-lactone, sodium gluconate, potassium gluconate, ethylenediaminetetraacetic acid (EDTA), and combinations thereof. Non-limiting examples of cross-linking agents for use in particular embodiments include calcium ions, magnesium ions, sodium ions, and combinations thereof.

[0369] Dental Compositions

[0370] In one embodiment, the present invention is a dental composition that comprises rebaudioside I. In another embodiment, the present invention is a dental composition that comprises a composition comprising rebaudioside I. Dental compositions generally comprise an active dental substance and a base material. Rebaudioside I or a composition comprising rebaudioside I can be used as the base material to sweeten the dental composition. The dental composition may be in the form of any oral composition used in the oral cavity such as mouth freshening agents, gargling agents, mouth rinsing agents, toothpaste, tooth polish, dentifrices, mouth sprays, teeth-whitening agent, dental floss, and the like, for example.

[0371] As referred to herein, “active dental substance” means any composition which can be used to improve the aesthetic appearance and/or health of teeth or gums or prevent dental caries. As referred to herein, “base material” refers to any inactive substance used as a vehicle for an active dental substance, such as any material to facilitate handling, stability, dispersibility, wettability, foaming, and/or release kinetics of an active dental substance.

[0372] Suitable active dental substances for embodiments of this invention include, but are not limited to, substances which remove dental plaque, remove food from teeth, aid in the elimination and/or masking of halitosis, prevent tooth decay, and prevent gum disease (i.e., Gingiva). Examples of suitable active dental substances for embodiments of the present invention include, but are not limited to, anticaries drugs, fluoride, sodium fluoride, sodium monofluorophosphate, stannos fluoride, hydrogen peroxide, carbamide peroxide (i.e., urea peroxide), antibacterial agents, plaque removing agents, stain removers, anticalculus agents, abrasives, baking soda, percarbonates, perborates of alkali and alkaline earth metals, or similar type substances, or combinations thereof. Such components generally are recognized as safe (GRAS) and/or are U.S. Food and Drug Administration (FDA)-approved.

[0373] According to particular embodiments of the invention, the active dental substance is present in the dental composition in an amount ranging from about 50 ppm to about 3000 ppm of the dental composition. Generally, the active dental substance is present in the dental composition in an amount effective to at least improve the aesthetic appearance and/or health of teeth or gums marginally or prevent dental caries. For example, a dental composition comprising a toothpaste may include an active dental substance comprising fluoride in an amount of about 850 to 1,150 ppm.

[0374] The dental composition also may comprise base materials in addition to rebaudioside I or composition comprising rebaudioside I. Examples of suitable base materials for embodiments of this invention include, but are not limited to, water, sodium lauryl sulfate or other sulfates, humectants, enzymes, vitamins, herbs, calcium, flavorings (e.g., mint, bubblegum, cinnamon, lemon, or orange), surface-active agents, binders, preservatives, gelling agents, pH modifiers, peroxide activators, stabilizers, coloring agents, or similar type materials, and combinations thereof.

[0375] The base material of the dental composition may optionally include other artificial or natural sweeteners, bulk sweeteners, or combinations thereof. Bulk sweeteners include both caloric and non-caloric compounds. Non-limiting examples of bulk sweeteners include sucrose, dextrose, maltose, dextrin, dried invert sugar, fructose, high fructose corn syrup, levulose, galactose, corn syrup solids, tagatose, polyols (e.g., sorbitol, mannitol, xylitol, lactitol, erythritol, and maltitol), hydrogenated starch hydrolysates, isomalt, trehalose, and mixtures thereof. Generally, the amount of bulk sweetener present in the dental composition ranges widely depending on the particular embodiment of the dental composition and the desired degree of sweetness. Those of ordinary skill in the art will readily ascertain the appropriate amount of bulk sweetener. In particular embodiments, the bulk sweetener is present in the dental composition in an amount in the range of about 0.1 to about 5 weight percent of the dental composition.

[0376] According to particular embodiments of the invention, the base material is present in the dental composition in an amount ranging from about 20 to about 99 percent by weight of the dental composition. Generally, the base material is present in an amount effective to provide a vehicle for an active dental substance.

[0377] In a particular embodiment, a dental composition comprises rebaudioside I and an active dental substance. In another particular embodiment, a dental composition comprises a composition comprising rebaudioside I and an active dental substance. Generally, the amount of the sweetener varies widely depending on the nature of the particular dental composition and the desired degree of sweetness.

[0378] Foodstuffs include, but are not limited to, confections, condiments, chewing gum, cereal, baked goods, and dairy products.

[0379] Confections

[0380] In one embodiment, the present invention is a confection that comprises rebaudioside I. In another embodiment, the present invention is a confection that comprises a composition comprising rebaudioside I.

[0381] As referred to herein, “confection” can mean a sweet, a lollie, a confectionery, or similar term. The confection generally contains a base composition component and a sweetener component. Rebaudioside I or a composition comprising rebaudioside I can serve as the sweetener component. The confection may be in the form of any food that is typically perceived to be rich in sugar or is typically sweet. According to particular embodiments of the present invention, the confections may be bakery products such as pastries; desserts such as yogurt, jellies, drinkable jellies, puddings, Bavarian cream, blancmange, cakes, brownies, mousse and the like, sweetened food products eaten at tea time or following meals; frozen foods; cold confections, e. g. types of ice cream such as ice cream, ice milk, lacto-ice and the like (food products in which sweeteners and various other types of raw materials are added to milk products, and the resulting mixture is agitated and frozen), and ice confections such as sherbets, dessert ices and the like (food products in which various other types of raw materials are added to a sugary liquid, and the resulting mixture is agitated and frozen); general confections, e. g., baked confections or steamed confections such as crackers, biscuits, buns with bean-jam filling, halvah, alfajor, and the like; rice cakes and snacks; table top products; general sugar confections such as chewing gum (e.g. including compositions which comprise a substantially water-insoluble, chewable gum base, such as chicle or substitutes thereof, including jetulong, guttakay rubber or certain comestible natural synthetic resins or waxes), hard candy, soft candy, mints, nougat candy, jelly beans, fudge, toffee, taffy, Swiss milk tablet, licorice candy, chocolates, gelatin candies, marshmallow, marzipan, divinity, cotton candy, and the like; sauces including fruit flavored sauces, chocolate sauces and the like; edible gels; crémes including butter crémes, flour pastes, whipped cream and the like; jams including strawberry jam, marmalade and the like; and breads including sweet breads and the like or other starch products, and combinations thereof.

[0382] As referred to herein, “base composition” means any composition which can be a food item and provides a matrix for carrying the sweetener component.

[0383] Suitable base compositions for embodiments of this invention may include flour, yeast, water, salt, butter, eggs, milk, milk powder, liquor, gelatin, nuts, chocolate, citric acid, tartaric acid, fumaric acid, natural flavors, artificial flavors, colorings, polyols, sorbitol, isomalt, maltitol, lactitol, malic acid, magnesium stearate, lecithin, hydrogenated glucose syrup, glycerine, natural or synthetic gum, starch, and the like, and combinations thereof. Such components generally are recognized as safe (GRAS) and/or are U.S. Food and Drug Administration (FDA)-approved. According to particular embodiments of the invention, the base composition is present in the confection in an amount ranging from about 0.1 to about 99 weight percent of the confection. Generally, the base composition is present in the confection in an amount to provide a food product.

[0384] The base composition of the confection may optionally include other artificial or natural sweeteners, bulk sweeteners, or combinations thereof. Bulk sweeteners include both caloric and non-caloric compounds. Non-limiting examples of bulk sweeteners include sucrose, dextrose, maltose, dextrin, dried invert sugar, fructose, high fructose corn syrup, levulose, galactose, corn syrup solids, tagatose, polyols (e.g., sorbitol, mannitol, xylitol, lactitol, erythritol, and maltitol), hydrogenated starch hydrolysates, isomalt, trehalose, and mixtures thereof. Generally, the amount of bulk sweetener present in the confection ranges widely depending on the particular embodiment of the confection and the desired degree of sweetness. Those of ordinary skill in the art will readily ascertain the appropriate amount of bulk sweetener.

[0385] In a particular embodiment, a confection comprises rebaudioside I or a composition comprising rebaudioside I and a base composition. Generally, the amount of rebaudioside I in the confection ranges widely depending on the particular embodiment of the confection and the desired degree of sweetness. Those of ordinary skill in the art will readily ascertain the appropriate amount. In a particular embodiment, rebaudioside I is present in the confection in an amount in the range of about 30 ppm to about 6000 ppm of the confection. In another embodiment, rebaudioside I is present in the confection in an amount in the range of about 1 ppm to about 10,000 ppm of the confection. In embodiments where the confection comprises hard candy, rebaudioside I is present in an amount in the range of about 150 ppm to about 2250 ppm of the hard candy.

[0386] Condiment Compositions

[0387] In one embodiment, the present invention is a condiment that comprises rebaudioside I. In another embodiment the present invention is a condiment that comprises a composition comprising rebaudioside I. Condiments, as used herein, are compositions used to enhance or improve the flavor of a food or beverage. Non-limiting examples of condiments include ketchup (catsup); mustard; barbecue sauce; butter; chili sauce; chutney; cocktail sauce; curry; dips; fish sauce; horseradish; hot sauce; jellies, jams, marmalades, or preserves; mayonnaise; peanut butter; relish; remoulade; salad dressings (e.g., oil and vinegar, Caesar, French, ranch, bleu cheese, Russian, Thousand Island, Italian, and balsamic vinaigrette), salsa; sauerkraut; soy sauce; steak sauce; syrups; tartar sauce; and Worcestershire sauce.

[0388] Condiment bases generally comprise a mixture of different ingredients, non-limiting examples of which include vehicles (e.g., water and vinegar); spices or seasonings (e.g., salt, pepper, garlic, mustard seed, onion, paprika, turmeric, and combinations thereof); fruits, vegetables, or their products (e.g., tomatoes or tomato-based products (paste, puree), fruit juices, fruit juice peels, and combinations thereof); oils or oil emulsions, particularly vegetable oils; thickeners (e.g., xanthan gum, food starch, other hydrocolloids, and combinations thereof); and emulsifying agents (e.g., egg yolk solids, protein, gum arabic, carob bean gum, guar gum, gum karaya, gum tragacanth, carageenan, pectin, propylene glycol esters of alginic acid, sodium carboxymethyl-cellulose, polysorbates, and combinations thereof). Recipes for condiment bases and methods of making condiment bases are well known to those of ordinary skill in the art.

[0389] Generally, condiments also comprise caloric sweeteners, such as sucrose, high fructose corn syrup, molasses, honey, or brown sugar. In exemplary embodiments of the condiments provided herein, rebaudioside I or a composition comprising rebaudioside I is used instead of traditional caloric sweeteners. Accordingly, a condiment composition desirably comprises rebaudioside I or a composition comprising rebaudioside I and a condiment base.

[0390] The condiment composition optionally may include other natural and/or synthetic high-potency sweeteners, bulk sweeteners, pH modifying agents (e.g., lactic acid, citric acid, phosphoric acid, hydrochloric acid, acetic acid, and combinations thereof), fillers, functional agents (e.g., pharmaceutical agents, nutrients, or components of a food or plant), flavorings, colorings, or combinations thereof.

[0391] Chewing Gum Compositions

[0392] In one embodiment, the present invention is a chewing gum composition that comprises rebaudioside I. In another embodiment, the present invention is a chewing gum composition that comprises a composition comprising rebaudioside I. Chewing gum compositions generally comprise a water-soluble portion and a water-insoluble chewable gum base portion. The water soluble portion, which typically includes the composition of the present invention, dissipates with a portion of the flavoring agent over a period of time during chewing while the insoluble gum base portion is retained in the mouth. The insoluble gum base generally determines whether a gum is considered chewing gum, bubble gum, or a functional gum.

[0393] The insoluble gum base, which is generally present in the chewing gum composition in an amount in the range of about 15 to about 35 weight percent of the chewing gum composition, generally comprises combinations of elastomers, softeners (plasticizers), emulsifiers, resins, and fillers. Such components generally are considered food grade, recognized as safe (GRA), and/or are U.S. Food and Drug Administration (FDA)-approved.

[0394] Elastomers, the primary component of the gum base, provide the rubbery, cohesive nature to gums and can include one or more natural rubbers (e.g., smoked latex, liquid latex, or guayule); natural gums (e.g., jelutong, perillo, sorva, massaranduba balata, massaranduba chocolate, nispero, rosindinha, chicle, and gutta hang kang); or synthetic elastomers (e.g., butadiene-styrene copolymers, isobutylene-isoprene copolymers, polybutadiene, polyisobutylene, and vinyl polymeric elastomers). In a particular embodiment, the elastomer is present in the gum base in an amount in the range of about 3 to about 50 weight percent of the gum base.

[0395] Resins are used to vary the firmness of the gum base and aid in softening the elastomer component of the gum base. Non-limiting examples of suitable resins include a rosin ester, a terpene resin (e.g., a terpene resin from α-pinene, β-pinene and/or d-limonene), polyvinyl acetate, polyvinyl alcohol, ethylene vinyl acetate, and vinyl acetate-vinyl laurate copolymers. Non-limiting examples of rosin esters include a glycerol ester of a partially hydrogenated rosin, a glycerol ester of a polymerized rosin, a glycerol ester of a partially dimerized rosin, a glycerol ester of rosin, a pentaerythritol ester of a partially hydrogenated rosin, a methyl ester of rosin, or a methyl ester of a partially hydrogenated rosin. In a particular embodiment, the resin is present in the gum base in an amount in the range of about 5 to about 75 weight percent of the gum base.

[0396] Softeners, which also are known as plasticizers, are used to modify the ease of chewing and/or mouthfeel of the chewing gum composition. Generally, softeners comprise oils, fats, waxes, and emulsifiers. Non-limiting examples of oils and fats include tallow, hydrogenated tallow, large, hydrogenated or partially hydrogenated vegetable oils (e.g., soybean, canola, cottonseed, sunflower, palm, coconut, corn, safflower, or palm kernel oils), cocoa butter, glycerol monostearate, glycerol triacetate, glycerol abietate, leithin, monoglycerides, diglycerides, triglycerides acetylated monoglycerides, and free fatty acids. Non-limiting examples of waxes include polypropylene/polyethylene/Fisher-Tropsch waxes, paraffin, and microcrystalline and natural waxes (e.g., candelilla, beeswax and carnauba). Microcrystalline waxes, especially those with a high degree of crystallinity and a high melting point, also may be considered as bodying agents or textural modifiers. In a particular embodiment, the softeners are present in the gum base in an amount in the range of about 0.5 to about 25 weight percent of the gum base.

[0397] Emulsifiers are used to form a uniform dispersion of the insoluble and soluble phases of the chewing gum composition and also have plasticizing properties. Suitable emulsifiers include glycerol monostearate (GMS), lecithin (Phosphatidyl choline), polyglycerol polyricinoleic acid (PPGR), mono and diglycerides of fatty acids, glycerol distearate, tracetin, acetylated monoglyceride, glycerol triactetate, and magnesium stearate. In a particular embodiment, the emulsifiers are present in the gum base in an amount in the range of about 2 to about 30 weight percent of the gum base.

[0398] The chewing gum composition also may comprise adjuvants or fillers in either the gum base and/or the soluble portion of the chewing gum composition. Suitable adjuvants and fillers include lecithin, inulin, polydextrin, calcium carbonate, magnesium carbonate, magnesium silicate, ground limestome, aluminum hydroxide, aluminum silicate, talc, clay, alumina, titanium dioxide, and calcium phosphate. In particular embodiments, lecithin can be used as an inert filler to decrease the stickiness of the chewing gum composition. In other particular embodiments, lactic acid copolymers, proteins (e.g., gluten and/or zein) and/or guar can be used to create a gum that is more readily biodegradable. The adjuvants or fillers are generally present in the gum base in an amount up to about 20 weight percent of the gum base. Other optional ingredients include coloring agents, whiteners, preservatives, and flavors.

[0399] In particular embodiments of the chewing gum composition, the gum base comprises about 5 to about 95 weight percent of the chewing gum composition, more desirably about 15 to about 50 weight percent of the chewing gum composition, and even more desirably from about 20 to about 30 weight percent of the chewing gum composition.

[0400] The soluble portion of the chewing gum composition may optionally include other artificial or natural sweeteners, bulk sweeteners, softeners, emulsifiers, flavoring agents, coloring agents, adjuvants, fillers, functional agents (e.g., pharmaceutical agents or nutrients), or combinations thereof. Suitable examples of softeners and emulsifiers are described above.

[0401] Bulk sweeteners include both caloric and non-caloric compounds. Non-limiting examples of bulk sweeteners include sucrose, dextrose, maltose, dextrin, dried invert sugar, fructose, high fructose corn syrup, levulose, galactose, corn syrup solids, tagatose, polyols (e.g., sorbitol, mannitol, xylitol, lactitol, erythritol, and maltitol), hydrogenated starch hydrolysates, isomalt, trehalose, and mixtures thereof. In particular embodiments, the bulk sweetener is present in the chewing gum composition in an amount in the range of about 1 to about 75 weight percent of the chewing gum composition.

[0402] Flavoring agents may be used in either the insoluble gum base or soluble portion of the chewing gum composition. Such flavoring agents may be natural or artificial flavors. In a particular embodiment, the flavoring agent comprises an essential oil, such as an oil derived from a plant or a fruit, peppermint oil, spearmint oil, other mint oils, clove oil, cinnamon oil, oil of wintergreen, bay, thyme, cedar leaf, nutmeg, allspice, sage, mace, and almonds. In another particular embodiment, the flavoring agent comprises a plant extract or a fruit essence such as apple, banana, watermelon, pear, peach, grape, strawberry, raspberry, cherry, plum, pineapple, apricot, and mixtures thereof. In still another particular embodiment, the flavoring agent comprises a citrus flavor, such as an extract, essence, or oil of lemon, lime, orange, tangerine, grapefruit, citron, or kumquat.

[0403] In a particular embodiment, a chewing gum composition comprises rebaudioside I or a composition comprising rebaudioside I and a gum base. In a particular embodiment, rebaudioside I is present in the chewing gum composition in an amount in the range of about 1 ppm to about 10,000 ppm of the chewing gum composition.

[0404] Cereal Compositions

[0405] In one embodiment, the present invention is a cereal composition that comprises rebaudioside I. In another embodiment, the present invention is a cereal composition that comprises a composition comprising rebaudioside I. Cereal compositions typically are eaten either as staple foods or as snacks. Non-limiting examples of cereal compositions for use in particular embodiments include ready-to-eat cereals as well as hot cereals. Ready-to-eat cereals are cereals which may be eaten without further processing (i.e. cooking) by the consumer. Examples of ready-to-eat cereals include breakfast cereals and snack bars. Breakfast cereals typically are processed to produce a shredded, flaky, puffy, or extruded form. Breakfast cereals generally are eaten cold and are often mixed with milk and/or fruit. Snack bars include, for example, energy bars, rice cakes, granola bars, and nutritional bars. Hot cereals generally are cooked, usually in either milk or water, before being eaten. Non-limiting examples of hot cereals include grits, porridge, polenta, rice, and rolled oats.

