COMPOSITIONS AND METHODS OF DUAL POISON-ANTIDOTE MEIOTIC DRIVERS
20200149054 ยท 2020-05-14
Inventors
- Sara ZANDERS (Prairie Village, KS, US)
- Nicole NUCKOLLS (Shawnee, KS, US)
- Maria Angelical Bravo NUNEZ (Kansas City, MO, US)
- Harmit Singh MALIK (Shoreline, WA, US)
Cpc classification
C12N1/00
CHEMISTRY; METALLURGY
International classification
Abstract
The present disclosure provides, inter alia, meiotic drive genes derived from chromosome 3 of the fission yeasts Schizosaccharomyces kambucha and S. pombe and orthologs thereof. In certain embodiments, compositions, methods, and kits are provided for biasing organisms to express such genes and, optionally, to co-express one or more genes of interest in such organisms.
Claims
1. A meiotic drive composition comprising: a recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the recombinant DNA sequence; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA.
2. A meiotic drive composition comprising: a recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA.
3. A meiotic drive composition comprising: a recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the recombinant DNA sequence; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA.
4. The meiotic drive composition of claim 1, wherein the recombinant DNA sequence does not naturally occur in the diploid organism.
5. The meiotic drive composition of claim 1, wherein the recombinant DNA sequence is adapted to integrate into the genome of the diploid organism.
6. A vector comprising the recombinant DNA sequence according to claim 1, and a heterologous DNA sequence.
7. A method of propagating a recombinant DNA sequence in a diploid organism's offspring comprising the steps of: expressing the recombinant DNA sequence in the diploid organism, wherein the DNA sequence encodes a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete of the organism and the second peptide sequence capable of rescuing a gamete of the organism from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the recombinant DNA sequence; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA sequence; and permitting reproduction of the organism.
8. A method of propagating a recombinant DNA sequence in a diploid organism's offspring comprising the steps of: expressing the recombinant DNA sequence in the diploid organism, wherein the DNA sequence encodes a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete of the organism and the second peptide sequence capable of rescuing a gamete of the organism from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA sequence; and permitting reproduction of the organism.
9. A method of propagating a recombinant DNA sequence in a diploid organism's offspring comprising the steps of: expressing the recombinant DNA sequence in the diploid organism, wherein the DNA sequence encodes a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete of the organism and the second peptide sequence capable of rescuing a gamete of the organism from the first peptide sequence; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the recombinant DNA sequence; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA sequence; and permitting reproduction of the organism.
10. The method according to claim 7, wherein the recombinant DNA sequence does not naturally occur in the diploid organism.
11. The method according to claim 7, wherein the recombinant DNA sequence is adapted to integrate into the genome of the diploid organism.
12. A meiotic drive composition comprising: a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; and a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
13. A meiotic drive composition comprising: a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; and a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
14. A meiotic drive composition comprising: a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; and a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
15. The meiotic drive composition of claim 12, wherein the first recombinant DNA sequence does not naturally occur in the diploid organism.
16. The meiotic drive composition of claim 12, wherein the second recombinant DNA sequence does not naturally occur in the diploid organism.
17. The meiotic drive composition of claim 12, wherein the first recombinant DNA sequence and/or second recombinant DNA sequence is adapted to integrate into the genome of the diploid organism.
18. A vector comprising the first recombinant DNA sequence and/or second recombinant DNA sequence according to claim 12, and a heterologous DNA sequence.
19. The meiotic drive composition of claim 12, wherein the second recombinant DNA sequence is operably linked to the first recombinant DNA sequence via proximity of the first and second recombinant DNA sequences on a chromosome.
20. The meiotic drive composition of claim 12, wherein the second recombinant DNA sequence is adjacent to the first recombinant DNA sequence and there is continuous transcription of the first and second recombinant DNA sequences.
21. A method of propagating one or more recombinant DNA sequences in a diploid organism's offspring comprising the steps of: (i) expressing in the organism a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; and (ii) expressing in the organism a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; and (iii) permitting reproduction of the organism; wherein the first recombinant DNA sequence, when expressed in the organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
22. A method of propagating one or more recombinant DNA sequences in a diploid organism's offspring comprising the steps of: (i) expressing in the organism a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; and (ii) expressing in the organism a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; and (iii) permitting reproduction of the organism; wherein the first recombinant DNA sequence, when expressed in the organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
23. A method of propagating one or more recombinant DNA sequences in a diploid organism's offspring comprising the steps of: (i) expressing in the organism a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; (ii) expressing in the organism a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; and (iii) permitting reproduction of the organism; wherein the first recombinant DNA sequence, when expressed in the organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
24. The method according to claim 21, wherein the first recombinant DNA sequence does not naturally occur in the diploid organism.
25. The method according to claim 21, wherein the second recombinant DNA sequence does not naturally occur in the diploid organism.
26. The method according to claim 21, wherein the first recombinant DNA sequence and/or second recombinant DNA sequence is adapted to integrate into the genome of the diploid organism.
27. The method according to claim 21, wherein the second recombinant DNA sequence is linked to the first recombinant DNA sequence via proximity of the first and second recombinant DNA sequences on a chromosome.
28. The method of claim 21, wherein the second recombinant DNA sequence is adjacent to the first recombinant DNA sequence and there is continuous transcription of the first and second recombinant DNA sequences.
29. A kit comprising: (1) a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; (2) a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence; (3) reagents for expressing the first recombinant DNA sequence and/or the second recombinant DNA sequence in the diploid organism.
30. A kit comprising: (1) a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; (2) a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence; (3) reagents for expressing the first recombinant DNA sequence and/or the second recombinant DNA sequence in the diploid organism.
31. A kit comprising: (1) a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; (2) a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence; and (3) reagents for expressing the first recombinant DNA sequence and/or the second recombinant DNA sequence in the diploid organism.
32. The composition of claim 1, wherein the first peptide sequence has at least 70% identity to the group of peptide sequences selected from SEQ ID NOs: 1 and 3.
33. The composition of claim 1, wherein the first peptide sequence has at least 80% identity to the group of peptide sequences selected from SEQ ID NOs: 1 and 3.
34. The composition of claim 1, wherein the first peptide sequence has at least 90% identity to the group of peptide sequences selected from SEQ ID NOs: 1 and 3.
35. The composition of claim 1, wherein the second peptide sequence has at least 70% identity to the group of peptide sequences selected from SEQ ID NOs: 2 and 4.
36. The composition of claim 1, wherein the second peptide sequence has at least 80% identity to the group of peptide sequences selected from SEQ ID NOs: 2 and 4.
37. The composition of claim 1, wherein the second peptide sequence has at least 90% identity to the group of peptide sequences selected from SEQ ID NOs: 2 and 4.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0031] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0032] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
DETAILED DESCRIPTION OF THE INVENTION
[0043] The present disclosure provides a meiotic drive composition comprising a recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the recombinant DNA sequence; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA.
[0044] As used herein, the term recombinant DNA sequence means a DNA molecule formed through recombination methods to splice fragments of DNA from a different source or from different parts of the same source. For example, in some embodiments, two or more different sources of DNA are cleaved using restriction enzymes and joined together using ligases.
[0045] As used herein, the term destroying a gamete and grammatical versions thereof means killing a gamete, preventing a gamete from uniting with another haploid cell, or preventing or reducing viability of a zygote arising from a gamete. As used herein, the term rescuing a gamete and grammatical versions thereof means preventing one or more agents from destroying a gamete or increasing the viability of a gamete relative to a non-rescued gamete.
[0046] As used herein, the term transport outside of a cell and grammatical versions thereof means any form of movement from the interior of a cell (or subcellular compartment) to the outside of the cell. The forms of transport outside of a cell include, but are not limited to, active transport, passive transport, and transport through one or more of endoplasmic reticulum, golgi, endosome, and secretory vesicles. In some embodiment, some or all of a protein translated inside of a cell may be transported outside of a cell. For example, in some embodiments, some or all of a peptide sequence may move from the interior of a cell to the outside of the cell (e.g. released into intercellular space or tethered to the outer membrane) where the peptide sequence may contact other cells.
[0047] As used herein, the terms polypeptide, peptide, and protein are used interchangeably herein to refer to a polymer of amino acid residues. The term peptide sequence refers to the sequence of amino acid residues comprising the peptide. In some embodiments, the peptide sequence is encoded by one or more nucleic acids. Nucleic acid as used herein means at least two nucleotides covalently linked together. Nucleic acids may be single stranded or double stranded, or may contain portions of both double stranded and single stranded sequences. The nucleic acid may be DNA, both genomic and cDNA, RNA, or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine. Nucleic acids may be synthesized as a single stranded molecule or expressed in a cell (in vitro or in vivo) using a synthetic gene. Nucleic acids may be obtained by chemical synthesis methods or by recombinant methods.
[0048] As used herein, the term alternative transcriptional start site, and grammatical versions thereof, means that there is more than one location where transcription starts at the 5 end of a nucleotide sequence. In some embodiments, the alternative transcription start sites result in distinct translation start sites to produce alternative isoforms of protein sequences. In some embodiments, the alternative transcripts encode distinct meiotic drive components. For example, in some embodiments, the alternative transcripts of Sk wtf 4 or Sp wtf 4 genes encode the two meiotic drive components of a poison peptide sequence (capable of destroying a gamete) and an antidote peptide sequence (capable of rescuing a gamete). In some embodiments, the alternative transcriptional start site is an alternative first exon transcriptional start site or an alternative tandem transcriptional start site.
[0049] According to some embodiments, a meiotic drive composition comprises a recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA.
[0050] According to some embodiments, a meiotic drive composition comprises a recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the recombinant DNA sequence; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA.
[0051] According to some embodiments, the recombinant DNA sequence does not naturally occur in the diploid organism. As used herein, the term does not naturally occur and grammatical versions thereof means that the recombinant DNA sequence is not present in the endogenous genomic DNA sequence of the organism or comprises at least one nucleotide substitution relative to the endogenous genomic DNA sequence. In some embodiments, the organism is selected from any vertebrate or invertebrate animal, including but not limited to, rodents, fleas, mosquitos, worms, ticks, lice, and flies, among many others.
[0052] According to some embodiments, the recombinant DNA sequence is adapted to integrate into the genome of a diploid organism. As used herein, the term integrate into the genome and grammatical versions thereof means to combine a DNA sequence with the whole of a chromosome or genome. The term includes, without limitation, site specific integration, random integration, reversible integration, or irreversible integration.
[0053] In some embodiments, the first and second peptide sequence may be encoded by any meiotic drive gene that, when expressed in a diploid organism, is capable of biasing offspring of such organism to express such gene and other genes that may be operatively linked to such genes. For example, the first peptide sequence may be SEQ ID NOs.: 1 and/or 3 or orthologs thereof. And, for example, the second peptide sequence may be SEQ ID NOs.: 2 and/or 4 or orthologs thereof. In addition, according to some embodiments, the first peptide sequence has at least 70% identity to SEQ ID NO: 1. According to some embodiments, the first peptide sequence has at least 80% identity to SEQ ID NO: 1. According to some embodiments, the first peptide sequence has at least 90% identity to SEQ ID NO: 1. According to some embodiments, the second peptide sequence has at least 70% identity to SEQ ID NO: 2. According to some embodiments, the second peptide sequence has at least 80% identity to SEQ ID NO: 2. According to some embodiments, the second peptide sequence has at least 90% identity to SEQ ID NO: 2.