[0406] Cereal compositions generally comprise at least one cereal ingredient. As used herein, the term “cereal ingredient” denotes materials such as whole or part grains, whole or part seeds, and whole or part grass. Non-limiting examples of cereal ingredients for use in particular embodiments include maize, wheat, rice, barley, bran, bran endosperm, bulgur, soghums, millets, oats, rye, triticale, buchwheat, fonio, quinoa, bean, soybean, amaranth, teff, spelt, and kaniwa.

[0407] In a particular embodiment, the cereal composition comprises rebaudioside I or a composition comprising rebaudioside I and at least one cereal ingredient. Rebaudioside I or the composition comprising rebaudioside I may be added to the cereal composition in a variety of ways, such as, for example, as a coating, as a frosting, as a glaze, or as a matrix blend (i.e. added as an ingredient to the cereal formulation prior to the preparation of the final cereal product).

[0408] Accordingly, in a particular embodiment, rebaudioside I or a composition comprising rebaudioside I is added to the cereal composition as a matrix blend. In one embodiment, rebaudioside I or a composition comprising rebaudioside I is blended with a hot cereal prior to cooking to provide a sweetened hot cereal product. In another embodiment, rebaudioside I or a composition comprising rebaudioside I is blended with the cereal matrix before the cereal is extruded.

[0409] In another particular embodiment, rebaudioside I or a composition comprising a rebaudioside I is added to the cereal composition as a coating, such as, for example, by combining rebaudioside I or a comprising rebaudioside I with a food grade oil and applying the mixture onto the cereal. In a different embodiment, rebaudioside I or a composition comprising rebaudioside I and the food grade oil may be applied to the cereal separately, by applying either the oil or the sweetener first. Non-limiting examples of food grade oils for use in particular embodiments include vegetable oils such as corn oil, soybean oil, cottonseed oil, peanut oil, coconut oil, canola oil, olive oil, sesame seed oil, palm oil, palm kernel oil, and mixtures thereof. In yet another embodiment, food grade fats may be used in place of the oils, provided that the fat is melted prior to applying the fat onto the cereal.

[0410] In another embodiment, rebaudioside I or a composition comprising rebaudioside I is added to the cereal composition as a glaze. Non-limiting examples of glazing agents for use in particular embodiments include corn syrup, honey syrups and honey syrup solids, maple syrups and maple syrup solids, sucrose, isomalt, polydextrose, polyols, hydrogenated starch hydrosylate, aqueous solutions thereof, and mixtures thereof. In another such embodiment, rebaudioside I or a composition comprising rebaudioside I is added as a glaze by combining with a glazing agent and a food grade oil or fat and applying the mixture to the cereal. In yet another embodiment, a gum system, such as, for example, gum acacia, carboxymethyl cellulose, or algin, may be added to the glaze to provide structural support. In addition, the glaze also may include a coloring agent, and also may include a flavor.

[0411] In another embodiment, rebaudioside I or a composition comprising rebaudioside I is added to the cereal composition as a frosting. In one such embodiment, rebaudioside I or a composition comprising rebaudioside I is combined with water and a frosting agent and then applied to the cereal. Non-limiting examples of frosting agents for use in particular embodiments include maltodextrin, sucrose, starch, polyols, and mixtures thereof. The frosting also may include a food grade oil, a food grade fat, a coloring agent, and/or a flavor.

[0412] Generally, the amount of rebaudioside I in a cereal composition varies widely depending on the particular type of cereal composition and its desired sweetness. Those of ordinary skill in the art can readily discern the appropriate amount of sweetener to put in the cereal composition. In a particular embodiment, rebaudioside I is present in the cereal composition in an amount in the range of about 0.02 to about 1.5 weight percent of the cereal composition and the at least one additive is present in the cereal composition in an amount in the range of about 1 to about 5 weight percent of the cereal composition.

[0413] Baked Goods

[0414] In one embodiment, the present invention is a baked good that comprises rebaudioside I. In another embodiment, the present invention is a baked good that comprises a composition comprising rebaudioside I. Baked goods, as used herein, include ready to eat and all ready to bake products, flours, and mixes requiring preparation before serving. Non-limiting examples of baked goods include cakes, crackers, cookies, brownies, muffins, rolls, bagels, donuts, strudels, pastries, croissants, biscuits, bread, bread products, and buns.

[0415] Preferred baked goods in accordance with embodiments of this invention can be classified into three groups: bread-type doughs (e.g., white breads, variety breads, soft buns, hard rolls, bagels, pizza dough, and flour tortillas), sweet doughs (e.g., danishes, croissants, crackers, puff pastry, pie crust, biscuits, and cookies), and batters (e.g., cakes such as sponge, pound, devil's food, cheesecake, and layer cake, donuts or other yeast raised cakes, brownies, and muffins). Doughs generally are characterized as being flour-based, whereas batters are more water-based.

[0416] Baked goods in accordance with particular embodiments of this invention generally comprise a combination of sweetener, water, and fat. Baked goods made in accordance with many embodiments of this invention also contain flour in order to make a dough or a batter. The term “dough” as used herein is a mixture of flour and other ingredients stiff enough to knead or roll. The term “batter” as used herein consists of flour, liquids such as milk or water, and other ingredients, and is thin enough to pour or drop from a spoon. Desirably, in accordance with particular embodiments of the invention, the flour is present in the baked goods in an amount in the range of about 15 to about 60% on a dry weight basis, more desirably from about 23 to about 48% on a dry weight basis.

[0417] The type of flour may be selected based on the desired product. Generally, the flour comprises an edible non-toxic flour that is conventionally utilized in baked goods. According to particular embodiments, the flour may be a bleached bake flour, general purpose flour, or unbleached flour. In other particular embodiments, flours also may be used that have been treated in other manners. For example, in particular embodiments flour may be enriched with additional vitamins, minerals, or proteins. Non-limiting examples of flours suitable for use in particular embodiments of the invention include wheat, corn meal, whole grain, fractions of whole grains (wheat, bran, and oatmeal), and combinations thereof. Starches or farinaceous material also may be used as the flour in particular embodiments. Common food starches generally are derived from potato, corn, wheat, barley, oat, tapioca, arrow root, and sago. Modified starches and pregelatinized starches also may be used in particular embodiments of the invention.

[0418] The type of fat or oil used in particular embodiments of the invention may comprise any edible fat, oil, or combination thereof that is suitable for baking. Non-limiting examples of fats suitable for use in particular embodiments of the invention include vegetable oils, tallow, lard, marine oils, and combinations thereof. According to particular embodiments, the fats may be fractionated, partially hydrogenated, and/or intensified. In another particular embodiment, the fat desirably comprises reduced, low calorie, or non-digestible fats, fat substitutes, or synthetic fats. In yet another particular embodiment, shortenings, fats, or mixtures of hard and soft fats also may be used. In particular embodiments, shortenings may be derived principally from triglycerides derived from vegetable sources (e.g., cotton seed oil, soybean oil, peanut oil, linseed oil, sesame oil, palm oil, palm kernel oil, rapeseed oil, safflower oil, coconut oil, corn oil, sunflower seed oil, and mixtures thereof). Synthetic or natural triglycerides of fatty acids having chain lengths from 8 to 24 carbon atoms also may be used in particular embodiments. Desirably, in accordance with particular embodiments of this invention, the fat is present in the baked good in an amount in the range of about 2 to about 35% by weight on a dry basis, more desirably from about 3 to about 29% by weight on a dry basis.

[0419] Baked goods in accordance with particular embodiments of this invention also comprise water in amounts sufficient to provide the desired consistency, enabling proper forming, machining and cutting of the baked good prior or subsequent to cooking. The total moisture content of the baked good includes any water added directly to the baked good as well as water present in separately added ingredients (e.g., flour, which generally includes about 12 to about 14% by weight moisture). Desirably, in accordance with particular embodiments of this invention, the water is present in the baked good in an amount up to about 25% by weight of the baked good.

[0420] Baked goods in accordance with particular embodiments of this invention also may comprise a number of additional conventional ingredients such as leavening agents, flavors, colors, milk, milk by-products, egg, egg by-products, cocoa, vanilla or other flavoring, as well as inclusions such as nuts, raisins, cherries, apples, apricots, peaches, other fruits, citrus peel, preservative, coconuts, flavored chips such a chocolate chips, butterscotch chips, and caramel chips, and combinations thereof. In particular embodiments, the baked goods may also comprise emulsifiers, such as lecithin and monoglycerides.

[0421] According to particular embodiments of this invention, leavening agents may comprise chemical leavening agents or yeast leavening agents. Non-limiting examples of chemical leavening agents suitable for use in particular embodiments of this invention include baking soda (e.g., sodium, potassium, or aluminum bicarbonate), baking acid (e.g., sodium aluminum phosphate, monocalcium phosphate, or dicalcium phosphate), and combinations thereof.

[0422] In accordance with another particular embodiment of this invention, cocoa may comprise natural or “Dutched” chocolate from which a substantial portion of the fat or cocoa butter has been expressed or removed by solvent extraction, pressing, or other means. In a particular embodiment, it may be necessary to reduce the amount of fat in a baked good comprising chocolate because of the additional fat present in cocoa butter. In particular embodiments, it may be necessary to add larger amounts of chocolate as compared to cocoa in order to provide an equivalent amount of flavoring and coloring.

[0423] Baked goods generally also comprise caloric sweeteners, such as sucrose, high fructose corn syrup, erythritol, molasses, honey, or brown sugar. In exemplary embodiments of the baked goods provided herein, the caloric sweetener is replaced partially or totally with rebaudioside I or a composition comprising rebaudioside I. Accordingly, in one embodiment a baked good comprises rebaudioside I or a composition comprising rebaudioside I in combination with a fat, water, and optionally flour. In a particular embodiment, the baked good optionally may include other natural and/or synthetic high-potency sweeteners and/or bulk sweeteners.

[0424] Dairy Products

[0425] In one embodiment, the consumable of the present invention is a dairy product that comprises rebaudioside I. In another embodiment, the consumable of the present invention is a dairy product that comprises a composition comprising rebaudioside I. Dairy products and processes for making dairy products suitable for use in this invention are well known to those of ordinary skill in the art. Dairy products, as used herein, comprise milk or foodstuffs produced from milk. Non-limiting examples of dairy products suitable for use in embodiments of this invention include milk, milk cream, sour cream, crème fraiche, buttermilk, cultured buttermilk, milk powder, condensed milk, evaporated milk, butter, cheese, cottage cheese, cream cheese, yogurt, ice cream, frozen custard, frozen yogurt, gelato, vla, piima, filmjolk, kajmak, kephir, viili, kumiss, airag, ice milk, casein, ayran, lassi, khoa, or combinations thereof.

[0426] Milk is a fluid secreted by the mammary glands of female mammals for the nourishment of their young. The female ability to produce milk is one of the defining characteristics of mammals and provides the primary source of nutrition for newborns before they are able to digest more diverse foods. In particular embodiments of this invention, the dairy products are derived from the raw milk of cows, goats, sheep, horses, donkeys, camels, water buffalo, yaks, reindeer, moose, or humans.

[0427] In particular embodiments of this invention, the processing of the dairy product from raw milk generally comprises the steps of pasteurizing, creaming, and homogenizing. Although raw milk may be consumed without pasteurization, it usually is pasteurized to destroy harmful microorganisms such as bacteria, viruses, protozoa, molds, and yeasts. Pasteurizing generally comprises heating the milk to a high temperature for a short period of time to substantially reduce the number of microorganisms, thereby reducing the risk of disease.

[0428] Creaming traditionally follows pasteurization step, and involves the separation of milk into a higher-fat cream layer and a lower-fat milk layer. Milk will separate into milk and cream layers upon standing for twelve to twenty-four hours. The cream rises to the top of the milk layer and may be skimmed and used as a separate dairy product. Alternatively, centrifuges may be used to separate the cream from the milk. The remaining milk is classified according to the fat content of the milk, non-limiting examples of which include whole, 2%, 1%, and skim milk.

[0429] After removing the desired amount of fat from the milk by creaming, milk is often homogenized. Homogenization prevents cream from separating from the milk and generally involves pumping the milk at high pressures through narrow tubes in order to break up fat globules in the milk. Pasteurization, creaming, and homogenization of milk are common but are not required to produce consumable dairy products. Accordingly, suitable dairy products for use in embodiments of this invention may undergo no processing steps, a single processing step, or combinations of the processing steps described herein. Suitable dairy products for use in embodiments of this invention may also undergo processing steps in addition to or apart from the processing steps described herein.

[0430] Particular embodiments of this invention comprise dairy products produced from milk by additional processing steps. As described above, cream may be skimmed from the top of milk or separated from the milk using machine-centrifuges. In a particular embodiment, the dairy product comprises sour cream, a dairy product rich in fats that is obtained by fermenting cream using a bacterial culture. The bacteria produce lactic acid during fermentation, which sours and thickens the cream. In another particular embodiment, the dairy product comprises crème fraiche, a heavy cream slightly soured with bacterial culture in a similar manner to sour cream. Créme fraiche ordinarily is not as thick or as sour as sour cream. In yet another particular embodiment, the dairy product comprises cultured buttermilk. Cultured buttermilk is obtained by adding bacteria to milk. The resulting fermentation, in which the bacterial culture turns lactose into lactic acid, gives cultured buttermilk a sour taste. Although it is produced in a different manner, cultured buttermilk generally is similar to traditional buttermilk, which is a by-product of butter manufacture.

[0431] According to other particular embodiments of this invention, the dairy products comprise milk powder, condensed milk, evaporated milk, or combinations thereof. Milk powder, condensed milk, and evaporated milk generally are produced by removing water from milk. In a particular embodiment, the dairy product comprises a milk powder comprising dried milk solids with a low moisture content. In another particular embodiment, the dairy product comprises condensed milk. Condensed milk generally comprises milk with a reduced water content and added sweetener, yielding a thick, sweet product with a long shelf-life. In yet another particular embodiment, the dairy product comprises evaporated milk. Evaporated milk generally comprises fresh, homogenized milk from which about 60% of the water has been removed, that has been chilled, fortified with additives such as vitamins and stabilizers, packaged, and finally sterilized. According to another particular embodiment of this invention, the dairy product comprises a dry creamer and rebaudioside I or a composition comprising rebaudioside I.

[0432] In another particular embodiment, the dairy product provided herein comprises butter. Butter generally is made by churning fresh or fermented cream or milk. Butter generally comprises butterfat surrounding small droplets comprising mostly water and milk proteins. The churning process damages the membranes surrounding the microscopic globules of butterfat, allowing the milk fats to conjoin and to separate from the other parts of the cream. In yet another particular embodiment, the dairy product comprises buttermilk, which is the sour-tasting liquid remaining after producing butter from full-cream milk by the churning process.

[0433] In still another particular embodiment, the dairy product comprises cheese, a solid foodstuff produced by curdling milk using a combination of rennet or rennet substitutes and acidification. Rennet, a natural complex of enzymes produced in mammalian stomachs to digest milk, is used in cheese-making to curdle the milk, causing it to separate into solids known as curds and liquids known as whey. Generally, rennet is obtained from the stomachs of young ruminants, such as calves; however, alternative sources of rennet include some plants, microbial organisms, and genetically modified bacteria, fungus, or yeast. In addition, milk may be coagulated by adding acid, such as citric acid. Generally, a combination of rennet and/or acidification is used to curdle the milk. After separating the milk into curds and whey, some cheeses are made by simply draining, salting, and packaging the curds. For most cheeses, however, more processing is needed. Many different methods may be used to produce the hundreds of available varieties of cheese. Processing methods include heating the cheese, cutting it into small cubes to drain, salting, stretching, cheddaring, washing, molding, aging, and ripening. Some cheeses, such as the blue cheeses, have additional bacteria or molds introduced to them before or during aging, imparting flavor and aroma to the finished product. Cottage cheese is a cheese curd product with a mild flavor that is drained but not pressed so that some whey remains. The curd is usually washed to remove acidity. Cream cheese is a soft, mild-tasting, white cheese with a high fat content that is produced by adding cream to milk and then curdling to form a rich curd. Alternatively, cream cheese can be made from skim milk with cream added to the curd. It should be understood that cheese, as used herein, comprises all solid foodstuff produced by the curdling milk.

[0434] In another particular embodiment of this invention, the dairy product comprises yogurt. Yogurt generally is produced by the bacterial fermentation of milk. The fermentation of lactose produces lactic acid, which acts on proteins in milk to give the yogurt a gel-like texture and tartness. In particularly desirable embodiments, the yogurt may be sweetened with a sweetener and/or flavored. Non-limiting examples of flavorings include, but are not limited to, fruits (e.g., peach, strawberry, banana), vanilla, and chocolate. Yogurt, as used herein, also includes yogurt varieties with different consistencies and viscosities, such as dahi, dadih or dadiah, labneh or labaneh, bulgarian, kefir, and matsoni. In another particular embodiment, the dairy product comprises a yogurt-based beverage, also known as drinkable yogurt or a yogurt smoothie. In particularly desirable embodiments, the yogurt-based beverage may comprise sweeteners, flavorings, other ingredients, or combinations thereof.

[0435] Other dairy products beyond those described herein may be used in particular embodiments of this invention. Such dairy products are well known to those of ordinary skill in the art, non-limiting examples of which include milk, milk and juice, coffee, tea, vla, piima, filmjolk, kajmak, kephir, viili, kumiss, airag, ice milk, casein, ayran, lassi, and khoa.

[0436] According to particular embodiments of this invention, the dairy compositions also may comprise other additives. Non-limiting examples of suitable additives include sweeteners and flavorants such as chocolate, strawberry, and banana. Particular embodiments of the dairy compositions provided herein also may comprise additional nutritional supplements such as vitamins (e.g., vitamin D) and minerals (e.g., calcium) to improve the nutritional composition of the milk.

[0437] In a particularly desirable embodiment, the dairy composition comprises rebaudioside I or a composition comprising rebaudioside I in combination with a dairy product. In a particular embodiment, rebaudioside I is present in the dairy composition in an amount in the range of about 200 to about 20,000 weight percent of the dairy composition.

[0438] Rebaudioside I or compositions comprising rebaudioside I is also suitable for use in processed agricultural products, livestock products or seafood; processed meat products such as sausage and the like; retort food products, pickles, preserves boiled in soy sauce, delicacies, side dishes; soups; snacks such as potato chips, cookies, or the like; as shredded filler, leaf, stem, stalk, homogenized leaf cured and animal feed.

[0439] Tabletop Sweetener Compositions

[0440] In one embodiment, the present invention is a tabletop sweetener comprising rebaudioside I. The tabletop composition can further include at least one bulking agent, additive, anti-caking agent, functional ingredient or combination thereof.

[0441] Suitable “bulking agents” include, but are not limited to, maltodextrin (10 DE, 18 DE, or 5 DE), corn syrup solids (20 or 36 DE), sucrose, fructose, glucose, invert sugar, sorbitol, xylose, ribulose, mannose, xylitol, mannitol, galactitol, erythritol, maltitol, lactitol, isomalt, maltose, tagatose, lactose, inulin, glycerol, propylene glycol, polyols, polydextrose, fructooligosaccharides, cellulose and cellulose derivatives, and the like, and mixtures thereof. Additionally, in accordance with still other embodiments of the invention, granulated sugar (sucrose) or other caloric sweeteners such as crystalline fructose, other carbohydrates, or sugar alcohol can be used as a bulking agent due to their provision of good content uniformity without the addition of significant calories.

[0442] As used herein, the phrase “anti-caking agent” and “flow agent” refer to any composition which assists in content uniformity and uniform dissolution. In accordance with particular embodiments, non-limiting examples of anti-caking agents include cream of tartar, calcium silicate, silicon dioxide, microcrystalline cellulose (Avicel, FMC BioPolymer, Philadelphia, Pa.), and tricalcium phosphate. In one embodiment, the anti-caking agents are present in the tabletop sweetener composition in an amount from about 0.001 to about 3% by weight of the tabletop sweetener composition.

[0443] The tabletop sweetener compositions can be packaged in any form known in the art. Non-limiting forms include, but are not limited to, powder form, granular form, packets, tablets, sachets, pellets, cubes, solids, and liquids.

[0444] In one embodiment, the tabletop sweetener composition is a single-serving (portion control) packet comprising a dry-blend. Dry-blend formulations generally may comprise powder or granules. Although the tabletop sweetener composition may be in a packet of any size, an illustrative non-limiting example of conventional portion control tabletop sweetener packets are approximately 2.5 by 1.5 inches and hold approximately 1 gram of a sweetener composition having a sweetness equivalent to 2 teaspoons of granulated sugar (˜8 g). The amount of rebaudioside I in a dry-blend tabletop sweetener formulation can vary. In a particular embodiment, a dry-blend tabletop sweetener formulation may contain rebaudioside I in an amount from about 1% (w/w) to about 10% (w/w) of the tabletop sweetener composition.

[0445] Solid tabletop sweetener embodiments include cubes and tablets. A non-limiting example of conventional cubes are equivalent in size to a standard cube of granulated sugar, which is approximately 2.2×2.2×2.2 cm.sup.3 and weigh approximately 8 g. In one embodiment, a solid tabletop sweetener is in the form of a tablet or any other form known to those skilled in the art.

[0446] A tabletop sweetener composition also may be embodied in the form of a liquid, wherein rebaudioside I is combined with a liquid carrier. Suitable non-limiting examples of carrier agents for liquid tabletop sweeteners include water, alcohol, polyol, glycerin base or citric acid base dissolved in water, and mixtures thereof. The sweetness equivalent of a tabletop sweetener composition for any of the forms described herein or known in the art may be varied to obtain a desired sweetness profile. For example, a tabletop sweetener composition may comprise a sweetness comparable to that of an equivalent amount of standard sugar. In another embodiment, the tabletop sweetener composition may comprise a sweetness of up to 100 times that of an equivalent amount of sugar. In another embodiment, the tabletop sweetener composition may comprise a sweetness of up to 90 times, 80 times, 70 times, 60 times, 50 times, 40 times, 30 times, 20 times, 10 times, 9 times, 8 times, 7 times, 6 times, 5 times, 4 times, 3 times, and 2 times that of an equivalent amount of sugar.

[0447] Beverage and Beverage Products

[0448] In one embodiment, the present invention is a beverage or beverage product comprising rebaudioside I. In another embodiment, the present invention is a beverage or beverage comprising a composition that comprises rebaudioside I (e.g., a sweetener composition).

[0449] As used herein a “beverage product” is a ready-to-drink beverage, a beverage concentrate, a beverage syrup, or a powdered beverage. Suitable ready-to-drink beverages include carbonated and non-carbonated beverages. Carbonated beverages include, but are not limited to, enhanced sparkling beverages, cola, lemon-lime flavored sparkling beverage, orange flavored sparkling beverage, grape flavored sparkling beverage, strawberry flavored sparkling beverage, pineapple flavored sparkling beverage, ginger-ale, soft drinks and root beer. Non-carbonated beverages include, but are not limited to fruit juice, fruit-flavored juice, juice drinks, nectars, vegetable juice, vegetable-flavored juice, sports drinks, energy drinks, enhanced water drinks, enhanced water with vitamins, near water drinks (e.g., water with natural or synthetic flavorants), coconut water, tea type drinks (e.g. black tea, green tea, red tea, oolong tea), coffee, cocoa drink, beverage containing milk components (e.g. milk beverages, coffee containing milk components, café au lait, milk tea, fruit milk beverages), beverages containing cereal extracts, smoothies and combinations thereof.

[0450] Beverage concentrates and beverage syrups are prepared with an initial volume of liquid matrix (e.g. water) and the desired beverage ingredients. Full strength beverages are then prepared by adding further volumes of water. Powdered beverages are prepared by dry-mixing all of the beverage ingredients in the absence of a liquid matrix. Full strength beverages are then prepared by adding the full volume of water.

[0451] Beverages comprise a liquid matrix, i.e. the basic ingredient in which the ingredients—including the compositions of the present invention—are dissolved. In one embodiment, a beverage comprises water of beverage quality as the liquid matrix, such as, for example deionized water, distilled water, reverse osmosis water, carbon-treated water, purified water, demineralized water and combinations thereof, can be used. Additional suitable liquid matrices include, but are not limited to phosphoric acid, phosphate buffer, citric acid, citrate buffer and carbon-treated water.

[0452] In one embodiment, the consumable of the present invention is a beverage that comprises rebaudioside I.

[0453] In another embodiment, a beverage contains a composition comprising rebaudioside I.

[0454] In a further embodiment, the present invention is a beverage product comprising rebaudioside I.

[0455] In another embodiment, the present invention is a beverage product that contains a composition comprising rebaudioside I.

[0456] The concentration of rebaudioside I in the beverage or beverage product may be above, at or below its threshold sweetness or recognition concentration.

[0457] In a particular embodiment, the concentration of rebaudioside I in the beverage or beverage product is above its threshold sweetness or flavor recognition concentration. In one embodiment, the concentration of rebaudioside I is at least about 1%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, about least about 35%, at least about 40%, about least about 45%, at least about 50% or more above its threshold sweetness or flavor recognition concentration.

[0458] In another particular embodiment, the concentration of rebaudioside I in the beverage or beverage product is at or approximately the threshold sweetness or flavor recognition concentration of rebaudioside I.

[0459] In yet another particular embodiment, the concentration of rebaudioside I in the beverage or beverage product is below the threshold sweetness or flavor recognition concentration of rebaudioside I. In one embodiment, the concentration of rebaudioside I is at least about 1%, at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, about least about 35%, at least about 40%, about least about 45%, at least about 50% or more below its threshold sweetness or flavor recognition concentration.

[0460] In one embodiment, the present invention is a beverage or beverage product that contains rebaudioside I in an amount ranging from about 1 ppm to about 10,000 ppm, such as, for example, from about 5 ppm to about 10,000 ppm, from about 10 ppm to about 10,000 ppm, from about 15 ppm to about 10,000 ppm, from about 20 ppm to about 10,000 ppm or from about 25 ppm to about 10,000. In another embodiment, rebaudioside I is present in a beverage in an amount ranging from about 100 ppm to about 600 ppm. In yet other embodiments, rebaudioside I is present in a beverage in an amount ranging from about 100 to about 200 ppm, from about 100 ppm to about 300 ppm, from about 100 ppm to about 400 ppm, or from about 100 ppm to about 500 ppm. In still another embodiment, rebaudioside I is present in the beverage or beverage product in an amount ranging from about 300 to about 700 ppm, such as, for example, from about 400 ppm to about 600 ppm. In a further embodiment, rebaudioside I is present in the beverage or beverage product in an amount ranging from about 200 ppm to about 400 ppm, such as, for example, about 200 to about 250 ppm, about 250 ppm to about 300 ppm, about 300 to about 350 ppm or about 350 ppm In a still further embodiment, rebaudioside I is present in the beverage or beverage product in an amount ranging from about 450 ppm to about 650 ppm, such as, for example, about 450 ppm to about 500 ppm, about 500 ppm to about 550 ppm, about 550 ppm to about 600 ppm, or about 600 to about 650 ppm.

[0461] In an exemplary embodiment, the present beverage is a comprising rebaudioside I in an amount from about 200 to about 300 ppm, and more particularly, about 200 ppm, about 225, about 250 ppm, about 275 ppm, or about 300 ppm.

[0462] In an exemplary embodiment, the present beverage is a comprising rebaudioside I in an amount from about 500 to about 600 ppm, and more particularly, about 500 ppm, about 525 ppm, about 550 ppm, about 575 ppm or about 600 ppm.

[0463] The beverage can further include at least one additional sweetener. Any of the sweeteners detailed herein can be used, including natural, non-natural, or synthetic sweeteners. These may be added to the beverage either before, contemporaneously with or after rebaudioside I.

[0464] In one embodiment, the beverage contains a carbohydrate sweetener in a concentration from about 100 ppm to about 140,000 ppm. Synthetic sweeteners may be present in the beverage in a concentration from about 0.3 ppm to about 3,500 ppm. Natural high potency sweeteners may be present in the beverage in a concentration from about 0.1 ppm to about 3,000 ppm.

[0465] The beverage can further comprise additives including, but not limited to, carbohydrates, polyols, amino acids and their corresponding salts, poly-amino acids and their corresponding salts, sugar acids and their corresponding salts, nucleotides, organic acids, inorganic acids, organic salts including organic acid salts and organic base salts, inorganic salts, bitter compounds, caffeine, flavorants and flavoring ingredients, astringent compounds, proteins or protein hydrolysates, surfactants, emulsifiers, weighing agents, juice, dairy, cereal and other plant extracts, flavonoids, alcohols, polymers and combinations thereof. Any suitable additive described herein can be used.

[0466] In one embodiment, the polyol can be present in the beverage in a concentration from about 100 ppm to about 250,000 ppm, such as, for example, from about 5,000 ppm to about 40,000 ppm.

[0467] In another embodiment, the amino acid can be present in the beverage in a concentration from about 10 ppm to about 50,000 ppm, such as, for example, from about 1,000 ppm to about 10,000 ppm, from about 2,500 ppm to about 5,000 ppm or from about 250 ppm to about 7,500 ppm.

[0468] In still another embodiment, the nucleotide can be present in the beverage in a concentration from about 5 ppm to about 1,000 ppm.

[0469] In yet another embodiment, the organic acid additive can be present in the beverage in a concentration from about 10 ppm to about 5,000 ppm.

[0470] In yet another embodiment, the inorganic acid additive can be present in the beverage in a concentration from about 25 ppm to about 25,000 ppm.

[0471] In still another embodiment, the bitter compound can be present in the beverage in a concentration from about 25 ppm to about 25,000 ppm.

[0472] In yet another embodiment, the flavorant can be present in the beverage a concentration from about 0.1 ppm to about 4,000 ppm.

[0473] In a still further embodiment, the polymer can be present in the beverage in a concentration from about 30 ppm to about 2,000 ppm.

[0474] In another embodiment, the protein hydrosylate can be present in the beverage in a concentration from about 200 ppm to about 50,000.

[0475] In yet another embodiment, the surfactant additive can be present in the beverage in a concentration from about 30 ppm to about 2,000 ppm.

[0476] In still another embodiment, the flavonoid additive can be present in the beverage a concentration from about 0.1 ppm to about 1,000 ppm.

[0477] In yet another embodiment, the alcohol additive can be present in the beverage in a concentration from about 625 ppm to about 10,000 ppm.

[0478] In a still further embodiment, the astringent additive can be present in the beverage in a concentration from about 10 ppm to about 5,000 ppm.

[0479] The beverage can further contain one or more functional ingredients, detailed above. Functional ingredients include, but are not limited to, vitamins, minerals, antioxidants, preservatives, glucosamine, polyphenols and combinations thereof. Any suitable functional ingredient described herein can be used.

[0480] It is contemplated that the pH of the consumable, such as, for example, a beverage, does not materially or adversely affect the taste of the sweetener. A non-limiting example of the pH range of the beverage may be from about 1.8 to about 10. A further example includes a pH range from about 2 to about 5. In a particular embodiment, the pH of beverage can be from about 2.5 to about 4.2. On of skill in the art will understand that the pH of the beverage can vary based on the type of beverage. Dairy beverages, for example, can have pHs greater than 4.2.

[0481] The titratable acidity of a beverage comprising rebaudioside I may, for example, range from about 0.01 to about 1.0% by weight of beverage.

[0482] In one embodiment, the sparkling beverage product has an acidity from about 0.01 to about 1.0% by weight of the beverage, such as, for example, from about 0.05% to about 0.25% by weight of beverage.

[0483] The carbonation of a sparkling beverage product has 0 to about 2% (w/w) of carbon dioxide or its equivalent, for example, from about 0.1 to about 1.0% (w/w).

[0484] The temperature of a beverage may, for example, range from about 4° C. to about 100° C., such as, for example, from about 4° C. to about 25° C.

[0485] The beverage can be a full-calorie beverage that has up to about 120 calories per 8 oz serving.

[0486] The beverage can be a mid-calorie beverage that has up to about 60 calories per 8 oz serving.

[0487] The beverage can be a low-calorie beverage that has up to about 40 calories per 8 oz serving.

[0488] The beverage can be a zero-calorie that has less than about 5 calories per 8 oz. serving.

[0489] Methods of Use

[0490] The compounds and compositions of the present invention can be used to impart sweetness or to enhance the flavor or sweetness of consumables or other compositions.

[0491] In another aspect, the present invention is a method of preparing a consumable comprising (i) providing a consumable matrix and (ii) adding rebaudioside I to the consumable matrix to provide a consumable.

[0492] In a particular embodiment, the present invention is a method of preparing a beverage comprising (i) providing a liquid or beverage matrix and (ii) adding rebaudioside I to the consumable matrix to provide a beverage.

[0493] In another aspect, the present invention is a method of preparing a sweetened consumable comprising (i) providing a sweetenable consumable and (ii) adding rebaudioside I to the sweetenable consumable to provide a sweetened consumable.

[0494] In a particular embodiment, the present invention is a method of preparing a sweetened beverage comprising (i) providing a sweetenable beverage and (ii) adding rebaudioside I to the sweetenable beverage to provide a sweetened beverage.

[0495] In the above methods, rebaudioside I may be provided as such, or in form of a composition. When the rebaudioside I is provided as a composition, the amount of the composition is effective to provide a concentration of rebaudioside I that is above, at or below its threshold flavor or sweetness recognition concentration when the composition is added to the consumable (e.g., the beverage). When rebaudioside I is not provided as a composition, it may be added to the consumable at a concentration that is above, at or below its threshold flavor or sweetness recognition concentration.

[0496] In one embodiment, the present invention is a method for enhancing the sweetness of a consumable comprising (i) providing a consumable comprising one or more sweet ingredients and (ii) adding rebaudioside I (1) to the consumable to provide a consumable with enhanced sweetness, wherein rebaudioside I is added to the consumable at a concentration at or below its threshold sweetness recognition concentration. In a particular embodiment, rebaudioside I is added to the consumable at a concentration below its threshold sweetness recognition concentration.

[0497] In another embodiment, the present invention is a method for enhancing the sweetness of a consumable comprising (i) providing a consumable comprising one or more sweet ingredients and (ii) adding a composition comprising rebaudioside I to the consumable to provide a consumable with enhanced sweetness, wherein rebaudioside I is present in the composition in an amount effective to provide a concentration of rebaudioside I at or below its threshold sweetness recognition concentration when the composition is added to the consumable. In a particular embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration of rebaudioside I below its threshold sweetness recognition concentration.

[0498] In a particular embodiment, the present invention is a method for enhancing the sweetness of a beverage comprising (i) providing a beverage comprising at least one sweet ingredient and (ii) adding rebaudioside I to the beverage to provide a beverage with enhanced sweetness, wherein rebaudioside I is added to the beverage in an amount effective to provide a concentration at or below its threshold sweetness recognition concentration. In a particular embodiment, rebaudioside I is added to the consumable in an amount effective to provide a concentration below its threshold sweetness recognition concentration.

[0499] In another particular embodiment, the present invention is a method for enhancing the sweetness of a beverage comprising (i) providing a beverage comprising one or more sweet ingredients and (ii) adding a composition comprising rebaudioside I to the consumable to provide a beverage with enhanced sweetness, wherein rebaudioside I is present in the composition in an amount effective to provide a concentration of rebaudioside I at or below its threshold sweetness recognition concentration when the composition is added to the beverage. In a particular embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration of rebaudioside I below its threshold sweetness recognition concentration when the composition is added to the beverage.

[0500] In another embodiment, the present invention is method for enhancing the flavor of a consumable, comprising (i) providing a consumable comprising at least one flavor ingredient and (ii) adding rebaudioside I to the consumable to provide a consumable with enhanced flavor, wherein rebaudioside I is added to the consumable at a concentration at or below its threshold flavor recognition concentration. In a particular embodiment, rebaudioside I is added to the consumable at a concentration below this threshold flavor recognition concentration.

[0501] In another embodiment, the present invention is a method for enhancing the flavor of a consumable comprising (i) providing a consumable comprising at least one flavor ingredient and (ii) adding a composition rebaudioside I to the consumable to provide a consumable with enhanced flavor, wherein rebaudioside I is present in the composition in an amount effective to provide a concentration of rebaudioside I at or below its threshold flavor recognition concentration when the composition is added to the consumable. In a particular embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration of rebaudioside I below its threshold flavor recognition concentration when the composition is added to the consumable.

[0502] In a particular embodiment, the present invention is a method for enhancing the flavor of a beverage comprising (i) providing a beverage comprising at least one flavor ingredient and (ii) adding rebaudioside I to the beverage to provide a beverage with enhanced flavor, wherein rebaudioside I is added to the beverage at a concentration at or below its threshold flavor recognition concentration. In a particular embodiment, rebaudioside I is added to the consumable at a concentration below its threshold flavor recognition concentration.

[0503] In a particular embodiment, the present invention is a method for enhancing the flavor of a beverage comprising (i) providing a beverage comprising at least one flavor ingredient and (ii) adding a composition comprising rebaudioside I to the beverage to provide a beverage with enhanced flavor wherein rebaudioside I is present in the composition in an amount effective to provide a concentration of rebaudioside I at or below its threshold flavor recognition concentration when the composition is added to the beverage. In a particular embodiment, rebaudioside I is present in the composition in an amount effective to provide a concentration of rebaudioside I below its threshold flavor recognition concentration when the composition is added to the consumable.