[0054] According to some embodiments, the first peptide sequence has at least 70% identity to SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 80% identity to SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 90% identity to SEQ ID NO: 3. According to some embodiments, the second peptide sequence has at least 70% identity to SEQ ID NO: 4. According to some embodiments, the second peptide sequence has at least 80% identity to SEQ ID NO: 4. According to some embodiments, the second peptide sequence has at least 90% identity to SEQ ID NO: 4.
[0055] As used herein, the term identity and grammatical versions thereof means the extent to which two nucleotide or amino acid sequences have the same residues at the same positions in an alignment. Percent (%) identity is calculated by multiplying the number of matches in a sequence alignment by 100 and dividing by the length of the aligned region, including internal gaps. In some embodiments, one or more peptides have at least 70, 80, 90, 95, 96, 97, 98, or 99% identity to one or more of SEQ ID NOs: 1-4.
[0056] In some embodiments, the first and/or second peptides comprise structural features, such as transmembrane helices. In some embodiments, SEQ ID NO: 1 comprises transmembrane helices between one or more of the following amino acid ranges: 41-63, 78-97, 110-129, 133-150, 162-184, and 194-216. In some embodiments, SEQ ID NO: 2 comprises transmembrane helices between one or more of the following amino acid ranges: 83-105, 120-139, 152-171, 175-192, 204-226, and 236-258. In some embodiments, SEQ ID NO: 3 comprises transmembrane helices between one or more of the following amino acid ranges: 53-75, 90-111, 118-140, 176-195, 208-230, 235-257, and 303-325. In some embodiments, SEQ ID NO: 4 comprises transmembrane helices between one or more of the following amino acid ranges: 108-130, 145-166, 173-195, 231-250, 263-285, 290-312, and 358-380.
[0057] In some embodiments, the first peptide sequence comprises the short form of the wtf 4 protein, which is capable of destroying a gamete. In some embodiments, the second peptide sequence comprises the long form of the wtf 4 protein, which is capable of rescuing a gamete from the first (short form) of the wtf 4 protein.
[0058] In some embodiments, the recombinant DNA sequence encodes the first and second peptide sequences as distinct genes having separate regulatory sequences (e.g. promoter, enhancer, terminator) and separate open reading frame (e.g. protein coding region and intron). In some embodiments, the regulatory sequences of the distinct genes comprises one or more of a constitutive promoter, tissue-specific promoter, developmental stage-specific promoter, inducible promoter, or a synthetic promoter. In some embodiments, the promoter is selected for expression of the first and second peptide sequence in a specific organism. In some embodiments, Eukaryotic promoters include, but are not limited to, one or more of CMV, EF1a, SV40, PGK1, CAG, TRE, UAS, Ac5, and Polyhedrin.
[0059] In some embodiments, the recombinant DNA sequence encodes the first and second peptide sequence as a single gene that results in more than one protein product. For example, in some embodiments, the recombinant DNA sequence is continuously transcribed but produces the first and second peptides as distinct proteins. In some embodiments, the recombinant DNA sequence comprises an internal ribosomal entry site (IRES), which results in more than one protein product from a single transcript.
[0060] The present disclosure also provides a vector or analogous construct comprising the recombinant DNA sequences described above and heterologous DNA sequences. As used herein, the term heterologous DNA sequences and grammatical versions thereof means a sequence of DNA that does not naturally occur in the context in which it is present. For example, a vector may comprise DNA sequences from one or more organisms that do not naturally occur together. Those sequences may comprise, without limitation, promoters, ribosomal binding sites, start codons, termination codons, and transcription termination sequences from one or more organisms.
[0061] The present disclosure also provides a method of propagating a recombinant DNA sequence in a diploid organism's offspring comprising the steps of expressing the recombinant DNA sequence in the diploid organism, wherein the DNA sequence encodes a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete of the organism and the second peptide sequence capable of rescuing a gamete of the organism from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the recombinant DNA sequence; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA sequence; and permitting reproduction of the organism.
[0062] As used herein, the term propagating a recombinant DNA sequence in a diploid organism's offspring and grammatical versions thereof means that the recombinant DNA sequence is caused to be over represented in the gametes which are formed, which results in over representation (e.g., higher than expected according to Mendelian genetics) of the recombinant DNA sequence in the next generation of the organism. In this manner, the recombinant DNA sequences are able to spread through a population of an organism during reproduction.
[0063] According to some embodiments, a method of propagating a recombinant DNA sequence in a diploid organism's offspring comprises the steps of expressing the recombinant DNA sequence in the diploid organism, wherein the DNA sequence encodes a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete of the organism and the second peptide sequence capable of rescuing a gamete of the organism from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA sequence; and permitting reproduction of the organism.
[0064] According to some embodiments, a method of propagating a recombinant DNA sequence in a diploid organism's offspring comprises the steps of expressing the recombinant DNA sequence in the diploid organism, wherein the DNA sequence encodes a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete of the organism and the second peptide sequence capable of rescuing a gamete of the organism from the first peptide sequence; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the recombinant DNA sequence; and wherein the recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having the recombinant DNA sequence; and permitting reproduction of the organism.
[0065] According to some embodiments, the recombinant DNA sequence does not naturally occur in the diploid organism. According to some embodiments, the recombinant DNA sequence is adapted to integrate into the genome of the diploid organism.
[0066] In some embodiments, the first and second peptide sequence may be encoded by any meiotic drive gene that, when expressed in a diploid organism, is capable of biasing offspring of such organism to express such gene and other genes that may be operatively linked to such genes. For example, the first peptide sequence may be SEQ ID NOs.: 1 and/or 3 or orthologs thereof. And, for example, the second peptide sequence may be SEQ ID NOs.: 2 and/or 4 or orthologs thereof. In addition, according to some embodiments, the first peptide sequence has at least 70% identity to SEQ ID NO: 1. According to some embodiments, the first peptide sequence has at least 80% identity to SEQ ID NO: 1. According to some embodiments, the first peptide sequence has at least 90% identity to SEQ ID NO: 1. According to some embodiments, the second peptide sequence has at least 70% identity to SEQ ID NO: 2. According to some embodiments, the second peptide sequence has at least 80% identity to SEQ ID NO: 2. According to some embodiments, the second peptide sequence has at least 90% identity to SEQ ID NO: 2.
[0067] According to some embodiments, the first peptide sequence has at least 70% identity to SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 80% identity to SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 90% identity to SEQ ID NO: 3. According to some embodiments, the second peptide sequence has at least 70% identity to SEQ ID NO: 4. According to some embodiments, the second peptide sequence has at least 80% identity to SEQ ID NO: 4. According to some embodiments, the second peptide sequence has at least 90% identity to SEQ ID NO: 4.
[0068] The present disclosure also provides a meiotic drive composition comprising a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; and a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
[0069] The term operably linked refers to the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is regulated by the other or is not hindered by the other. For example, a promoter is operably linked with a coding sequence when it is capable of regulating the expression of that coding sequence (i.e., that the coding sequence is under the transcriptional control of the promoter). Coding sequences can be operably linked to regulatory sequences in a sense or antisense orientation. In another example, two proteins can be operably linked, such that the function of either protein is not compromised. Generally, operably linked means that the nucleic acid sequences being linked are contiguous and, where necessary to join two protein coding regions, contiguous and in the same reading frame. In addition, the term operatively linked and grammatical versions thereof means that two or more sequences are inherited together more than 50% of the time. For example, two or more DNA sequences may be located in close proximity to one another on a chromosome such that it is unlikely the two sequences will be separated during the process of homologous recombination. In this regard, according to some embodiments, two or more DNA sequences are inherited together more than 60% of the time. According to some embodiments, two or more DNA sequences are inherited together more than 70% of the time. According to some embodiments, two or more DNA sequences are inherited together more than 80% of the time. According to some embodiments, two or more DNA sequences are inherited together more than 90% of the time.
[0070] As used herein, the term gene of interest and grammatical versions thereof includes, without limitation, genetic tags, selection genes (e.g. anti-biotic resistance genes), or any other, gene or nucleotide sequence or fragment thereof, that confers a desired phenotype. The gene of interest may be from the same or different organism as the first DNA sequence or may be a synthetic construct. In some embodiments, the gene of interest is a gene that confers infertility to an animal that carries one or more copies. In some embodiments, the gene of interest is effective to cause a crash in the population of a disease vector (e.g. mosquitos) by reducing the population's reproductive capacity.
[0071] According to some embodiments, a meiotic drive composition comprises a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; and a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
[0072] According to some embodiments, a meiotic drive composition comprises a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; and a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
[0073] According to some embodiments, the first recombinant DNA sequence does not naturally occur in the diploid organism. According to some embodiments, the second recombinant DNA sequence does not naturally occur in the diploid organism.
[0074] According to some embodiments, the first recombinant DNA sequence and/or second recombinant DNA sequence is adapted to integrate into the genome of the diploid organism.
[0075] The present disclosure also provides a vector or analogous construct comprising the first recombinant DNA sequence and/or second recombinant DNA sequence as described above and one or more heterologous DNA sequences.
[0076] According to some embodiments, the second recombinant DNA sequence may be linked to the first recombinant DNA sequence via proximity of the first and second recombinant DNA sequences on a chromosome.
[0077] According to some embodiments, the second recombinant DNA sequence may be adjacent to the first recombinant DNA sequence and there is continuous transcription of the first and second recombinant DNA sequences.
[0078] As used herein, the term continuous transcription of recombinant DNA sequences and grammatical versions thereof means that the recombinant DNA sequences are organized into a single transcriptional unit and are transcribed into a continuous transcript. According to some embodiments, the continuous transcript is translated into a continuous amino acid sequence. According to some embodiments, the continuous transcript is translated into two or more amino acid sequences. For example, in some embodiments, an adjacent DNA sequence comprises an internal ribosomal entry site (IRES), resulting in production of two or more proteins from a single transcript.
[0079] In some embodiments, the first and second peptide sequence may be encoded by any meiotic drive gene that, when expressed in a diploid organism, is capable of biasing offspring of such organism to express such gene and other genes that may be operatively linked to such genes. For example, the first peptide sequence may be SEQ ID NOs.: 1 and/or 3 or orthologs thereof. And, for example, the second peptide sequence may be SEQ ID NOs.: 2 and/or 4 or orthologs thereof. In addition, according to some embodiments, the first peptide sequence has at least 70% identity to SEQ ID NO: 1. According to some embodiments, the first peptide sequence has at least 80% identity to SEQ ID NO: 1. According to some embodiments, the first peptide sequence has at least 90% identity to SEQ ID NO: 1. According to some embodiments, the second peptide sequence has at least 70% identity to SEQ ID NO: 2. According to some embodiments, the second peptide sequence has at least 80% identity to SEQ ID NO: 2. According to some embodiments, the second peptide sequence has at least 90% identity to SEQ ID NO: 2.
[0080] According to some embodiments, the first peptide sequence has at least 70% identity to SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 80% identity to SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 90% identity to SEQ ID NO: 3. According to some embodiments, the second peptide sequence has at least 70% identity to SEQ ID NO: 4. According to some embodiments, the second peptide sequence has at least 80% identity to SEQ ID NO: 4. According to some embodiments, the second peptide sequence has at least 90% identity to SEQ ID NO: 4.
[0081] The present disclosure also provides a method of propagating one or more recombinant DNA sequences in a diploid organism's offspring comprising the steps of (i) expressing in the organism a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; (ii) expressing in the organism a second recombinant DNA sequence linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; and (iii) permitting reproduction of the organism; wherein the first recombinant DNA sequence, when expressed in the organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
[0082] According to some embodiments, a method of propagating one or more recombinant DNA sequences in a diploid organism's offspring comprises the steps of: (i) expressing in the organism a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; and (ii) expressing in the organism a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; and (iii) permitting reproduction of the organism; wherein the first recombinant DNA sequence, when expressed in the organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
[0083] According to some embodiments, a method of propagating one or more recombinant DNA sequences in a diploid organism's offspring comprising the steps of: (i) expressing in the organism a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; (ii) expressing in the organism a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; and (iii) permitting reproduction of the organism; wherein the first recombinant DNA sequence, when expressed in the organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence.