[0504] The present invention also includes methods of preparing sweetened compositions (e.g., sweetened consumables) and flavor enhanced compositions (e.g., flavored enhanced consumables) by adding rebaudioside I or compositions comprising rebaudioside I to such compositions/consumables.

[0505] The following examples illustrate preferred embodiments of the invention. It will be understood that the invention is not limited to the materials, proportions, conditions and procedures set forth in the examples, which are only illustrative.

Example 1

In-Vivo Production of UGT76G1

[0506] NcoI and NdeI restriction sides were added to the original nucleic sequence as described in Genbank accession no. AAR06912.1. After codon optimization the following nucleic sequence was obtained:

TABLE-US-00005 (SEQ ID NO: 1) CCATGGCCCATATGGAAAACAAAACCGAAACCACCGTTCGTCGTCGT CGCCGTATTATTCTGTTTCCGGTTCCGTTTCAGGGTCATATTAATCC GATTCTGCAGCTGGCAAATGTGCTGTATAGCAAAGGTTTTAGCATTA CCATTTTTCATACCAATTTTAACAAACCGAAAACCAGCAATTATCCG CATTTTACCTTTCGCTTTATTCTGGATAATGATCCGCAGGATGAACG CATTAGCAATCTGCCGACACATGGTCCGCTGGCAGGTATGCGTATTC CGATTATTAACGAACATGGTGCAGATGAACTGCGTCGTGAACTGGAA CTGCTGATGCTGGCAAGCGAAGAAGATGAAGAAGTTAGCTGTCTGAT TACCGATGCACTGTGGTATTTTGCACAGAGCGTTGCAGATAGCCTGA ATCTGCGTCGTCTGGTTCTGATGACCAGCAGCCTGTTTAACTTTCAT GCACATGTTAGCCTGCCGCAGTTTGATGAACTGGGTTATCTGGATCC GGATGATAAAACCCGTCTGGAAGAACAGGCAAGCGGTTTTCCGATGC TGAAAGTGAAAGATATCAAAAGCGCCTATAGCAATTGGCAGATTCTG AAAGAAATTCTGGGCAAAATGATTAAACAGACCAAAGCAAGCAGCGG TGTTATTTGGAATAGCTTTAAAGAACTGGAAGAAAGCGAACTGGAAA CCGTGATTCGTGAAATTCCGGCACCGAGCTTTCTGATTCCGCTGCCG AAACATCTGACCGCAAGCAGCAGCAGCCTGCTGGATCATGATCGTAC CGTTTTTCAGTGGCTGGATCAGCAGCCTCCGAGCAGCGTTCTGTATG TTAGCTTTGGTAGCACCAGCGAAGTTGATGAAAAAGATTTTCTGGAA ATTGCCCGTGGTCTGGTTGATAGCAAACAGAGCTTTCTGTGGGTTGT TCGTCCGGGTTTTGTTAAAGGTAGCACCTGGGTTGAACCGCTGCCGG ATGGTTTTCTGGGTGAACGTGGTCGTATTGTTAAATGGGTTCCGCAG CAAGAAGTTCTGGCACACGGCGCAATTGGTGCATTTTGGACCCATAG CGGTTGGAATAGCACCCTGGAAAGCGTTTGTGAAGGTGTTCCGATGA TTTTTAGCGATTTTGGTCTGGATCAGCCGCTGAATGCACGTTATATG AGTGATGTTCTGAAAGTGGGTGTGTATCTGGAAAATGGTTGGGAACG TGGTGAAATTGCAAATGCAATTCGTCGTGTTATGGTGGATGAAGAAG GTGAATATATTCGTCAGAATGCCCGTGTTCTGAAACAGAAAGCAGAT GTTAGCCTGATGAAAGGTGGTAGCAGCTATGAAAGCCTGGAAAGTCT GGTTAGCTATATTAGCAGCCTGTAATAACTCGAG.

[0507] After synthesis of the gene and subcloning into pET30A+ vector using NdeI and XhoI cloning sites, the UGT76G1_pET30a+ plasmid was introduced in E. coli B121(DE3) and E. coli EC100 by electroporation. The obtained cells were grown in petri-dishes in the presence of Kanamycin and suitable colonies were selected and allowed to grow in liquid LB medium (erlenmeyer flasks). Glycerol was added to the suspension as cryoprotectant and 400 μL aliquots were stored at −20° C. and at −80° C.

[0508] The storage aliquots of E. coli BL21(DE3) containing the pET30A+_UGT76G1 plasmid were thawed and added to 30 mL of LBGKP medium (20 g/L Luria Broth Lennox; 50 mM PIPES buffer pH 7.00; 50 mM Phosphate buffer pH 7.00; 2.5 g/L glucose and 50 mg/L of Kanamycin). This culture was allowed to shake at 135 rpm at 30° C. for 8 h.

[0509] The production medium contained 60 g/L of overnight express instant TB medium (Novagen), 10 g/L of glycerol and 50 mg/L of Kanamycin. The medium was allowed to stir at 20° C. while taking samples to measure the OD and pH. The cultures gave significant growth and a good OD was obtained. After 40 h, the cells were harvested by centrifugation and frozen to yield 12.7 g of cell wet weight.

[0510] Lysis was performed by addition of Bugbuster Master mix (Novagen) and the lysate was recovered by centrifugation and kept frozen. Activity tests were performed with thawed lysate.

Example 2

In-Vitro Production of UGT76G1

[0511] The S30 T7 High Yield Protein expression system kit from Promega was used. 4 μg of UGT76G1_pET30a+ plasmid from E. coli EC100 was mixed with 80 μL of S30 premix plus and 72 μL of S30 T7 extract was added. Nuclease-free water was added in order to obtain a total volume of 200 μL and the resulting solution was incubated for 2 h at 30° C. 180 μL was used in the catalytic test reaction.

Example 3

In-Vitro Production of UGT91D2

[0512] NcoI and NdeI restriction sides were added to the original nucleic sequence as described in Genbank accession no. ACE87855.1. After codon optimization the following nucleic sequence was obtained:

TABLE-US-00006 (SEQ ID NO: 2) CCATGGCACATATGGCAACCAGCGATAGCATTGTTGATGATCGTAAA CAGCTGCATGTTGCAACCTTTCCGTGGCTGGCATTTGGTCATATTCT GCCGTATCTGCAGCTGAGCAAACTGATTGCAGAAAAAGGTCATAAAG TGAGCTTTCTGAGCACCACCCGTAATATTCAGCGTCTGAGCAGCCAT ATTAGTCCGCTGATTAATGTTGTTCAGCTGACCCTGCCTCGTGTTCA AGAACTGCCGGAAGATGCCGAAGCAACCACCGATGTTCATCCGGAAG ATATTCCGTATCTGAAAAAAGCAAGTGATGGTCTGCAGCCGGAAGTT ACCCGTTTTCTGGAACAGCATAGTCCGGATTGGATCATCTATGATTA TACCCATTATTGGCTGCCGAGCATTGCAGCAAGCCTGGGTATTAGCC GTGCACATTTTAGCGTTACCACCCCGTGGGCAATTGCATATATGGGT CCGAGCGCAGATGCAATGATTAATGGTAGTGATGGTCGTACCACCGT TGAAGATCTGACCACCCCTCCGAAATGGTTTCCGTTTCCGACCAAAG TTTGTTGGCGTAAACATGATCTGGCACGTCTGGTTCCGTATAAAGCA CCGGGTATTAGTGATGGTTATCGTATGGGTCTGGTTCTGAAAGGTAG CGATTGTCTGCTGAGCAAATGCTATCATGAATTTGGCACCCAGTGGC TGCCGCTGCTGGAAACCCTGCATCAGGTTCCGGTTGTTCCGGTGGGT CTGCTGCCTCCGGAAGTTCCGGGTGATGAAAAAGATGAAACCTGGGT TAGCATCAAAAAATGGCTGGATGGTAAACAGAAAGGTAGCGTGGTTT ATGTTGCACTGGGTAGCGAAGTTCTGGTTAGCCAGACCGAAGTTGTT GAACTGGCACTGGGTCTGGAACTGAGCGGTCTGCCGTTTGTTTGGGC ATATCGTAAACCGAAAGGTCCGGCAAAAAGCGATAGCGTTGAACTGC CGGATGGTTTTGTTGAACGTACCCGTGATCGTGGTCTGGTTTGGACC AGCTGGGCACCTCAGCTGCGTATTCTGAGCCATGAAAGCGTTTGTGG TTTTCTGACCCATTGTGGTAGCGGTAGCATTGTGGAAGGTCTGATGT TTGGTCATCCGCTGATTATGCTGCCGATTTTTGGTGATCAGCCGCTG AATGCACGTCTGCTGGAAGATAAACAGGTTGGTATTGAAATTCCGCG TAATGAAGAAGATGGTTGCCTGACCAAAGAAAGCGTTGCACGTAGCC TGCGTAGCGTTGTTGTTGAAAAAGAAGGCGAAATCTATAAAGCCAAT GCACGTGAACTGAGCAAAATCTATAATGATACCAAAGTGGAAAAAGA ATATGTGAGCCAGTTCGTGGATTATCTGGAAAAAAACACCCGTGCAG TTGCCATTGATCACGAAAGCTAATGACTCGAG

[0513] After synthesis of the gene and subcloning into pET30A+ vector using NcoI and XhoI cloning sites, the UGT91D2_pET30a+ plasmid was introduced into E. coli EC100 by electroporation. The obtained cells were grown in the presence of Kanamycin and suitable colonies were selected and allowed to grow in liquid LB medium (erlenmeyer flasks). Glycerol was added to the suspension as cryoprotectant and 400 μL aliquots were stored at −20° C. and at −80° C.

[0514] The S30 T7 High Yield Protein expression system kit from Promega was used for the in-vitro synthesis of the protein.

[0515] 4 μg of UGT91D2_pET30a+ plasmid was mixed with 80 μL of S30 premix plus and 72 μL of S30 T7 extract was added. Nuclease-free water was added in order to obtain a total volume of 200 μL and the resulting solution was incubated for 2 h at 30° C. 5 μL was used for SDS-page analysis while the remaining 45 μL was used in the catalytic test reaction.

Example 4

In-Vivo Production of UGTSL

[0516] The pET30A+ vector containing the gene corresponding to the enzyme (GI 460409128, Version XP 004249992.1) was introduced in E. coli BL21(DE3) by heat shock. The obtained cells were grown in Petri dishes in the presence of Kanamycin and suitable colonies were selected and allowed to grow in liquid LB medium (Erlenmeyer flasks). Glycerol was added to the suspension as cryoprotector and 400 μL aliquots were stored at −20° C. and at −80° C.

[0517] The storage aliquots of E. coli BL21(DE3) containing the pET30A+_UGT plasmids were thawed and added to 30 mL of LBGKP medium (20 g/L Luria Broth Lennox; 50 mM PIPES buffer pH 7.00; 50 mM Phosphate buffer pH 7.00; 2.5 g/L glucose and 50 mg/L of Kanamycine). This culture was allowed to shake at 135 rpm at 30° C. for 8 hrs.

[0518] The production medium contained 60 g/L of overnight express instant TB medium (Novagen), 10 g/L of glycerol and 50 mg/L of Kanamycine. The preculture was added to 400 mL of this medium and the solution was allowed to stir at 20° C. while taking samples to measure the OD and pH. The cultures gave significant growth and a good OD was obtained. After 40 hrs, the cells were harvested by centrifugation and frozen. The cell wet weights (CWW) was 6.8 g.

[0519] Lysis was performed by addition of Bugbuster Master mix (Novagen) and the lysate was recovered by centrifugation and used fresh.

Example 5

In-Vivo Production of UGTSL2

[0520]

TABLE-US-00007 UGTSL2 (GI_460410132/XP_004250485.1) amino acid sequence: (SEQ ID NO: 9) MATNLRVLMFPWLAYGHISPFLNIAKQLADRGFLIYLCSTRINLESI IKKIPEKYADSIHLIELQLPELPELPPHYHTTNGLPPHLNPTLHKAL KMSKPNFSRILQNLKPDLLIYDVLQPWAEHVANEQNIPAGKLLTSCA AVFSYFFSFRKNPGVEFPFPAIHLPEVEKVKIREILAKEPEEGGRLD EGNKQMMLMCTSRTIEAKYIDYCTELCNWKVVPVGPPFQDLITNDAD NKELIDWLGTKHENSTVFVSFGSEYFLSKEDMEEVAFALELSNVNFI WVARFPKGEERNLEDALPKGFLERIGERGRVLDKFAPQPRILNHPST GGFISHCGWNSAMESIDFGVPIIAMPIHNDQPINAKLMVELGVAVEI VRDDDGKIHRGEIAETLKSVVTGETGEILRAKVREISKNLKSIRDEE MDAVAEELIQLCRNSNKSK.

[0521] The pET30A+ vector containing the UGTSL2 gene was introduced in E. coli B121(DE3) by heat shock. The obtained cells were grown in petri-dishes in the presence of Kanamycin and suitable colonies were selected and allowed to grow in liquid LB medium (erlenmeyer flasks). Glycerol was added to the suspension as cryoprotecteur and 400 μL aliquots were stored at −20° C. and at −80° C.

[0522] The storage aliquots of E. coli BL21(DE3) containing the pET30A+_UGTSL2 plasmids were thawed and added to 30 mL of LBGKP medium (20 g/L Luria Broth Lennox; 50 mM PIPES buffer pH 7.00; 50 mM Phosphate buffer pH 7.00; 2.5 g/L glucose and 50 mg/L of Kanamycin). This culture was allowed to shake at 135 rpm at 30° C. for 8 h.

[0523] The production medium contained 60 g/L of overnight express instant TB medium (Novagen), 10 g/L of glycerol and 50 mg/L of Kanamycin. The preculture was added to 200 mL of this medium and the solution was allowed to stir at 20° C. while taking samples to measure the OD and pH. The culture gave significant growth and a good OD was obtained. After 40 h, the cells were harvested by centrifugation and frozen to obtain 6.22 g of cell wet weight.

[0524] Lysis was performed on 1.4 g of cells by addition of Bugbuster Master mix (Novagen) and the lysate was recovered by centrifugation and used fresh.

Example 6

Catalytic Reaction with In-Vivo Produced UGT76G1

[0525] The total volume of the reaction was 5.0 mL with the following composition: 50 mM sodium phosphate buffer pH 7.2, 3 mM MgCl.sub.2, 2.5 mM UDP-glucose, 0.5 mM Stevioside and 500 μL of UGT76G1 thawed lysate. The reactions were run at 30° C. on an orbitary shaker at 135 rpm. For each sample, 460 μL of the reaction mixture was quenched with 40 μL of 2N H.sub.2SO.sub.4 and 420 μL of methanol/water (6/4). The samples were immediately centrifuged and kept at 10° C. before analysis by HPLC (CAD). HPLC indicated almost complete conversion of stevioside to rebaudioside A (FIG. 4).

Example 7

[0526] Preparation and Activity of UGT76G1 Prepared by pET30a+ Plasmid and BL21 (DE3) Expression Strain

[0527] The pET30a+_UGT76G1 plasmid was transformed into BL21(DE3) expression strain (Lucigen E. Cloni® EXPRESS Electrocompetent Cells). The obtained cells were grown on LB Agar medium in petri-dishes in the presence of Kanamycin. Suitable colonies were selected and allowed to grow in liquid LBGKP medium containing Kanamycin. Glycerol was added and 400 μL aliquots were stored at −20° C. and at −80° C.

[0528] A storage aliquot was thawed and added to 30 mL of LBGKP medium. This culture was allowed to shake at 30° C. for 8 h. and subsequently used to inoculate 400 mL of production medium containing 60 g/L of “Overnight express instant TB medium” (Novagen, reference 71491-5), 10 g/L of glycerol and 50 mg/L of Kanamycin. The medium was allowed to stir at 20° C. while taking samples to measure the OD (600 nm) and pH. After 40 h, the cells were harvested by centrifugation and frozen. The obtained cell wet weight was 10.58 g.

[0529] 3.24 g of obtained pellet was lysed by addition of 8.1 mL of “Bugbuster Master mix” (Novagen, reference 71456) and 3.5 mL of water. The lysate was recovered by centrifugation and kept frozen.

Example 8

[0530] Preparation and Activity of UGT76G1 Prepared by pET30a+ Plasmid and Tuner (DE3) Expression Strain

[0531] The pET30a+_UGT76G1 plasmid was transformed into Tuner (DE3) expression strain (Novagen Tuner™ (DE3) Competent cells) by heat shock treatment. The obtained cells were grown on LB Agar medium in petri-dishes in the presence of Kanamycin. Suitable colonies were selected and allowed to grow in liquid LBGKP medium containing Kanamycin). Glycerol was added and 400 μL aliquots were stored at −20° C. and at −80° C.

[0532] A storage aliquot was thawed and added to 100 mL of LB medium containing 50 mg/L of Kanamycin. This culture allowed to shake at 30° C. for 15 h. 4.4 mL of this culture was used to inoculate 200 mL of production medium containing LB. This medium was allowed to stir at 37° C. until an OD (600 nm) of 0.9 was obtained, after which 400 μL of a 100 mM IPTG solution was added and the medium was allowed to stir at 30° C. for 4 h. The cells were harvested by centrifugation and frozen. The obtained cell wet weight was 1.38 g.

[0533] The obtained pellet was lysed by addition of 4.9 mL of “Bugbuster Master mix” (Novagen, reference 71456) and 2.1 mL of water. The lysate was recovered by centrifugation and kept frozen.

Example 9

[0534] Preparation and Activity of UGT76G1 Prepared by pMAL Plasmid and BL21 Expression Strain

[0535] After subcloning the synthetic UGT76G1 gene into the pMAL plasmid using NdeI and Sal1 cloning sites, the pMAL_UGT76G1 plasmid was transformed into BL21 expression strain (New England Biolabs BL21 Competent E. coli) by heat shock treatment. The obtained cells were grown on LB Agar medium in petri-dishes in the presence of Ampicillin. Suitable colonies were selected and allowed to grow in liquid LBGKP medium containing Ampicillin). Glycerol was added and 400 μL aliquots were stored at −20° C. and at −80° C.

[0536] A storage aliquot was thawed and added to 30 mL of LBGKP medium. This culture was allowed to shake at 30° C. for 8 h. and subsequently used to inoculate 400 mL of production medium containing 60 g/L of “Overnight express instant TB medium” (Novagen, reference 71491-5), 10 g/L of glycerol and 50 mg/L of Ampicillin. The medium was allowed to stir at 20° C. while taking samples to measure the OD and pH. After 40 h, the cells were harvested by centrifugation and frozen. The obtained cell wet weight was 5.86 g.

[0537] 2.74 g of obtained pellet was lysed by addition of 9.6 mL of “Bugbuster Master Mix” (Novagen, reference 71456) and 4.1 mL of water. The lysate was recovered by centrifugation and kept frozen.

Example 10

[0538] Preparation and Activity of UGT76G1 Prepared by pMAL Plasmid and ArcticExpress Expression Strain

[0539] The pMAL_UGT76G1 plasmid was transformed into ArticExpress expression strain (Agilent ArcticExpress competent cells) by heat shock treatment. The obtained cells were grown on LB Agar medium in petri-dishes in the presence of Ampicillin and Geneticin. Suitable colonies were selected and allowed to grow in liquid LBGKP medium containing of Ampicillin and Geneticin. Glycerol was added and 400 μL aliquots were stored at −20° C. and at −80° C.

[0540] A storage aliquot was thawed and added to 30 mL of LBGKP medium (containing Ampicillin and Geneticin). This culture was allowed to shake at 30° C. for 8 h. and subsequently used to inoculate 400 mL of production medium containing 60 g/L of “Overnight express instant TB medium” (Novagen, reference 71491-5), 10 g/L of glycerol and 50 mg/L of Ampicillin. The medium was allowed to stir at 12° C. while taking samples to measure the OD (600 nm) and pH. After 68 h, the cells were harvested by centrifugation and frozen. The obtained cell wet weight was 8.96 g.

[0541] 2.47 g of the obtained pellet was lysed by addition of 8.73 mL of “Bugbuster Master Mix” (Novagen, reference 71456) and 3.79 mL of water. The lysate was recovered by centrifugation and kept frozen.

Example 11

[0542] Preparation and Activity of UGT76G1 Prepared by pCOLDIII Plasmid and ArcticExpress Expression Strain

[0543] After subcloning the synthetic UGT76G1 gene into the pCOLDIII plasmid using NdeI and Xho1 cloning sites, the pCOLDIII_UGT76G1 plasmid was transformed into ArcticExpress expression strain (Agilent ArcticExpress competent cells) by heat shock treatment. The obtained cells were grown on LB Agar medium in petri-dishes in the presence of Ampicillin and Geneticin. Suitable colonies were selected and allowed to grow in liquid LBGKP medium containing Ampicillin and Geneticin. Glycerol was added and 400 μL aliquots were stored at −20° C. and at −80° C.

[0544] A storage aliquot was thawed and added to 30 mL of LBGKP medium (containing Ampicillin and Geneticin). This culture was allowed to shake at 30° C. for 8 h. and subsequently used to inoculate 400 mL of production medium containing 60 g/L of “Overnight express instant TB medium” (Novagen, reference 71491-5), 10 g/L of glycerol and 50 mg/L of Kanamycin. The medium was allowed to stir at 12° C. while taking samples to measure the OD (600 nm) and pH. After 63 h, the cells were harvested by centrifugation and frozen. The obtained cell wet weight was 6.54 g.

[0545] 2.81 g of the obtained pellet was lysed by addition of 9.8 mL of “Bugbuster Master Mix” (Novagen, reference 71456) and 4.2 mL of water. The lysate was recovered by centrifugation and kept frozen.

Example 12

Preparation and Activity of UGT76G1 Prepared by pCOLDIII Plasmid and Origami2 (DE3) Expression Strain

[0546] The pCOLDIII_UGT76G1 plasmid was transformed into Origami2 (DE3) expression strain (Novagen Origami™2 (DE3) Competent Cells) by heat shock treatment. The obtained cells were grown on LB Agar medium in petri-dishes in the presence of Ampicillin. Suitable colonies were selected and allowed to grow in liquid LBGKP medium containing Ampicillin. Glycerol was added and 400 μL aliquots were stored at −20° C. and at −80° C.

[0547] A storage aliquot was thawed and added to 30 mL of LBGKP medium (containing Ampicillin). This culture was allowed to shake at 30° C. for 8 h. and subsequently used to inoculate 400 mL of production medium containing 60 g/L of “Overnight express instant TB medium” (Novagen, reference 71491-5), 10 g/L of glycerol and 50 mg/L of Kanamycin. The medium was allowed to stir at 12° C. while taking samples to measure the OD (600 nm) and pH. After 68 h, the cells were harvested by centrifugation and frozen. The obtained cell wet weight was 2.53 g.

[0548] 1.71 g of the obtained pellet was lysed by addition of 6.0 mL of “Bugbuster Master mix” (Novagen, reference 71456) and 1.9 mL of water. The lysate was recovered by centrifugation and kept frozen.

Example 13

[0549] Preparation of UGT91D2 Using pMAL Plasmid and BL21 Expression Strain

[0550] After subcloning the synthetic UGT91D2 gene into the pMAL plasmid using NdeI and Sal1 cloning sites, the pMAL_UGT91D2 plasmid was transformed into BL21 expression strain (New England Biolabs BL21 Competent E. coli) by heat shock treatment. The obtained cells were grown on LB Agar medium in petri-dishes in the presence of Ampicillin. Suitable colonies were selected and allowed to grow in liquid LBGKP medium containing Ampicillin). Glycerol was added and 400 μL aliquots were stored at −20° C. and at −80° C.

[0551] A storage aliquot was thawed and added to 30 mL of LBGKP medium. This culture was allowed to shake at 30° C. for 8 h. and subsequently used to inoculate 400 mL of production medium containing 60 g/L of “Overnight express instant TB medium” (Novagen, reference 71491-5), 10 g/L of glycerol and 50 mg/L of Ampicillin. The medium was allowed to stir at 20° C. while taking samples to measure the OD and pH. After 40 h, the cells were harvested by centrifugation and frozen. The obtained cell wet weight is 12.32 g.

[0552] 2.18 g of obtained pellet was lysed by addition of 7.7 mL of “Bugbuster Master Mix” (Novagen, reference 71456) and 3.2 mL of water. The lysate was recovered by centrifugation and used directly for activity testing.

Example 14

[0553] Preparation of UGT91D2 Using pMAL Plasmid and ArcticExpress Expression Strain

[0554] The pMAL_UGT91D2 plasmid was transformed into ArcticExpress expression strain (Agilent ArcticExpress competent cells) by heat shock treatment. The obtained cells were grown on LB Agar medium in petri-dishes in the presence of Ampicillin and Geneticin. Suitable colonies were selected and allowed to grow in liquid LBGKP medium containing Ampicillin and Geneticin. Glycerol was added and 400 μL aliquots were stored at −20° C. and at −80° C.

[0555] A storage aliquot was thawed and added to 30 mL of LBGKP medium (containing Ampicillin and Geneticin). This culture was allowed to shake at 30° C. for 8 h. and subsequently used to inoculate 400 mL of production medium containing 60 g/L of “Overnight express instant TB medium” (Novagen, reference 71491-5), 10 g/L of glycerol and 50 mg/L of Ampicillin. The medium was allowed to stir at 20° C. for 16 h. followed by another 50 h. at 12° C. while taking samples to measure the OD (600 nm) and pH. The cells were harvested by centrifugation and frozen. The obtained cell wet weight is 15.77 g.

[0556] 2.57 g of the obtained pellet was lysed by addition of 9.0 mL of “Bugbuster Master Mix” (Novagen, reference 71456) and 3.8 mL of water. The lysate was recovered by centrifugation and used directly for activity testing.

Example 15

[0557] Preparation of UGT91D2 Using pET30a+ Plasmid and Tuner (DE3) Expression Strain

[0558] The pET30a+_UGT91D2 plasmid was transformed into Tuner (DE3) expression strain (Novagen Tuner™ (DE3) Competent cells) by heat shock treatment. The obtained cells were grown on LB Agar medium in petri-dishes in the presence of Kanamycin. Suitable colonies were selected and allowed to grow in liquid LBGKP medium (containing Kanamycin). Glycerol was added and 400 μL aliquots were stored at −20° C. and at −80° C.

[0559] A storage aliquot was thawed and added to 100 mL of LB medium containing 50 mg/L of Kanamycin. This culture allowed to shake at 30° C. for 15 h. 6.2 mL of this culture was used to inoculate 500 mL of production medium containing LB. This medium was allowed to stir at 37° C. until an OD (600 nm) of 0.9 was obtained after which 500 μL of a 100 mM IPTG solution was added (IPTG concentration in medium is 100 μM) and the medium was allowed to stir at 30° C. for 4 h, the cells were harvested by centrifugation and frozen. The obtained cell wet weight is 4.02 g.

[0560] 1.92 g of the obtained pellet was lysed by addition of 6.8 mL of “Bugbuster Master mix” (Novagen, reference 71456) and 2.8 mL of water. The lysate was recovered by centrifugation and tested directly for activity.

Example 16

[0561] Preparation of UGT91D2 Using pET30a+ Plasmid and ArcticExpress Expression Strain

[0562] The pET30a+_UGT91D2 plasmid was transformed into ArcticExpress (DE3) expression strain (Agilent ArcticExpress competent cells) by heat shock treatment. The obtained cells were grown on LB Agar medium in petri-dishes in the presence of Kanamycin and Geneticin. Suitable colonies were selected and allowed to grow in liquid LBGKP medium containing of Kanamycin and Geneticin. Glycerol was added and 400 μL aliquots were stored at −20° C. and at −80° C.

[0563] A storage aliquot was thawed and added to 30 mL of LBGKP medium (containing Kanamycin and Geneticin). This culture was allowed to shake at 30° C. for 8 h. and subsequently used to inoculate 400 mL of production medium containing 60 g/L of “Overnight express instant TB medium” (Novagen, reference 71491-5), 10 g/L of glycerol and 50 mg/L of Ampicillin. The medium was allowed to stir at 20° C. for 16 h. followed by another 50 h. at 12° C. while taking samples to measure the OD (600 nm) and pH. After 60 h, the cells were harvested by centrifugation and frozen. The obtained cell wet weight is 16.07 g.

[0564] 3.24 g of the obtained pellet was lysed by addition of 11.4 mL of “Bugbuster Master Mix” (Novagen, reference 71456) and 4.8 mL of water. The lysate was recovered by centrifugation and used directly for activity testing.

Example 17

Determination of Activity of In-Vivo Preparations of UGT91D2

[0565] Activity tests were performed at 5 mL scale with 1000 μL of lysate for the transformation of Rubusoside to Stevioside using 0.5 mM of substrate, 2.5 mM of UDP-Glucose and 3 mM MgCl.sub.2 in 50 mM Sodium Phosphate buffer at pH 7.2. Samples were taken and analyzed by HPLC. The results for the different preparations of UGT91D2 are summarized in the following table.

TABLE-US-00008 Transformation activity* Plasmid Expression strain Rubusoside to Stevioside pMAL BL21  9 mU mL.sup.−1 pMAL ArcticExpress 60 mU mL.sup.−1 pET30a+ Tuner (DE3) 28 mU mL.sup.−1 pET30a+ ArcticExpress (DE3) 21 mU mL.sup.−1 *Note: The activities are mentioned per mL of lysate. 1 U will transform 1 μmol of substrate in 1 hour at 30° C. and pH 7.2

Example 18

Directed Evolution of UGT76G1 for the Conversion of Rebaudioside D to Rebaudioside M

[0566] Starting from the amino acid sequence of UGT76G1, as is described in Genbank (AAR06912.1), different mutations at various amino acid positions were identified that could alter the activity of the enzyme for the transformation of Rebaudioside D (Reb D) to Rebaudioside M (Reb M). This list of mutations, designed by DNA2.0 ProteinGPS™ strategy, was subsequently used to synthesize 96 variant genes that contained 3, 4 or 5 of these mutations that were codon-optimized for expression in E. coli. The genes were subcloned in the pET30a+ plasmid and used for transformation of E. coli BL21 (DE3) chemically competent cells. The obtained cells were grown in Petri-dishes on solid LB medium in the presence of Kanamycin. Suitable colonies were selected and allowed to grow in liquid LB medium in tubes. Glycerol was added to the suspension as cryoprotectant and 400 μL aliquots were stored at −20° C. and at −80° C.

[0567] These storage aliquots of E. coli BL21(DE3) containing the pET30a+_UGT76G1var plasmids were thawed and added to LBGKP medium (20 g/L Luria Broth Lennox; 50 mM PIPES buffer pH 7.00; 50 mM Phosphate buffer pH 7.00; 2.5 g/L glucose and 50 mg/L of Kanamycine). This culture was allowed to shake in a 96 microtiter plate at 135 rpm at 30° C. for 8 h.

[0568] 3.95 mL of production medium containing 60 g/L of Overnight Express™ Instant TB medium (Novagen®), 10 g/L of glycerol and 50 mg/L of Kanamycin was inoculated with 50 μL of above described culture. In a 48 deepwell plate the resulting culture was allowed to stir at 20° C. The cultures gave significant growth and a good OD (600 nm; 1 cm) was obtained. After 44 h, the cells were harvested by centrifugation and frozen.

[0569] Lysis was performed by addition of Bugbuster® Master mix (Novagen®) to the thawed cells and the lysate was recovered by centrifugation. Activity tests were performed with 100 μL of fresh lysate that was added to a solution of Rebaudioside D (final concentration 0.5 mM), MgCl.sub.2 (final concentration 3 mM) and UDP-Glucose (final concentration 2.5 mM) in 50 mM phosphate buffer pH 7.2.

[0570] The reaction was allowed to run at 30° C. and samples were taken after 2, 4, 7 and 24 h. to determine conversion and initial rate by HPLC (CAD detection) using the analytical method that was described above for the transformation of Rebaudioside D to Rebaudioside M. The results are depicted in the following table.

TABLE-US-00009 Conversion Reb D initial rate Clone Mutations* to Reb M after 24 h (%) (Reb M area/min) UGT76G1var1 E224A_F314S_R334K 51.8 5.5E+07 UGT76G1var2 S274G_T284I_L379G 49.3 4.7E+07 UGT76G1var3 I295T_S357C_V366I 9.6 1.6E+06 UGT76G1var4 E224D_E231A_F265I 14.7 8.6E+06 UGT76G1var5 F22Y_I373L_P382M 3.5 2.3E+06 UGT76G1var6 Q266S_S357N_I373L 0.5 1.8E+06 UGT76G1var7 F22L_I43V_A239V 0.2 −6.0E+04  UGT76G1var8 E224A_Q266S_Q342E 0.5 2.3E+04 UGT76G1var9 E231A_D301N_G348P 52.0 4.9E+07 UGT76G1var10 A33G_L246F_Q342E 0.3 −7.7E+02  UGT76G1var11 F22L_A33G_V310I 0.4 3.8E+04 UGT76G1var12 L243P_K303G_A352G 0.5 8.7E+04 UGT76G1var13 L243A_S357C_A385T 0.2 −3.3E+04  UGT76G1var14 A239I_F265I_V396F 5.3 1.5E+06 UGT76G1var15 F41L_L246F_Q425E 5.6 1.5E+06 UGT76G1var16 F265I_P272A_I335V 18.6 5.8E+06 UGT76G1var17 F265L_Q266E_Q342K 0.7 7.2E+05 UGT76G1var18 L243P_S274G_N409R 1.9 5.0E+05 UGT76G1var19 E224D_E229A_Q432E 10.5 5.5E+06 UGT76G1var20 S375M_K393G_Y397E 1.8 1.9E+06 UGT76G1var21 A239V_V300A_K303G 41.9 3.3E+07 UGT76G1var22 E231A_V310I_R334K 34.4 2.4E+07 UGT76G1var23 T263S_G348P_A352G 47.8 4.1E+07 UGT76G1var24 A239I_P272A_Q425E 31.0 2.1E+07 UGT76G1var25 T284L_Q342K_Y397Q 0.9 6.3E+04 UGT76G1var26 S241I_F265L_F377C 1.8 7.5E+05 UGT76G1var27 A239I_L379A_V394I 29.0 1.5E+07 UGT76G1var28 L243A_S274G_P382M 6.1 2.4E+06 UGT76G1var29 F22Y_V279I_N409R 41.0 2.9E+07 UGT76G1var30 I43V_E224A_S241I 13.6 5.6E+06 UGT76G1var31 E224D_L243P_V300A 0.4 2.4E+05 UGT76G1var32 A239V_L243A_S375M 0.0 −4.4E+04  UGT76G1var33 A33G_R334H_Y397Q 1.0 7.5E+06 UGT76G1var34 I43V_T284I_I295T 3.4 1.5E+06 UGT76G1var35 T284L_F314S_S357N 0.5 1.8E+05 UGT76G1var36 F265L_L379A_V396F 20.0 8.8E+06 UGT76G1var37 E229A_L379G_I407V 39.1 2.8E+07 UGT76G1var38 F41L_I295M_F377C 8.2 3.7E+06 UGT76G1var39 F22Y_F41L_V366I 7.2 3.3E+06 UGT76G1var40 T263S_Q266E_S375R 47.6 3.3E+07 UGT76G1var41 L246F_A385T_K393G 0.8 1.4E+06 UGT76G1var42 T263S_Q266S_R334H 34.6 2.2E+07 UGT76G1var43 S241I_P272A_V279I 19.9 9.4E+06 UGT76G1var44 I335V_S375R_I407V 35.3 2.3E+07 UGT76G1var45 V279I_D301N_S389E 38.6 2.3E+07 UGT76G1var46 F22L_Q266E_I295M 0.6 9.8E+05 UGT76G1var47 E229A_T284I_S389E 4.8 2.7E+06 UGT76G1var48 V394I_Y397E_Q432E 47.6 3.8E+07 UGT76G1var49 F41L_Q266E_T284I_Y397Q 2.6 1.1E+06 UGT76G1var50 F22Y_V310I_S375M_F377C 1.9 7.9E+05 UGT76G1var51 K303G_S357C_S389E_V396F 18.7 9.5E+06 UGT76G1var52 D301N_I373L_F377C_I407V 12.9 4.6E+06 UGT76G1var53 R334K_A352G_P382M_S389E 9.3 4.1E+06 UGT76G1var54 E229A_T284L_R334K_Q342E 0.7 4.3E+05 UGT76G1var55 I295M_Q342E_V366I_N409R 1.0 2.2E+05 UGT76G1var56 L246F_A352G_S357N_Q432E 0.4 4.1E+04 UGT76G1var57 S241I_T263S_L379G_A385T 0.8 1.5E+05 UGT76G1var58 S357C_S375M_N409R_Q425E 7.5 2.2E+06 UGT76G1var59 I335V_K393G_V394I_Y397Q 33.0 2.7E+07 UGT76G1var60 E231A_L243A_V279I_S357N 0.5 9.5E+04 UGT76G1var61 I43V_F265I_Q266S_L379A 6.4 2.0E+06 UGT76G1var62 L243P_P272A_V394I_V396F 0.1 3.4E+04 UGT76G1var63 F314S_R334H_Q342K_L379G 3.4 1.2E+06 UGT76G1var64 F22L_A239I_R334H_I407V 0.3 3.1E+04 UGT76G1var65 A33G_A239V_P382M_Q425E 1.2 3.3E+05 UGT76G1var66 F265L_V310I_V366I_A385T 0.8 3.7E+05 UGT76G1var67 E224D_F314S_S375R_Y397E −2.1 −5.6E+05  UGT76G1var68 Q342K_G348P_I373L_Y397E −1.4 −1.1E+05  UGT76G1var69 S274G_I295T_I335V_L379A 24.7 8.3E+06 UGT76G1var70 E224A_I295T_V300A_G348P 24.0 8.4E+06 UGT76G1var71 I295M_V300A_K393G_Q432E 42.9 2.1E+07 UGT76G1var72 T284L_D301N_K303G_S375R 19.2 9.1E+06 UGT76G1var73 F22Y_D301N_R334H_Q342E_V396F 0.8 8.7E+05 UGT76G1var74 I295T_I373L_S375R_Y397Q_Q432E 0.6 9.6E+04 UGT76G1var75 F41L_A239I_Q266S_S375M_P382M 0.8 −1.3E+05  UGT76G1var76 F22Y_A239I_L246F_I295M_R334K 2.6 7.2E+05 UGT76G1var77 A239V_F265I_I295T_D301N_K393G 1.9 4.4E+05 UGT76G1var78 V279I_V300A_V310I_I335V_S357C 3.2 8.2E+05 UGT76G1var79 E224D_T284I_V366I_I373L_K393G 8.5 3.8E+06 UGT76G1var80 L243P_L379A_S389E_Q425E_Q432E 1.0 2.1E+05 UGT76G1var81 A33G_T263S_S274G_V279I_Y397E 15.0 6.5E+06 UGT76G1var82 E224D_L243A_F265L_R334H_A352G 1.1 2.5E+05 UGT76G1var83 I43V_Q342E_S357N_S375R_L379G 0.5 4.3E+04 UGT76G1var84 F22L_Q266S_F314S_A352G_S357C 1.2 2.3E+05 UGT76G1var85 T284L_G348P_F377C_P382M_N409R 1.8 4.0E+05 UGT76G1var86 E224A_T284L_V396F_Y397E_I407V 1.6 3.8E+05 UGT76G1var87 S241I_L243A_V300A_F314S_N409R 35.7 2.1E+07 UGT76G1var88 A239V_T284I_V310I_Q342K_L379A 1.6 3.8E+05 UGT76G1var89 F41L_E229A_E231A_F265L_P272A 1.2 2.1E+05 UGT76G1var90 E231A_S241I_S274G_Y397Q_Q425E 34.5 1.9E+07 UGT76G1var91 E224A_L246F_T263S_F265I_Q342K 1.2 2.3E+05 UGT76G1var92 K303G_S357N_V366I_V394I_I407V 1.6 3.6E+05 UGT76G1var93 I43V_Q266E_S375M_S389E_V394I 1.8 4.5E+05 UGT76G1var94 Q266E_P272A_R334K_G348P_L379G 72.0 7.9E+07 UGT76G1var95 A33G_I295M_K303G_I335V_A385T −1.3 −1.7E+05  UGT76G1var96 F22L_E229A_L243P_F377C_A385T 1.2 2.7E+05 *Mutations are noted as follows: original amino acid-position-new amino acid: For example the mutation of an alanine at position 33 to a glycine is noted as A33G.