[0084] According to some embodiments, the first recombinant DNA sequence does not naturally occur in the diploid organism. According to some embodiments, the second recombinant DNA sequence does not naturally occur in the diploid organism.
[0085] According to some embodiments, the first recombinant DNA sequence and/or second recombinant DNA sequence is adapted to integrate into the genome of the diploid organism.
[0086] According to some embodiments, the second recombinant DNA sequence is operably linked to the first recombinant DNA sequence via, e.g., proximity of the first and second recombinant DNA sequences on a chromosome. According to some embodiments, the second recombinant DNA sequence is, e.g., adjacent to the first recombinant DNA sequence and there is continuous transcription of the first and second recombinant DNA sequences.
[0087] In some embodiments, the first and second peptide sequence may be encoded by any meiotic drive gene that, when expressed in a diploid organism, is capable of biasing offspring of such organism to express such gene and other genes that may be operatively linked to such genes. For example, the first peptide sequence may be SEQ ID NOs.: 1 and/or 3 or orthologs thereof. And, for example, the second peptide sequence may be SEQ ID NOs.: 2 and/or 4 or orthologs thereof. In addition, according to some embodiments, the first peptide sequence has at least 70% identity to SEQ ID NO: 1. According to some embodiments, the first peptide sequence has at least 80% identity to SEQ ID NO: 1. According to some embodiments, the first peptide sequence has at least 90% identity to SEQ ID NO: 1. According to some embodiments, the second peptide sequence has at least 70% identity to SEQ ID NO: 2. According to some embodiments, the second peptide sequence has at least 80% identity to SEQ ID NO: 2. According to some embodiments, the second peptide sequence has at least 90% identity to SEQ ID NO: 2.
[0088] According to some embodiments, the first peptide sequence has at least 70% identity to SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 80% identity to SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 90% identity to SEQ ID NO: 3. According to some embodiments, the second peptide sequence has at least 70% identity to SEQ ID NO: 4. According to some embodiments, the second peptide sequence has at least 80% identity to SEQ ID NO: 4. According to some embodiments, the second peptide sequence has at least 90% identity to SEQ ID NO: 4.
[0089] The present disclosure also provides a kit comprising: (1) a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; (2) a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence; and (3) reagents for expressing the first recombinant DNA sequence and/or the second recombinant DNA sequence in the diploid organism.
[0090] In addition to the above components, the subject kits will further include instructions for use of the components and/or practicing the subject methods. These instructions may be present in the subject kits in a variety of forms, one or more of which may be present in the kit. One form in which these instructions may be present is as printed information on a suitable medium or substrate, such as a piece or pieces of paper on which the information is printed, in the packaging of the kit, or in a package insert. Yet another means would be a computer readable medium, such as diskette, or CD, on which the information has been recorded. Further, another means by which the instructions may be present is a website address used via the internet to access the information at a removed site. Any convenient means may be present in the kits.
[0091] The components of the kits may be packaged either in aqueous media or in lyophilized form. The kits will generally be packaged to include at least one vial, test tube, flask, bottle, syringe or other container means, into which the described reagents may be placed, and preferably, suitably aliquoted. Where additional components are provided, the kit will also generally contain a second, third or other additional container into which such component may be placed.
[0092] The kits of the present disclosure will also typically include a means for containing the reagent containers in close confinement for commercial sale. Such containers may include injection or blow-molded plastic containers into which the desired vials are retained.
[0093] According to some embodiments, a kit comprises: (1) a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence and the second peptide sequence are derived from alternative transcriptional start sites on the first recombinant DNA sequence; (2) a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence; (3) reagents for expressing the first recombinant DNA sequence and/or the second recombinant DNA sequence in the diploid organism.
[0094] According to some embodiments, a kit comprises: (1) a first recombinant DNA sequence encoding a first peptide sequence and a second peptide sequence, the first peptide sequence capable of destroying a gamete and the second peptide sequence capable of rescuing a gamete from the first peptide sequence; wherein the first peptide sequence is transported outside of a cell and the second peptide sequence is not transported outside of a cell; (2) a second recombinant DNA sequence operably linked to the first recombinant DNA sequence, wherein the second recombinant DNA sequence encodes a gene of interest; wherein the first recombinant DNA sequence, when expressed in a diploid organism, is effective to bias offspring toward having both the first recombinant DNA sequence and the second recombinant DNA sequence; and (3) reagents for expressing the first recombinant DNA sequence and/or the second recombinant DNA sequence in the diploid organism.
[0095] In some embodiments, the first and second peptide sequence may be encoded by any meiotic drive gene that, when expressed in a diploid organism, is capable of biasing offspring of such organism to express such gene and other genes that may be operatively linked to such genes. For example, the first peptide sequence may be SEQ ID NOs.: 1 and/or 3 or orthologs thereof. And, for example, the second peptide sequence may be SEQ ID NOs.: 2 and/or 4 or orthologs thereof. In addition, according to some embodiments, the first peptide sequence has at least 70% identity to SEQ ID NO:1 or SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 80% identity to SEQ ID NO:1 or SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 90% identity to SEQ ID NO:1 or SEQ ID NO: 3. According to some embodiments, the first peptide sequence has at least 70% identity to SEQ ID NO:2 or SEQ ID NO: 4. According to some embodiments, the first peptide sequence has at least 80% identity to SEQ ID NO: 2 or SEQ ID NO: 4. According to some embodiments, the first peptide sequence has at least 90% identity to SEQ ID NO: 2 or SEQ ID NO: 4.