Example 19

[0571] In Vivo Production of UGT76G1 in S. cerevisiae

TABLE-US-00010 UGT76G1 [Stevia rebaudiana](gi_37993653/ gb_AAR06912.1) MENKTETTVRRRRRIILFPVPFQGHINPILQLANVLYSKGFSITIFH TNFNKPKTSNYPHFTFRFILDNDPQDERISNLPTHGPLAGMRIPIIN EHGADELRRELELLMLASEEDEEVSCLITDALWYFAQSVADSLNLRR LVLMTSSLFNFHAHVSLPQFDELGYLDPDDKTRLEEQASGFPMLKVK DIKSAYSNWQILKEILGKMIKQTKASSGVIWNSFKELEESELETVIR EIPAPSFLIPLPKHLTASSSSLLDHDRTVFQWLDQQPPSSVLYVSFG STSEVDEKDFLEIARGLVDSKQSFLWVVRPGFVKGSTWVEPLPDGFL GERGRIVKWVPQQEVLAHGAIGAFWTHSGWNSTLESVCEGVPMIFSD FGLDQPLNARYMSDVLKVGVYLENGWERGEIANAIRRVMVDEEGEYI RQNARVLKQKADVSLMKGGSSYESLESLVSYISSL.

[0572] The above mentioned amino acid sequence was codon optimized for expression in S. cerevisiae. Furthermore the yeast consensus sequence AACACA was added before the ATG start codon. The synthetic gene was subcloned in the pYES2 vector using Hind III and Xba I restriction sites. The pYES2_UGT76G1_Sc vector was used to transform chemically competent S. cerevisiae INVSc1 cells (Invitrogen).

[0573] The cells were grown on a solid synthetic minimal medium containing 2% glucose lacking Uracil and a single colony was picked and allowed to grow in liquid synthetic minimal medium lacking Uracil (SC-U containing 2% glucose). After centrifugation, the cells were suspended with SC-U (containing 2% glucose) and 60% glycerol/water. Aliquots were stored at −80° C. and one aliquot was used to start a culture in SC-U (containing 2% glucose) for 43 h at 30° C. Part of this culture was centrifuged and suspended in induction medium (SC-U containing 2% galactose) for 19 h 30 at 30° C.

[0574] Cells were obtained by centrifugation and lysis with five volumes of CelLytic™ Y Cell Lysis Reagent (Sigma). The lysates were used directly for activity testing (UGT76G1_Sc).

Example 20

Directed Evolution of UGT76G1 for the Conversion of Rebaudioside D to Rebaudioside M (Round 2)

[0575] The most active clone from the first round of directed evolution of UGT76G1 (see EXAMPLE 18 UGT76G1var94 containing mutations: Q266E_P272A_R334K_G348P_L379G) was chosen as baseline clone for round 2. A list of 53 mutations was established containing different identified positive mutations from the first round and new mutations obtained by DNA2.0 ProteinGPS™ strategy. This list of mutations was subsequently used to design 92 variant genes that contained each 3 different mutations. After codon-optimized for expression in E. coli the genes were synthesized, subcloned in the pET30a+ plasmid and used for transformation of E. coli BL21 (DE3) chemically competent cells. The obtained cells were grown in Petri-dishes on solid LB medium in the presence of Kanamycin. Suitable colonies were selected and allowed to grow in liquid LB medium in tubes. Glycerol was added to the suspension as cryoprotectant and 400 μL aliquots were stored at −20° C. and at −80° C.

[0576] These storage aliquots of E. coli BL21(DE3) containing the pET30a+_UGT76G1var plasmids were thawed and added to LBGKP medium (20 g/L Luria Broth Lennox; 50 mM PIPES buffer pH 7.00; 50 mM Phosphate buffer pH 7.00; 2.5 g/L glucose and 50 mg/L of Kanamycine). This culture was allowed to shake in a 96 microtiter plate at 30° C. for 8 h.

[0577] 3.95 mL of production medium containing 60 g/L of Overnight Express™ Instant TB medium (Novagen®), 10 g/L of glycerol and 50 mg/L of Kanamycin was inoculated with 50 μL of above described culture. In a 48 deepwell plate the resulting culture was allowed to stir at 20° C. The cultures gave significant growth and a good OD (600 nm) was obtained. After 44 h, the cells were harvested by centrifugation and frozen.

[0578] Lysis was performed by addition of Bugbuster® Master mix (Novagen®) to the thawed cells and the lysate was recovered by centrifugation. Activity tests were performed with 100 μL of fresh lysate that was added to a solution of Rebaudioside D (final concentration 0.5 mM), MgCl.sub.2 (final concentration 3 mM) and UDP-Glucose (final concentration 2.5 mM) in 50 mM phosphate buffer pH 7.2.

[0579] The reaction was allowed to run at 30° C. and samples were taken after 2, 4, 7 and 24 h. to determine conversion and initial rate by HPLC (CAD detection) using the analytical method that was described above for the transformation of Rebaudioside D to Rebaudioside M. In parallel the experiments were performed with baseline clone, Round1-Var94. The conversion after 22 h. and initial rate for this baseline clone was defined as 100% and the normalized conversions and initial rates for the round 2 clones are depicted in the following table:

TABLE-US-00011 Normalized conversion Normalized initial Clone Mutations* Reb D to Reb M after 22 h. rate (0-4 h) Round1-Var94 UGT76G1 100%  100%  (Q266E_P272A_R334K_G348P_L379G) baseline clone Round2-Var1 Round1-Var94 (A213N_P348G_I411V) 70% 86% Round2-Var2 Round1-Var94 (K303G_I423M_Q425E) 120%  134%  Round2-Var3 Round1-Var94 (V20L_N138K_S147G) 14% 15% Round2-Var4 Round1-Var94 (I16V_V133A_L299I) 37% 43% Round2-Var5 Round1-Var94 (S241V_S274G_Q432E) 75% 72% Round2-Var6 Round1-Var94 (I16V_L139V_I218V) 62% 68% Round2-Var7 Round1-Var94 (K334R_N409K_Q432E) 104%  92% Round2-Var8 Round1-Var94 (I15L_R141T_I407V) 17% 26% Round2-Var9 Round1-Var94 (R141T_K303G_G379L) 31% 42% Round2-Var10 Round1-Var94 (I190L_K303G_P348G) 131%  149%  Round2-Var11 Round1-Var94 (E266Q_F314S_N409R) 106%  132%  Round2-Var12 Round1-Var94 (V133A_I295V_K303G) 43% 49% Round2-Var13 Round1-Var94 (I16V_S241V_N409R) 80% 79% Round2-Var14 Round1-Var94 (A239V_K334R_G379L) 58% 55% Round2-Var15 Round1-Var94 (I190L_K393R_V396L) 118%  126%  Round2-Var16 Round1-Var94 (L101F_I295M_K393R) 84% 89% Round2-Var17 Round1-Var94 (A239V_E266Q_Q425E) 96% 101%  Round2-Var18 Round1-Var94 (V20L_I190L_I423M) 98% 98% Round2-Var19 Round1-Var94 (V20L_G379L_S456L) 84% 81% Round2-Var20 Round1-Var94 (K334R_P348G_N409R) 73% 73% Round2-Var21 Round1-Var94 (E231A_S241V_E449D) 53% 50% Round2-Var22 Round1-Var94 (K188R_L299I_V394I) 56% 59% Round2-Var23 Round1-Var94 (E231A_S274G_V394I) 110%  124%  Round2-Var24 Round1-Var94 (S42A_I295V_Q432E) 71% 78% Round2-Var25 Round1-Var94 (A213N_A272P_K334R) 95% 80% Round2-Var26 Round1-Var94 (L158Y_S274K_N409K) 80% 50% Round2-Var27 Round1-Var94 (K188R_I295M_Q425E) 132%  116%  Round2-Var28 Round1-Var94 (I15L_I295M_V394I) 53% 36% Round2-Var29 Round1-Var94 (V133A_A239V_V394I) 47% 30% Round2-Var30 Round1-Var94 (L158Y_F314S_K316R) 107%  72% Round2-Var31 Round1-Var94 (L158Y_A239V_A272P) 54% 30% Round2-Var32 Round1-Var94 (F46I_D301N_V396L) 109%  101%  Round2-Var33 Round1-Var94 (L101F_I218V_Q432E) 78% 54% Round2-Var34 Round1-Var94 (I16V_F46I_I295M) 110%  95% Round2-Var35 Round1-Var94 (A213N_E266S_I407V) 98% 79% Round2-Var36 Round1-Var94 (A239V_S274K_I295M) 102%  89% Round2-Var37 Round1-Var94 (A239V_F314S_S450K) 105%  99% Round2-Var38 Round1-Var94 (L139V_K188R_D301N) 66% 51% Round2-Var39 Round1-Var94 (I45V_I218V_S274K) 87% 58% Round2-Var40 Round1-Var94 (S241V_K303G_V394I) 78% 57% Round2-Var41 Round1-Var94 (R141T_S274G_K334R) 41% 28% Round2-Var42 Round1-Var94 (V217L_S274G_L299I) 47% 34% Round2-Var43 Round1-Var94 (S274G_D301N_P348G) 98% 91% Round2-Var44 Round1-Var94 (E231A_N409R_S450K) 87% 65% Round2-Var45 Round1-Var94 (R64H_E231A_K316R) 88% 64% Round2-Var46 Round1-Var94 (V394I_N409K_I411V) 110%  100%  Round2-Var47 Round1-Var94 (I45V_I295M_K303G) 113%  88% Round2-Var48 Round1-Var94 (L101F_V396L_L398V) 46% 43% Round2-Var49 Round1-Var94 (N27S_L101F_S447A) 54% 37% Round2-Var50 Round1-Var94 (S274G_F314S_L398V) 129%  156%  Round2-Var51 Round1-Var94 (E266Q_L299I_K393R) 70% 51% Round2-Var52 Round1-Var94 (V217L_E266S_V394I) 62% 48% Round2-Var53 Round1-Var94 (N138K_A272P_N409R) 118%  102%  Round2-Var54 Round1-Var94 (E266S_F314S_Q432E) 124%  146%  Round2-Var55 Round1-Var94 (D301N_G379L_L398V) 56% 45% Round2-Var56 Round1-Var94 (F46I_E266S_K334R) 123%  142%  Round2-Var57 Round1-Var94 (A272P_V394I_Q432E) 133%  142%  Round2-Var58 Round1-Var94 (V394I_I407V_S456L) 118%  114%  Round2-Var59 Round1-Var94 (I218V_E266Q_I423M) 106%  98% Round2-Var60 Round1-Var94 (A272P_G379L_I407V) 80% 63% Round2-Var61 Round1-Var94 (E231A_K303G_S456L) 113%  110%  Round2-Var62 Round1-Var94 (I190L_E266Q_I407V) 150%  167%  Round2-Var63 Round1-Var94 (N27S_L139V_I295V) 43% 25% Round2-Var64 Round1-Var94 (V217L_I423M_S447A) 67% 51% Round2-Var65 Round1-Var94 (L158Y_E266S_E449D) 68% 43% Round2-Var66 Round1-Var94 (S42A_F46I_I407V) 160%  203%  Round2-Var67 Round1-Var94 (N138K_E231A_D301N) 118%  93% Round2-Var68 Round1-Var94 (K188R_G379L_N409R) 52% 35% Round2-Var69 Round1-Var94 (I15L_E231A_V396L) 38% 22% Round2-Var70 Round1-Var94 (E231A_Q425E_Q432E) 115%  119%  Round2-Var71 Round1-Var94 (D301N_K316R_Q425E) 126%  121%  Round2-Var72 Round1-Var94 (L139V_I295M_F314S) 76% 91% Round2-Var73 Round1-Var94 (S147G_E266S_D301N) 30% 18% Round2-Var74 Round1-Var94 (R64H_S147G_S447A) 23% 12% Round2-Var75 Round1-Var94 (S42A_K303G_L398V) 95% 110%  Round2-Var76 Round1-Var94 (I45V_D301N_E449D) 62% 60% Round2-Var77 Round1-Var94 (V133A_E266S_I411V) 37% 28% Round2-Var78 Round1-Var94 (I45V_N409R_Q425E) 63% 59% Round2-Var79 Round1-Var94 (R141T_A272P_F314S) 23% 10% Round2-Var80 Round1-Var94 (E266S_S274G_N409R) 81% 91% Round2-Var81 Round1-Var94 (N409K_Q425E_S450K) 81% 84% Round2-Var82 Round1-Var94 (N27S_R64H_K393R) 47% 37% Round2-Var83 Round1-Var94 (S42A_A213N_V217L) 62% 46% Round2-Var84 Round1-Var94 (N27S_S274K_I407V) 49% 44% Round2-Var85 Round1-Var94 (I411V_Q425E_S456L) 75% 81% Round2-Var86 Round1-Var94 (A239V_K316R_E449D) 83% 72% Round2-Var87 Round1-Var94 (S147G_A239V_P348G) 18%  7% Round2-Var88 Round1-Var94 (V20L_S274G_S450K) 71% 68% Round2-Var89 Round1-Var94 (F314S_V394I_S447A) 88% 123%  Round2-Var90 Round1-Var94 (R64H_E266Q_I295M) 45% 47% Round2-Var91 Round1-Var94 (N138K_I295V_I407V) 50% 51% Round2-Var92 Round1-Var94 (I15L_P348G_Q432E) 18% 13% *Mutations are noted as follows: reference gene-original amino acid-position-new amino acid: For example the mutation of an alanine at position 33 to a glycine for variant 94 from the first round of directed evolution of UGT76G1 is noted as Round1-Var94 (A33G)

[0580] Modeling of these results allowed to obtain a ranking of the effect of each mutation. The following mutations were determined as being beneficial for activity: S42A, F46I, I190L, S274G, I295M, K303G, F314S, K316R, K393R, V394I, I407V, N409K, N409R, Q425E, Q432E, S447A, S456L.

Example 21

Directed Evolution of UGT76G1 for the Conversion of Rebaudioside D to Rebaudioside X (Round 3)

[0581] The most active clone from the second round of directed evolution of UGT76G1 (see EXAMPLE 20 round2_UGT76G1var66 containing mutations: S42A_F46I_I407V) was chosen as baseline clone for a third round of directed evolution. A list of 56 mutations was established containing different identified positive mutations from the second round and 30 new mutations obtained by DNA2.0 ProteinGPS™ strategy. This list of mutations was subsequently used to design 92 variant genes that contained each 3 or 4 different mutations. After codon-optimized for expression in E. coli the genes were synthesized, subcloned in the pET30a+ plasmid and used for transformation of E. coli BL21 (DE3) chemically competent cells. The obtained cells were grown in Petri-dishes on solid LB medium in the presence of Kanamycin. Suitable colonies were selected and allowed to grow in liquid LB medium in tubes. Glycerol was added to the suspension as cryoprotectant and 400 μL aliquots were stored at −20° C. and at −80° C.

[0582] These storage aliquots of E. coli BL21(DE3) containing the pET30a+_UGT76G1var plasmids were thawed and added to LBGKP medium (20 g/L Luria Broth Lennox; 50 mM PIPES buffer pH 7.00; 50 mM Phosphate buffer pH 7.00; 2.5 g/L glucose and 50 mg/L of Kanamycine). This culture was allowed to shake in a 96 microtiter plate at 30° C. for 8 h.

[0583] 3.95 mL of production medium containing 60 g/L of Overnight Express™ Instant TB medium (Novagen®), 10 g/L of glycerol and 50 mg/L of Kanamycin was inoculated with 50 μL of above described culture. In a 48 deepwell plate the resulting culture was allowed to stir at 20° C. The cultures gave significant growth and a good OD (600 nm) was obtained. After 44 h, the cells were harvested by centrifugation and frozen.

[0584] Lysis was performed by addition of Bugbuster® Master mix (Novagen®) to the thawed cells and the lysate was recovered by centrifugation. Activity tests were performed with 100 μL of fresh lysate that was added to a solution of Rebaudioside D (final concentration 0.5 mM), MgCl.sub.2 (final concentration 3 mM) and UDP-Glucose (final concentration 2.5 mM) in 50 mM phosphate buffer pH 7.2.