TABLE-US-00001 SEQIDNO: AminoAcidSequence SEQIDNO:1 MLSEIWKYIKTVSEDSSTGPTETTNPNVERRQEFKDSHPNIYSLLRL LISVLAVIVVFFTAWVCVNPLEKSIFGKVAFFVTIGITCPILLITIFCFF ETWTQAVAQCIKVTVIFLAQCVKVTAVGLYNSREKWVVIIWLLWV VICYTLFLRSKFGNLNLNKALICSTCSISAALLLFLLYVRLPFWTLKH MFSGLFQVLGVQSCVVIVTKGLTYLFDKHIDATGYEIEASSLFVIGN FLFFYEMECPGALKRMPKFIRNGIASFLEGIGNIGRAFRGANDNNDI PLGEMEVESEV SEQIDNO:2 MKNKDYPLRSSMDELSTKNDNEIDLEKGPLPEYNSEDESTLPPYSEI WKYIKTVSEDSSTGPTETTNPNVERRQEFKDSHPNIYSLLRLLISVL AVIVVFFTAWVCVNPLEKSIFGKVAFFVTIGITCPILLITIFCFFETWT QAVAQCIKVTVIFLAQCVKVTAVGLYNSREKWVVIIWLLWVVICY TLFLRSKFGNLNLNKALICSTCSISAALLLFLLYVRLPFWTLKHMFS GLFQVLGVQSCVVIVTKGLTYLFDKHIDATGYEIEASSLFVIGNFLF FYEMECPGALKRMPKFIRNGIASFLEGIGNIGRAFRGANDNNDIPLG EMEVESEV SEQIDNO:3 MGQNITKLFNWNKSTTPPDYDENRLPITDEGNNPPNTHRENHSSGT ADNSSPFLIKLIISFTPIFVLNVPAVCYLTYKDALFKDYGKDEWVYF GVWCAICLMSFISLWCFYETWTKAVKVTVIFLAQCVKVTVIFLAQC VKVTAIFSAQCIKVTVISLAKCVKVIAVGLYNSKKDLVVTIWLAWV VICFILFGCVKDGRLNLNKALICSTSSISAALFFILLLVCIPIWTLKHM LFGLFQVLGVQSCVVIVTKGLMYLFDKHIDATGYEIEASSLFVIGNF LFFYEMERPGALKRMPKFIRNGIASFLGGIANAFGGIANAIRGANDN NDIPLGEMEVESEV SEQIDNO:4 MKNKYYPLRSSMDELSTKNDNEIDLEKGPLPEYNSEDGNTLPPYSE NINLKDPKQMGQNITKLFNWNKSTTPPDYDENRLPITDEGNNPPNT HRENHSSGTADNSSPFLIKLIISFTPIFVLNVPAVCYLTYKDALFKDY GKDEWVYFGVWCAICLMSFISLWCFYETWTKAVKVTVIFLAQCVK VTVIFLAQCVKVTAIFSAQCIKVTVISLAKCVKVIAVGLYNSKKDLV VTIWLAWVVICFILFGCVKDGRLNLNKALICSTSSISAALFFILLLVCI PIWTLKHMLFGLFQVLGVQSCVVIVTKGLMYLFDKHIDATGYEIEA SSLFVIGNFLFFYEMERPGALKRMPKFIRNGIASFLGGIANAFGGIAN AIRGANDNNDIPLGEMEVESEV
[0096] The present disclosure provides Sk wtf4 as an autonomous gamete-killing meiotic drive gene. Data show that Sk wtf4 generates two transcripts from alternate start sites: a long transcript encoding an antidote and a short transcript encoding a gamete-killing poison. Whereas the poison protein is found in all the gametes, the antidote protein is enriched only in the gametes encoding Sk wtf4, thereby ensuring that gametes that do not inherit the selfish allele are destroyed. This gene is a member of the large, rapidly evolving wtf gene family that has 25 members in Sp. The present disclosure provides that wtf4 is not the only driver amongst wtfs. According to some embodiments, a novel mechanism by which meiotic drivers can act is used to bias the meiotic driver alone or with one or more genes of interest into a population of an organism.
[0097] The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting. As used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise.
[0098] The following examples are provided to further illustrate the methods of the present invention. These examples are illustrative only and are not intended to limit the scope of the invention in any way.
Example 1
Materials and Methods
Crosses
[0099] For the mapping crosses, fertility and meiotic drive assays, the crosses were carried out similar to the description in (18). This required making stable diploids, because many of the strains used are homothallic (h90) and their self-mating would generate many non-informative spores. Briefly, 200 L of overnight culture from each haploid parent were mixed in a microcentrifuge tube, spun down and plated on either SPA (1% glucose, 7.3 nM KH.sub.2PO.sub.4, vitamins, agar) or MEA (3% malt extract, agar) for 12-15 hours at room temperature to allow the cells to mate. No differences were observed in meiotic drive phenotypes for diploids generated on SPA vs. MEA. SPA was generally used, but for some matings there was more success isolating stable diploids from MEA. The mated cells were scraped off and spread on a medium to select heterozygous diploids (generally minimal yeast nitrogen base plates). Diploid colonies were grown overnight in 5 mL of rich YEL broth (0.5% yeast extract, 3% glucose, 250 mg/L of adenine, lysine, histidine, and uracil). A small amount of the cultures <100 L were then plated onto SPA to induce sporulation, and a diluted sample plated onto YEA (same as YEL, but with agar). The colonies that grew on the YEA plate were screened via replica plating to diagnostic media to verify that the culture was comprised of heterozygous diploid cells. If not, the culture was not assayed further. After 3-7 days, the mixture of cells, asci, and spores from the SPA plates were scooped up, treated with glusulase and ethanol to kill vegetative cells and to release spores from asci and the spores were plated on YEA. The spore colonies were then phenotyped using standard approaches. For some control loci, heterozygosity in the diploid test described above could not be easily verified. For those loci heterozygosity of the parent diploid in the progeny was verified. If the parent diploid proved not to be heterozygous, the diploid was eliminated. For each cross, at least two independently created diploids were assayed. The number of progeny scored varied between experiments. To map Sk wtf4, at least 100 viable progeny per cross were assayed. To characterize Sk wtf4, at least 200 viable gametes per cross were assayed. The one exception was the Sk wtf4.sup.poison/Sk wtf4.sup.antidote cross in which allele transmission by PCR and sequencing (described below) was used to assay. For that cross, 50 viable progeny were assayed. The raw data underlying the major crosses are presented in Table I and Table II.