[0585] The reaction was allowed to run at 30° C. and samples were taken after 1, 2, 4, 6 and 22 h. to determine conversion and initial rate by HPLC (CAD detection) using the analytical method that was described above for the transformation of Rebaudioside D to Rebaudioside M. In parallel the experiments were performed with baseline clone, Round2-Var66. The conversion after 22 h. and initial rate for this baseline clone was defined as 100% and the normalized conversions and initial rates for the round 3 clones are depicted in the following table:

TABLE-US-00012 Normalized conversion Normalized initial Clone Mutations* Reb D to Reb M after 22 h. rate (0-4 h) Round2-Var66 UGT76G1 100%  100%  (S42A_F46I_Q266E_P272A_R334K_G348P_L379G_I407V) Baseline clone Round3-Var1 Round2-Var66 (I46F_L121I_E229A_K393R) 42% 96% Round3-Var2 Round2-Var66 (F18V_A213N_E266S)  7% 36% Round3-Var3 Round2-Var66 (F41L_I190L_A239V_K316R) 20% 64% Round3-Var4 Round2-Var66 (N138K_S274G_Q425E_S456L) 92% 104%  Round3-Var5 Round2-Var66 (F22Y_E229S_V407I_N409R) 15% 66% Round3-Var6 Round2-Var66 (F150A_G216A_T355S_S447A) 15% 50% Round3-Var7 Round2-Var66 (V394I_N409R_Q425E_S447A) 72% 97% Round3-Var8 Round2-Var66 (Y37H_F41L_N409R_Q425E)  6% 37% Round3-Var9 Round2-Var66 (L121V_F182L_K303G_E331G) 75% 95% Round3-Var10 Round2-Var66 (S274G_K303G_N409R_Q432E) 99% 106%  Round3-Var11 Round2-Var66 (F41L_K303G_F314S) 26% 67% Round3-Var12 Round2-Var66 (F22Y_R141S_T284V)  3% 15% Round3-Var13 Round2-Var66 (I190L_E229A_T284V) 31% 70% Round3-Var14 Round2-Var66 (K303G_Q425E_S447A) 109%  114%  Round3-Var15 Round2-Var66 (K316R_L383V_V394I) 107%  117%  Round3-Var16 Round2-Var66 (I190L_K303G_S447A_S456L) 112%  110%  Round3-Var17 Round2-Var66 (N138G_V264C_A352G_S447A) 102%  107%  Round3-Var18 Round2-Var66 (S274K_V407I_Q425E) 91% 107%  Round3-Var19 Round2-Var66 (I190L_S274G_K393R_V394I) 120%  108%  Round3-Var20 Round2-Var66 (A213N_L277I_Q425E_E449D) 79% 101%  Round3-Var21 Round2-Var66 (I46L_K303G_K393R) 147%  117%  Round3-Var22 Round2-Var66 (S221T_S274G_S375Q) 19% 65% Round3-Var23 Round2-Var66 (Y37H_L383V_S456L) 67% 99% Round3-Var24 Round2-Var66 (N138G_I190L_I295T_N409R) 45% 84% Round3-Var25 Round2-Var66 (A42S_S119A_K303G_V407I) 92% 99% Round3-Var26 Round2-Var66 (F22Y_I46F_I190L_V394I) 76% 95% Round3-Var27 Round2-Var66 (N138K_A213N_F314S) 83% 92% Round3-Var28 Round2-Var66 (D301N_F314S_V394I_N409R) 76% 86% Round3-Var29 Round2-Var66 (G216A_E266S_Q432E) 70% 88% Round3-Var30 Round2-Var66 (N138K_A239V_P382R_K393R) 42% 76% Round3-Var31 Round2-Var66 (I46L_S274G_K316R_S456L) 149%  109%  Round3-Var32 Round2-Var66 (F18V_I190L_S375Q_S456L)  1%  2% Round3-Var33 Round2-Var66 (N138K_R141S_S274G) 18% 57% Round3-Var34 Round2-Var66 (N138K_K393R_N409R_S447A) 59% 82% Round3-Var35 Round2-Var66 (I295T_K303G_P382R_V394I) 31% 70% Round3-Var36 Round2-Var66 (N138K_I218V_S456L) 54% 81% Round3-Var37 Round2-Var66 (M145R_S274K_L383V)  1%  1% Round3-Var38 Round2-Var66 (F182L_A352G_V394I) 86% 96% Round3-Var39 Round2-Var66 (A42S_N138G_E229A_S456L) 21% 77% Round3-Var40 Round2-Var66 (R141S_I190L_E331G_Q425E)  6% 35% Round3-Var41 Round2-Var66 (E229S_K316R_T355S) 32% 81% Round3-Var42 Round2-Var66 (I46F_N138K_F292L_N409R) 30% 83% Round3-Var43 Round2-Var66 (A42S_F182L_L277I_T355S) 40% 89% Round3-Var44 Round2-Var66 (S274G_T284V_Q425E) 85% 93% Round3-Var45 Round2-Var66 (A272P_E331G_V394I_S447A) 88% 96% Round3-Var46 Round2-Var66 (S274G_F314S_Q432E_S447A) 112%  104%  Round3-Var47 Round2-Var66 (L121I_K316R_S375Q_N409R) 24% 76% Round3-Var48 Round2-Var66 (L121I_N138K_F150A_K303G) 40% 83% Round3-Var49 Round2-Var66 (I46F_V264C_Q432E) 61% 98% Round3-Var50 Round2-Var66 (F150A_A272P_D301N_K316R) 44% 88% Round3-Var51 Round2-Var66 (I46L_R64V_A239V) 28% 71% Round3-Var52 Round2-Var66 (L121I_I218V_F314S) 87% 94% Round3-Var53 Round2-Var66 (I190L_G216A_E449D) 49% 90% Round3-Var54 Round2-Var66 (S274G_I295M_F314S) 128%  106%  Round3-Var55 Round2-Var66 (F22Y_S274G_P382R_Q432E) 39% 48% Round3-Var56 Round2-Var66 (N138K_I190L_K334R) 93% 97% Round3-Var57 Round2-Var66 (N138G_I295M_K303G) 110%  100%  Round3-Var58 Round2-Var66 (L121V_G216A_Q425E_S456L) 28% 52% Round3-Var59 Round2-Var66 (F182L_F314S_K393R) 92% 97% Round3-Var60 Round2-Var66 (R64V_K316R_N409K) 16% 54% Round3-Var61 Round2-Var66 (V264C_S274G_K393R) 102%  98% Round3-Var62 Round2-Var66 (F41L_K393R_S456L) 12% 49% Round3-Var63 Round2-Var66 (A42S_S274G_F292L_V394I) 75% 87% Round3-Var64 Round2-Var66 (I190L_S221T_E266S_S447A) 34% 71% Round3-Var65 Round2-Var66 (R64V_E229S_S274K) 12% 49% Round3-Var66 Round2-Var66 (S221T_K334R_K393R_V394I) 72% 90% Round3-Var67 Round2-Var66 (I190L_K393R_Q425E_Q432E) 101%  102%  Round3-Var68 Round2-Var66 (F18V_N138K_M145R)  1%  1% Round3-Var69 Round2-Var66 (I218V_F292L_K316R_S447A) 40% 79% Round3-Var70 Round2-Var66 (L121V_E229A_K316R_Q432E) 19% 63% Round3-Var71 Round2-Var66 (Y37H_L121V_D301N) 35% 68% Round3-Var72 Round2-Var66 (N138K_V394I_Q432E_S456L) 66% 89% Round3-Var73 Round2-Var66 (T284V_I295M_A352G_L383V) 69% 89% Round3-Var74 Round2-Var66 (S119A_F150A_V394I_Q425E) 66% 88% Round3-Var75 Round2-Var66 (F18V_A239V_S447A)  8% 27% Round3-Var76 Round2-Var66 (K303G_N409R_Q432E) 84% 97% Round3-Var77 Round2-Var66 (Y37H_A272P_K334R_E449D) 75% 89% Round3-Var78 Round2-Var66 (K303G_F314S_V394I_Q425E) 121%  104%  Round3-Var79 Round2-Var66 (R141S_I295T_F314S_Q432E)  9% 29% Round3-Var80 Round2-Var66 (N138K_I190L_F314S_N409R) 90% 97% Round3-Var81 Round2-Var66 (S119A_E331G_S456L) 87% 97% Round3-Var82 Round2-Var66 (K303G_F314S_K393R_S456L) 100%  100%  Round3-Var83 Round2-Var66 (N138K_A352G_V407I_Q432E) 72% 95% Round3-Var84 Round2-Var66 (S274G_L277I_I295T) 34% 81% Round3-Var85 Round2-Var66 (R64V_L277I_F314S_S447A) 34% 61% Round3-Var86 Round2-Var66 (S221T_N409K_Q432E) 39% 75% Round3-Var87 Round2-Var66 (N409R_S447A_S456L) 52% 86% Round3-Var88 Round2-Var66 (K393R_Q425E_Q432E) 102%  99% Round3-Var89 Round2-Var66 (I46L_F292L_S375Q_N409K)  8% 35% Round3-Var90 Round2-Var66 (M145R_K393R_N409R)  1%  1% Round3-Var91 Round2-Var66 (S119A_M145R_T355S_P382R)  0%  1% Round3-Var92 Round2-Var66 (I190L_E229S_V264C_F314S) 64% 82% *Mutations are noted as follows: reference gene-original amino acid-position-new amino acid: For example the mutation of an isoleucine at position 190 to a leucine for variant 66 from the second round of directed evolution of UGT76G1 is noted as Round2-Var66 (I190L)

[0586] Modeling of these results allowed to obtain a ranking of the effect of each mutation. The following mutations were determined as being beneficial for activity: I46L, I295M, S119A, S274G, K334R, F314S, K303G, K316R, K393R, I190L, Q425E, Q432E, N138G, V394I, F182L, V407I, A272P, V264C, E449D, A352G.

Example 22

Conversion of Rebaudioside A to Rebaudioside I Using UGT76G1

[0587] The reaction was conducted using UGT76G1-R1-F12 (also known as UGT76G1var94)

[0588] The total volume of the reaction was 40 mL with the following composition: 50 mM potassium phosphate buffer pH 7.5, 3 mM MgCl.sub.2, 2.5 mM UDP-glucose, 0.5 mM Rebaudioside A and 4 mL of UGT76G1-R1-F12 lysate (2.5 U/mL). The reaction was run at 30° C. on an orbitary shaker at 135 rpm. For sampling 125 μL of the reaction mixture was quenched with 10 μL of 2N H.sub.2SO.sub.4 and 115 μL of methanol/water (7/3). The samples were immediately centrifuged and kept at 10° C. before analysis by LC-MS. An Agilent 1200 series HPLC system, equipped with binary pump (G1312B), autosampler (G1367D), thermostatted column compartment (G1316B), DAD detector (G1315C), connected with Agilent 6110A MSD, and interfaced with “LC/MSD Chemstation” software, was used.

Instrument Conditions

[0589]

TABLE-US-00013 Column Phenomenex Kinetex 2.6 u C18 100A, 4.6 mm × 150 mm, 2.6 μm Column Temperature 55° C. Detection DAD at 210 nm bw 360 nm MSD (Scan and SIM mode) Mode: ES-API, Negative Polarity Drying gas flow: 13.0 L/min Nebulizer pressure: 30 psig Drying gas temperature: 270° C. Analysis duration 20 min Injected volume 2 μL Flow rate 0.8 mL/min

Mobile Phase Gradient Program

[0590]

TABLE-US-00014 Time (min) A (%): Formic acid 0.1% B (%): Acetonitrile 0 76 24 8.5 76 24 10.0 71 29 16.5 70 30

[0591] The reaction profile is shown in FIG. 5.

[0592] After 42 h. of reaction, 20 mL of the reaction mixture was quenched with 20 mL of ethanol and used for structure elucidation.

[0593] In similar manner, the best clones of UGT76G1 directed evolution round 1 (UGT76G1-R1-F12), round 2 (UGT76G1-R2-B9 identified above as “Round2-Var66”) and round 3 (UGT76G1-R3-G3 identified above as “Round3-Var21”) and native UGT76G1 were tested for the conversion of Rebaudioside A to Rebaudioside I. The results are shown in FIG. 5.

Example 23

Isolation and Characterization of Rebaudioside I

[0594] Crude Reaction Sample.

[0595] The sample, Lot Crude CB-2977-198, used for isolation, was prepared according to Example 22 with UGT76G1.

[0596] HPLC Analysis.

[0597] Preliminary HPLC analyses of samples were performed using a Waters 2695 Alliance System with the following method: Phenomenex Synergi Hydro-RP, 4.6×250 mm, 4 μm (p/n 00G-4375-E0); Column Temp: 55° C.; Mobile Phase A: 0.0284% NH.sub.4OAc and 0.0116% HOAc in water; Mobile Phase B: Acetonitrile (MeCN); Flow Rate: 1.0 mL/min; Injection volume: 10 μL. Detection was by UV (210 nm) and CAD

Gradient:

[0598]

TABLE-US-00015 Time (min) % A % B 0.0-8.5 75 25 10.0 71 29 16.5 70 30 18.5-24.5 66 34 26.5-29.0 48 52 31-37 30 70 38   75 25

[0599] Isolation by HPLC.

[0600] The purification was performed using a Waters Atlantis dC18 (30×100 mm, 5 μm, p/n 186001375) column with isocratic mobile phase conditions of 80:20 water/MeCN. Flow rate was maintained at 45 mL/min and injection load was 180 mg. Detector wavelength was set at 210 nm.

[0601] The analyses of fractions were performed using a Waters Atlantis dC18 (4.6×150 mm, 5 μm, p/n 186001342) column; Mobile Phase A: water; Mobile Phase B: MeCN; Flow Rate: 1 mL/min; Isocratic mobile phase conditions: 75:25 A/B for 30 min.

[0602] MS and MS/MS.

[0603] MS and MS/MS data were generated with a Waters QT of Micro mass spectrometer equipped with an electrospray ionization source. The sample was analyzed by negative ESI. The sample was diluted to a concentration of 0.25 mg/mL with H.sub.2O:MeCN (1:1) and introduced via flow injection for MS data acquisition. The sample was diluted further to 0.01 mg/mL to yield good s/n to tune for MS/MS and acquired by direct infusion. The collision energy was set to 60 V in order to acquire MS/MS data with increased fragment ion peaks due to the nature of the molecule

[0604] NMR.

[0605] The sample was prepared by dissolving ˜1.0 mg in 180 μL of pyridine-d.sub.5+TMS, and NMR data were acquired on a Bruker Avance 500 MHz instrument with either a 2.5 mm inverse probe or a 5 mm broad band probe. The 13C and HMBC NMR data were acquired at Rensselaer Polytechnic Institute using their Bruker Avance 600 MHz and 800 MHz instruments with 5 mm cryo-probe, respectively. The .sup.1H and .sup.13C NMR spectra were referenced to the TMS resonance (δ.sub.H 0.00 ppm and δ.sub.C 0.0 ppm).

[0606] Isolation of Reb I was performed using a semi-synthetic steviol glycoside mixture, Lot number CB-2977-198. The material was analyzed by HPLC as described above. The Reb I peak was observed at a retention time (t.sub.R) of approximately 17 min as shown in FIG. 6.

[0607] Results and Discussion

[0608] The reb I peak was isolated from the reaction crude as described above. The isolated fraction was pooled and lyophilized. Purity of the final product was 91% as confirmed by LC-CAD using the method described above. Approximately 1 mg of Reb I was provided for spectroscopic and spectrometric analyses.

[0609] Mass Spectrometry.

[0610] The ESI-TOF mass spectrum acquired by infusing a sample of reb I showed a [M-H].sup.− ion at m/z 1127.4741. The mass of the [M-H].sup.− ion was in good agreement with the molecular formula C.sub.50H.sub.79O.sub.28 (calcd for C.sub.50H.sub.79O.sub.28: 1127.4758, error: −1.5 ppm) expected for reb I. The MS data confirmed that reb I has a nominal mass of 1128 Daltons with the molecular formula, C.sub.50H.sub.80O.sub.28.

[0611] The MS/MS spectrum of reb I, selecting the [M-H].sup.− ion at m/z 1127.4 for fragmentation, indicated loss of two sugar units at m/z 803.5301, however did not show additional fragmentation with collision energy of 30 V. When higher collision energy was applied (60 V), the parent ion was not observed but sequential loss of three sugar units at m/z 641.4488, 479.3897, and 317.3023 were observed from m/z 803.5301

[0612] NMR Spectroscopy.

[0613] A series of NMR experiments including .sup.1H NMR, .sup.13C NMR, .sup.1H-.sup.1H COSY, HSQC-DEPT, HMBC NOESY, and 1D TOCSY were performed to allow assignment of reb I.

[0614] In the .sup.1H NMR spectrum of reb I acquired at 300 K, one of the anomeric protons was completely obscured by the water resonance. Therefore, .sup.1H NMR spectrum of the sample was acquired at lower temperature (292 K), to shift out the water resonance, and at this temperature anomeric proton was sufficiently resolved. Thus, all other NMR data of reb I was acquired at 292 K.

[0615] The 1D and 2D NMR data indicated that the central core of the glycoside is a diterpene. An HMBC correlation from the methyl protons at δ.sub.H 1.22 to the carbonyl at δ.sub.C 176.9 allowed assignment of one of the tertiary methyl groups (C-18) as well as C-19 and provided a starting point for the assignment of the rest of the aglycone. Additional HMBC correlations from the methyl protons (H-18) to carbons at δ.sub.C 38.5, 44.0, and 57.2 allowed assignment of C-3, C-4, and C-5. Analysis of the .sup.1H-.sup.13C HSQC-DEPT data indicated that the carbon at δ.sub.C 38.5 was a methylene group and the carbon at δ.sub.C 57.2 was a methine which were assigned as C-3 and C-5, respectively. This left the carbon at δ.sub.C 44.0, which did not show a correlation in the HSQC-DEPT spectrum, to be assigned as the quaternary carbon, C-4. The .sup.1H chemical shifts for C-3 (δ.sub.H 1.02 and 2.35) and C-5 (δ.sub.H 1.03) were assigned using the HSQC-DEPT data. A COSY correlation between one of the H-3 protons (δ.sub.H 1.02) and a proton at δ.sub.H 1.44 allowed assignment of one of the H-2 protons which in turn showed a correlation with a proton at δ.sub.H 0.74 which was assigned to H-1. The remaining .sup.1H and .sup.13C chemical shifts for C-1 and C-2 were then assigned on the basis of additional COSY and HSQC-DEPT correlations and are summarized in the table below.