TABLE-US-00002 TABLE I control % allele 1 % allele 1 # progeny p value for % # diploids loci (CONTROL) drive loci % disomy (excluding disomes) assayed allele 1 assayed Diploid allele 1 ura4-wtt4 allele 2 ura4-wtt4 ade+ ade NAT NAT
# SZY# GENOTYPE SZY# GENOTYPE 11 661
MX
702
163 112 59.27 238 37 8
.55 275 1.8E08 4 12 8
2
MX
702
186 155 54.
225 116 65.98 341 8.9E04 4 Diploid allele 1 ura4-wtt4 allele 2 ura4-wtt4 lys+ lys NAT
NAT
ura4+ # SZY# GENOTYPE SZY# GENOTYPE NAT
13 661
MX
180
269 247 52.13 229 287 21 4.07 44.38 51
control 7 Diploid allele 1 ura4-wtt4 allele 2 ura4-wtt4 lys+ lys ura+ ura ura4+ # SZY# GENOTYPE SZY# GENOTYPE NAT
14 871
876
MX
131 118 52.61 231 18 5 2.01
2.77 249 9.6E10 2 15 863
MX
876
MX
132 117 53.01 139 110 55.82 249 0.084 2 Diploid allele 1 ade6 allele 2 ade6 ura+ ura ade+ ade ade+ # SZY# GENOTYPE SZY# GENOTYPE
418
1
925
empty vector
kanMX4 44
214 123 36.5 164 173 11 3.16 51.34 337 control 3 GFP 958
kanMX4
43
234 147 81.42 18 363 20 4.99 95.28 381
.0E09 3 diploid 17 887
kanMX4 44
188 225 54.48 17 396 13 3.05 95.88 413
.8E08 2 Diploid allele 1 ade6 allele 2 ade6 ura+ ura HY
HY
HY
# SZY# GENOTYPE SZY# GENOTYPE
418
18 1064
MX4 887
kanMX4 130 99 58.77 114 115 20 8.032 49.78 229 0.835 2 Diploid allele 1 ade6 allele 2 ade6 ura+ ura ade+ ade ade+ # SZY# GENOTYPE SZY# GENOTYPE
418
19 1044
kanMX4 44
130 96 42.48 23 203 8 2.5
89.82 226 3.0E0
2 20 1033
kanMX4 44
191 144 42.99 181 154 10 2.9 45.97 335 0.413 2 22 1051
kanMX4 44
318 180 33.47 304 174 16 3.24 3
.4 478 7.
E03 3 Diploid allele 1 ade6 allele 2 ade6 ura+ ura HY
HY
HY
# SZY# GENOTYPE SZY# GENOTYPE
418
21 1084
MX4 1033
kanMX4 124 77 61.69 108 93 27 11.84 53.73 201 0.78 2 23 1064
MX4 1051
kanMX4 132 69 65.
7 194 7 30 12.99 96.
2 201 3.
2 Diploid allele 1 ade6 allele 2 ade6 ura+ ura antidote+ antidote # SZY# GENOTYPE SZY# GENOTYPE (sequenced) (sequenced) 24 1110
kanMX4 1051
kanMX4 42 8 84 44 6 88 50 0.018 3 Diploid allele 1 ade6 allele 2 ade6 ura+ ura ade+ ade ade+ # SZY# GENOTYPE SZY# GENOTYPE
418
25 1035
kanMX4 44
157 114 42.07 28 243 14 4.93 89.67 271 1.3E05 2 27 1049
GFP
kanMX4 44
122 128 51.2 110 340 17
.37 56 2
0 8.538 2 Diploid allele 1 ade6 allele 2 ade6 ura+ ura HY
HY
HY
# SZY# GENOTYPE SZY# GENOTYPE
418
26 1064
MX4 1035
kanMX4 151
9.5
105 112 27 11.07 48.3
217 0.696 2 28 1064
MX4 1049
GFP
kanM4 119 81 59.5 183 17 26 11.5
1.5 200 2.9E06 2
indicates data missing or illegible when filed
TABLE-US-00003 TABLE II # PI- # PI- stained excluding % PI- Diploid allele 1 ura4-wtt44 allele 2 ura4-wtt44 spores spores excluding # sci # diploids # SZY# GENOTYPE SZY# GENOTYPE (dead) (alive) spores assayed p-value assayed 11
1
MX
702
103 429 80.
4 133 2.22E1
2 12 8
2
MX
702
13 283 95.