TABLE-US-00016 .sup.1H and .sup.13C NMR (500 and 150 MHz, pyridine-d.sub.5), assignments of the Rebaudioside I aglycone. Position .sup.1H .sup.13C 1 0.74 t (11.6) 40.7 1.75 m 2 1.44 m 2.20 m 19.4 3 1.02 m 2.35 m 38.5 4 — 44.0 5 1.03 m 57.2 6 1.90 m 2.33 m 22.2 7 1.29 m 1.31 m 41.7 8 — 42.3 9 0.88 d (6.3) 54.1 10 — 39.8 11 1.67 m 1.70 m 20.5 12 1.98 m 2.28 m 37.3 13 — 86.7 14 1.78 m 2.59 d 44.3 (11.9) 15 2.04 brs 47.6 16 — 154.0 17 5.02 s 5.67 s 104.8 18 1.22 s 28.4 19 — 176.9 20 1.26 s 15.7

[0616] The other tertiary methyl singlet, observed at δ.sub.H 1.26, showed HMBC correlations to C-1 and C-5 and was assigned as H-20. The methyl protons showed additional HMBC correlations to a quaternary carbon (δ.sub.C 39.8) and a methine carbon (δ.sub.C 54.1) which were assigned as C-10 and C-9, respectively. COSY correlations between H-5 (δ.sub.H 1.03) and protons at δ.sub.H 1.90 and 2.33 then allowed assignment of the H-6 protons which in turn showed correlations to protons at δ.sub.H 1.29 and 1.31 which were assigned to H-7. The .sup.13C chemical shifts for C-6 (δ.sub.C 22.2) and C-7 (δ.sub.C 41.7) were then determined from the HSQC-DEPT data. COSY correlations between H-9 (δ.sub.H 0.88) and protons at δ.sub.H 1.67 and 1.70 allowed assignment of the H-11 protons which in turn showed COSY correlations to protons at δ.sub.H 1.98 and 2.28 which were assigned as the H-12 protons. The HSQC-DEPT data was then used to assign C-11 (δ.sub.C 20.5) and C-12 (δ.sub.C 37.3). The olefinic protons observed at δ.sub.H 5.02 and 5.67 showed HMBC correlations to a quaternary carbon at δ.sub.C 86.7 (C-13) and thus were assigned to H-17 (δ.sub.C 104.8 via HSQC-DEPT). The methine proton H-9 showed HMBC correlations to carbons at δ.sub.C 42.3, 44.3 and 47.6 which were assigned as C-8, C-14 and C-15, respectively. The .sup.1H chemical shifts at C-14 (δ.sub.H 1.78 and 2.59) and C-15 (δ.sub.H 2.04) were assigned using the HSQC-DEPT data. Additional HMBC correlations from H-9 to C-11 and H-12 to C-9 further confirmed the assignments made above. HMBC correlations observed from H-14 to a quaternary carbon at δ.sub.C 154.0 allowed the assignment of C-16 to complete the assignment of the central core.

[0617] Correlations observed in the NOESY spectrum were used to assign the relative stereochemistry of the central diterpene core. In the NOESY spectrum, NOE correlations were observed between H-14 and H-20 indicating that H-14 and H-20 are on the same face of the rings. Similarly, NOE correlations were observed between H-9 and H-5 as well as H-5 and H-18. NOE correlations between H-9 and H-14 were not observed. The NOESY data thus indicate that H-5, H-9 and H-18 were on the opposite face of the rings compared to H-14 and H-20 as presented in the figure below. These data thus indicate that the relative stereochemistry in the central core was retained during the glycosylation step.

[0618] Analysis of the .sup.1H-.sup.13C HSQC-DEPT data for reb I confirmed the presence of five anomeric protons. All five anomeric protons were resolved in the spectra acquired at 292 K at δ.sub.H 6.14 (δ.sub.C 95.3), 5.57 (δ.sub.C 104.6), 5.38 (δ.sub.C 104.7), 5.29 (δ.sub.C 105.0), and 5.06 (δ.sub.C 98.0). Additionally, all five anomeric protons had large couplings (7.7 Hz-8.2 Hz) indicating that they had β-configurations. The anomeric proton observed at δ.sub.H 6.14 showed an HMBC correlation to C-19 which indicated that it corresponds to the anomeric proton of Glc.sub.I. Similarly, the anomeric proton observed at δ.sub.H 5.06 showed an HMBC correlation to C-13 allowing it to be assigned as the anomeric proton of Glc.sub.II.

[0619] The Glc.sub.I anomeric proton (δ.sub.H 6.14) showed a COSY correlation to a proton at δ.sub.H 4.18 which was assigned as Glc.sub.I H-2. Due to data overlap the COSY spectrum did not allow assignment of H-3 or H-4. Therefore, a series of 1D TOCSY experiments were performed using selective irradiation of the Glc.sub.I anomeric proton with several different mixing times. In addition to confirming the assignment for Glc.sub.I H-2, the TOCSY data showed protons at δ.sub.H 4.27, 4.25, and 3.93 which were assigned as H-3, H-4 and H-5, respectively. The proton observed at δ.sub.H 4.37 in the TOCSY spectrum was assigned to one of the Glc.sub.I H-6 protons. The other H-6 methylene proton at δ.sub.H 4.27 was assigned based on COSY correlation from H-5 to δ.sub.H 4.27. The .sup.13C chemical shifts for Glc.sub.I C-2 (δ.sub.C 72.5), C-3 (δ.sub.C 89.4), C-4 (δ.sub.C 69.2), C-5 (δ.sub.C 78.2-78.8) and C-6 (δ.sub.C 61.7) were assigned using the HSQC-DEPT data. HMBC correlations from H-1 to C-3 and H-4 to C-6 further confirmed the assignments made above to complete the assignment of Glc.sub.I.

[0620] Of the four remaining unassigned glucose moieties one was assigned as a substituent at C-3 of Glc.sub.I on the basis of HMBC correlations. The anomeric proton observed at δ.sub.H 5.29 showed an HMBC correlation to Glc.sub.I C-3 and was assigned as the anomeric proton of Glc.sub.V. The reciprocal HMBC correlation from Glc.sub.I H-3 to the anomeric carbon of Glc.sub.V was also observed.

[0621] A summary of the .sup.1H and .sup.13C chemical shifts for the glycoside at C-19 are shown in the following table:

TABLE-US-00017 .sup.1H and .sup.13C NMR (500 and 150 MHz, pyridine-d.sub.5) assignments of Rebaudioside I C-19 glycoside. Position .sup.1H .sup.13C Glc.sub.I-1 6.14 d (8.2) 95.3 Glc.sub.I-2 4.18 m 72.5 Glc.sub.I-3 4.27 m 89.4 Glc.sub.I-4 4.25 m 69.2 Glc.sub.I-5 3.93 m 78.2-78.8.sup.† Glc.sub.I-6 4.27 m, 4.37 m 61.7 Glc.sub.V-1 5.29 d (7.9) 105.0 Glc.sub.V-2 4.04 m 75.3 or 75.5 Glc.sub.V-3 4.27 m 78.2-78.6.sup.† Glc.sub.V-4 4.12 m 71.5 or 71.6 Glc.sub.V-5 4.05 m .sup. 78.5 or 78.6.sup.† Glc.sub.V-6 4.26 m, 4.56 m 62.3 or 62.4

[0622] A summary of key HMBC and COSY correlations used to assign the C-19 glycoside region are provided below. †Five carbon resonances in the range of 78.2-78.8 (78.16, 78.47, 78.50, 78.55, and 78.77), hence chemical shift could not be unequivocally assigned.

##STR00002##

[0623] The anomeric proton of Glc.sub.V (δ.sub.H 5.29) showed a COSY correlation with a proton at δ.sub.H 4.04 which was assigned as Glc.sub.V H-2. Glc.sub.V C-2 (δ.sub.C 75.3 or 75.5) was then assigned using the HSQC-DEPT data. Due to overlap in the data the COSY spectrum did not allow assignment of the remaining protons. Therefore, a series of 1D TOCSY experiments were performed using selective irradiation of the Glc.sub.V anomeric proton with several different mixing times. In addition to confirming the assignments for Glc.sub.V H-2, the TOCSY data allowed assignment of Glc.sub.V H-3 (δ.sub.H 4.27), H-4 (δ.sub.H 4.12), and H-5 (δ.sub.H 4.05). The proton observed at δ.sub.H 4.56 in the TOCSY spectrum was assigned to one of the Glc.sub.V H-6 protons. The other H-6 methylene proton at δ.sub.H 4.26 was assigned based on COSY correlation from H-5 to δ.sub.H 4.26. The .sup.13C chemical shifts for Glc.sub.V C-3 (δ.sub.C 78.2-78.6), C-4 (δ.sub.C 71.5 or 71.6), C-5 (δ.sub.C 78.5 or 78.6) and C-6 (δ.sub.C 62.3 or 62.4) were assigned using the HSQC-DEPT data to complete the assignment of Glc.sub.V.

[0624] Assignment of Glc.sub.II was carried out in a similar manner. The Glc.sub.II anomeric proton (δ.sub.H 5.06) showed a COSY correlation to a proton at δ.sub.H 4.34 which was assigned as Glc.sub.II H-2 and in turn showed a COSY correlation to a proton at δ.sub.H 4.20 (Glc.sub.II H-3) which showed an additional correlation with a proton at δ.sub.H 3.97 (Glc.sub.II H-4) which also showed a COSY correlation to a proton at δ.sub.H 3.80 (Glc.sub.II H-5). H-5 showed additional COSY correlations to protons at δ.sub.H 4.18 and 4.49 which were assigned to H-6. A series of 1D TOCSY experiments were also performed using selective irradiation of the Glc.sub.II anomeric proton with several different mixing times. The TOCSY data confirmed the above proton assignments. Assignment of the .sup.13C chemical shifts for Glc.sub.II C-2 (δ.sub.C 80.2), C-3 (δ.sub.C 87.5), C-4 (δ.sub.C 70.1), C-5 (δ.sub.C 77.6) and C-6 (δ.sub.C 62.5) was based on HSQC-DEPT data. HMBC correlations from Glc.sub.II H-3 to C-2 and C-4 and also from Glc.sub.II H-4 to C-3, C-5 and C-6 confirmed the assignments made above to complete the assignment of Glc.sub.II.

[0625] The remaining two unassigned glucose moieties were assigned as substituents at C-2 and C-3 of Glc.sub.II on the basis of HMBC correlations. The anomeric proton observed at δ.sub.H 5.57 showed an HMBC correlation to Glc.sub.II C-2 and was assigned as the anomeric proton of Glc.sub.III. The anomeric proton observed at δ.sub.H 5.38 showed an HMBC correlation to Glc.sub.II C-3 and was assigned as the anomeric proton of Glc.sub.IV. The reciprocal HMBC correlations from Glc.sub.II H-2 to the anomeric carbon of Glc.sub.III and from Glc.sub.II H-3 to the anomeric carbon of Glc.sub.IV were also observed.

[0626] The anomeric proton of Glc.sub.III (δ.sub.H 5.57) showed a COSY correlation with a proton at δ.sub.H 4.21 which was assigned as Glc.sub.III H-2. Glc.sub.III C-2 (δ.sub.C 76.3) was then assigned using the HSQC-DEPT data. Due to data overlap the COSY spectrum did not allow assignment of the remaining protons. Therefore, a series of 1D TOCSY experiments were performed using selective irradiation of the Glc.sub.III anomeric proton with several different mixing times. In addition to confirming the assignments for Glc.sub.III H-2, the TOCSY data allowed assignment of Glc.sub.III H-3 (δ.sub.H 4.27), H-4 (δ.sub.H 4.25) and H-5 (δ.sub.H 3.94). The protons observed at δ.sub.H 4.41 and δ.sub.H 4.53 in the TOCSY spectrum were assigned as the Glc.sub.III H-6 protons. The .sup.13C chemical shifts for C-3 (δ.sub.C 78.2-78.6), C-4 (δ.sub.C 72.1), C-5 (δ.sub.C 78.2-78.8) and C-6 (δ.sub.C 63.1) were assigned using the HSQC-DEPT data. HMBC correlations from H-5 to a carbon at δ.sub.C 63.1 further confirmed the assignment of Glc.sub.III C-6 to complete the assignment of Glc.sub.III.

[0627] The anomeric proton of Glc.sub.IV (δ.sub.H 5.38) showed a COSY correlation with a proton at δ.sub.H 4.01 which was assigned as Glc.sub.IV H-2. Glc.sub.IV C-2 (δ.sub.C 75.3 or 75.5) was then assigned using the HSQC-DEPT data. Due to data overlap the COSY spectrum did not allow assignment of the remaining protons. Therefore a series of 1D TOCSY experiments were performed using selective irradiation of the Glc.sub.IV anomeric proton with several different mixing times. In addition to confirming the assignments for Glc.sub.IV H-2, the 1D TOCSY data allowed assignment of H-3 (δ.sub.H 4.28), H-4 (δ.sub.H 4.11), H-5 (δ.sub.H 4.13) and H-6 (δ.sub.H 4.25 and 4.58). The proton at δ.sub.H 4.25 also showed COSY correlation with δ.sub.H 4.58 further confirmed that these protons belong to H-6. The .sup.13C chemical shifts for C-3 (δ.sub.C 78.2-78.6), C-4 (δ.sub.C 72.1), C-5 (δ.sub.C 78.2-78.6) and C-6 (δ.sub.C 62.3 or 62.4) were assigned using the HSQC-DEPT data. HMBC correlations from H-4 to C-6 and H-5 to C-1 further confirmed the assignment of Glc.sub.IV C-6 to complete the assignment of Glc.sub.IV.

[0628] A summary of the .sup.1H and .sup.13C chemical shifts for the glycoside at C-13 are shown below:

TABLE-US-00018 .sup.1H and .sup.13C NMR (500 and 150 MHz, pyridine-d.sub.5) assignments of the Rebaudioside I C-13 glycoside. Position .sup.1H 13C Glc.sub.II-1 5.06 d (7.9) 98.0 Glc.sub.II-2 4.34 m 80.6 Glc.sub.II-3 4.20 m 87.5 Glc.sub.II-4 3.97 m 70.1 Glc.sub.II-5 3.80 m 77.6 Glc.sub.II-6 4.18 m, 4.49 m 62.5 Glc.sub.III-1 5.57 d (7.7) 104.6 Glc.sub.III-2 4.21 m 76.3 Glc.sub.III-3 4.27 m 78.2-78.6.sup.† Glc.sub.III-4 4.25 m 72.1 Glc.sub.III-5 3.94 m 78.2-78.8.sup.† Glc.sub.III-6 4.41 m, 4.53 m 63.1 Glc.sub.IV-1 5.38 d (7.9) 104.7 Glc.sub.IV-2 4.01 m 75.3 or 75.5 Glc.sub.IV-3 4.28 m 78.2-78.6.sup.† Glc.sub.IV-4 4.11 m 72.1 Glc.sub.IV-5 4.13 m 78.2-78.6.sup.† Glc.sub.IV-6 4.25 m, 4.58 m 62.3 or 62.4

[0629] A summary of key HMBC and COSY correlations used to assign the C-13 glycoside region are provided below. †Five carbon resonances in the range of 78.2-78.8 (78.16, 78.47, 78.50, 78.55, and 78.77), hence chemical shift could not be unequivocally assigned.

##STR00003##

[0630] NMR and MS analyses of rebaudioside I allowed the full assignment of the structure as (13-[(2-O-β-D-glucopyranosyl-3-O-β-D-glucopyranosyl)-β-D-glucopyranosyl)oxy] ent-kaur-16-en-19-oic acid-(3-O-β-D-glucopyranosyl)-β-D-glucopyranosyl) ester].

Example 24

Sensory Characteristics of Rebaudioside I

[0631] Rebaudioside I was evaluated to determine its sensory profile, including in comparison to rebaudioside M.

Sample Preparation.

[0632] Samples were prepared at a concentration of 400 ppm in a water matrix. Analysis to determine the actual concentration of the samples was preformed.

Methodology

[0633] Seven panelists participated in testing of rebaudioside I and rebaudioside M. Samples were served at approximately 4° C. Panelists were instructed to take 1 sip of the sample (10 mL), hold in mouth for 5 seconds, expectorate and rate the taste attributes, as described below. A 5 minute break was placed between each sample and panelist were instructed to cleanse their palates with at least 1 bite of an unsalted cracker and 2 sips of filtered water. Samples were randomized and each sample was present in replicate in the session.

[0634] Attributes evaluated included: sweet taste intensity (maximum level of sweeteness in mouth during 5 seconds); bitter taste intensity (maximum level of bitterness in mouth during 5 seconds); overall maximum sweet intensity (maximum sweet intensity experienced from time sip is taken up to 1 minute); overall maximum bitter intensity (maximum bitter intensity experienced from time sip is taken up to 1 minute); other intensity (intensity of any taste, aromatic or mouth feel other than sweet and bitter (e.g., metallic, plastic, licorice, etc.); sweet linger intensity (sweet intensity 1 minute after expectoring the sample); and bitter aftertaste intensity (bitter intensity one minute after expectoring the sample).

[0635] A 3-way ANOVA analysis was used to compare the sweetners for each attribute and significance was determined at the 95% CL. Fishers LSD was used to compare significant differences between the mean scores.

Results

[0636] Rebaudioside I was lower in sweet taste intensity, overall maximal sweet intensity and sweet linger intensity.

TABLE-US-00019 TABLE 1 Sensory Attributes of Rebaudioside I Compared to Rebaudioside M at 400 ppm Overall Max Overall Max Sweet Bitter Sweet Taste Bitter Taste Sweetness Bitterness Other Linger Aftertaste Intensity Intensity Intensity Intensity Intensity Intensity Intensity (Reb M) 7.4 1.0 8.0 1.6 0.9 4.9 0.8 (Reb I) 5.9 1.4 7.2 2.1 1.3 3.5 1.3

Example 25: Beverage Formulations

Flavored Black Tea:

[0637] The taste properties of a flavored zero calorie black tea drink containing Reb A in a concentration of 275 ppm is compared to a comparable flavored zero calorie black tea drink with Reb I in a concentration of 275 ppm. The drink containing Reb I is determined to be much cleaner in finish with less sweetness linger and a more rounded overall sweetness profile.

Enhanced Water:

[0638] The taste properties of a zero calorie enhanced water drink containing Reb A in a concentration of 200 ppm is compared to a comparable zero calorie enhanced water drink containing Reb I in a concentration of 200 ppm. The Reb I-containing drink is cleaner in finish and has a reduced sweetness linger and a more rounded overall sweetness taste quality.

Lemon-Lime Flavored Sparking Beverage:

[0639] Reb I levels are evaluated in an zero calorie Lemon-lime-flavored sparking beverage base to determine the effect of increasing sweetness. Samples of the Lemon-lime-flavored sparkling beverage with Reb I in amounts between 400 and 750 ppm (in 50 ppm increments) and 3.5% allulose are prepared. All samples taste significantly better than comparable Reb A-containing formulations, resulting in cleaner profiles with increased sweetness intensity and not negative aftertaste characteristic. Samples having 550 ppm and 600 ppm Reb I are found to be the closest in sweetness level to an 10.0 Brix HFCS sweetened Lemon-lime flavored sparkling beverage formulation.