1 74 0.0194 2 Diploid allele 1 ura4-wtt44 allele 2 ura4-wtt44 # SZY# GENOTYPE SZY# GENOTYPE 13
1
MX
180
22 2
2 92.03 71 control 3 Diploid allele 1 ura4-wtt44 allele 2 ura4-wtt44 # SZY# GENOTYPE SZY# GENOTYPE 14 871 876
MX
204 59.19
8 2.22E1
3 15 8
3
MX
876
MX
25 299 92.4 81 0.984 3 Diploid allele 1 ade6 allele 2 ade6 # SZY# GENOTYPE SZY# GENOTYPE 1
925
empty vector
kanMX4 44
29 771 96.38 200 control 2 GFP 958
kanMX4
43
232 276 54.33 127 2.22E1
2 diploid 17 887
kanMX4 44
352 416
4.2
192 2.22E1
3 Diploid allele 1 ade6 allele 2 ade6 # SZY# GENOTYPE SZY# GENOTYPE 18 1064
MX4 887
kanMX4 7 217 96.88 56 0.682 2 Diploid allele 1 ade6 allele 2 ade6 # SZY# GENOTYPE SZY# GENOTYPE 19 1044
kanMX4 44
144 188 56.79 83 2.22E1
2 20 1033
kanMX4 44
20 896 97.82 229 0.01189 2 22 1051
kanMX4 44
244 40 14.09 71 2.22E1
2 Diploid allele 1 ade6 allele 2 ade6 # SZY# GENOTYPE SZY# GENOTYPE 21 1064
MX4 1033
kanMX4 14 222 94.08 59 0.08 3 23 1064
MX4 1051
kanMX4 88 116 56.88 51 2.22E1
2 Diploid allele 1 ade6 allele 2 ade6 # SZY# GENOTYPE SZY# GENOTYPE 24 1110
kanMX4 1051
kanMX4 122 106 44.55 57 2.22E1
3 Diploid allele 1 ade6 allele 2 ade6 # SZY# GENOTYPE SZY# GENOTYPE 26 1035
MX4 44
27 104
GFP
MX4 44
41
409 49.6 20
2.22E1
3 Diploid allele 1 ade6 allele 2 ade6 # SZY# GENOTYPE SZY# GENOTYPE 2
1064
MX4 1035
kanMX4 29 1064
MX4 1049
kanMX4 182 222 54.98 101 2.22E1
2
indicates data missing or illegible when filed
[0100] Table I shows raw data of allele transmission from
Mapping the Sk Wtf4 Region
[0101] All strains used and their genotypes can be found in Table III. Table III shows the various yeast strains. The ura4-X allele (e.g. SZY382) listed in the table is either ura4-D18 or ura4-294. The wtf4::kanMX4(truncated drug S) allele is described in the methods. It does not confer resistance to G418. The precise location of the ura4.sup.+ allele in strain SZY863 is unknown. It is not at the endogenous locus, although it is closely linked to the endogenous locus. The ade6-::gene1::gene2::ade6-allele naming structure is used in many strains. This indicates that a plasmid derived from pSZB188 bearing two genes (e.g. wtf4 and kanMX4) was integrated into the ade6.sup.+ locus. This recombination event generates two mutant copies of ade6 flanking the contents of the plasmid. The Skwtf4(357A>T, 358T>A, 359G>C) nomenclature denotes that the ATG sequence beginning at position 357 of the wtf4 gene has been changed to TAC. This is the ATG within what is intron 1 of the antidote that used as the start codon for the poison transcript. The Skwtf4(M1X,M12X) nomenclature denotes that the first two methionines in the antidote coding sequence have been mutated to stop codons (TAG).
TABLE-US-00004 TABLE III Strain Species Genotype SZY44 Sp h-, lys4-95 SZY120 Sk h90, rec12::ura4+, ura4::kanMX4 SZY80 Sk h90, lys1::kanMX4 SZY192 Sk h90, rec12::ura4+, ura4::kanMX4, his5::natMX4MX4 SZY196 Sk h90, rec12::ura4+, ura4::kanMX4, lys1::kanMX4 SZY201 Sp h-, lys1-37, rec12-171::ura4+, ura4-x SZY208 Sk h90, rec12::ura4 , ade6::hphMX4, his5::natMX4, ura4::kanMX4 SZY210 Sk h90, ade6::hphMX4, his5::natMX4, ura4::kanMX4 SZY239 hybrid with Sk h-, rec12::ura4+, ade6::hphMX4, ura4::kanMX4, karyotype SZY247 hybrid with Sk h?, rec12::ura4 , lys1-37, his5::natMX4, ura4-x, karyotype SZY320 Sk h90, ura4::natMX4 SZY382 hybrid with Sk h-, rec12::ura4 , lys1-37, ura4-x karyotype SZY547 hybrid with Sk h-, rec12::ura4 , lys1-37, ura4-x, arg12:hphMX4 karyotype SZY558 hybrid with Sk h90, rec12::ura4 , his5::natMX4, ura4-x, arg12::natMX4 karyotype SZY562 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4-x, ade6::hphMX4 SZY563 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4-x, ade6::hphMX4 SZY564 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4-x, ade6::hphMX4 SZY565 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4-x, ade6::hphMX4 SZY566 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4-x, ade6::hphMX4 SZY567 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4-x, ade6::hphMX4 SZY574 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4-x, ade6::hphMX4 SZY581 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4-x SZY582 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4-x SZY589 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4::kanMX4 SZY591 hybrid with Sk hybrid chr3, Sk chr1 and chr2. h90, rec12::ura4+, karyotype his5::natMX4, ura4::kanMX4 SZY643 Sp h90, leu1-32, ura4-D18 SZY649 hybrid with Sk h90, rec12::ura4+, ura4-x, ade6::hphMX4 karyotype SZY659 hybrid with Sk h90, rec12::ura4+, ura4-x, ade6::hphMX4, kanMX4@chr3 karyotype position 214,500 bp SZY661 Sk h90, ura4::natMX4, leu1::hphMX4 SZY679 hybrid with Sk ura4::natMX4, kanMX4@chr3 position 214500 bp, karyotype ade6::hphMX4, rec12::ura4+ SZY684 hybrid with Sk ura4::natMX4, kanMX4@chr3 position 214500 bp, karyotype ade6::hphMX4, rec12::ura4+ SZY685 hybrid with Sk ura4::natMX4, kanMX4@chr3 position 214500 bp, karyotype ade6::hphMX4, rec12::ura4+ SZY686 hybrid with Sk ura4::natMX4, kanMX4@chr3 position 214500 bp, karyotype ade6::hphMX4, rec12::ura4+ SZY702 hybrid with Sk h90, ura4-x, ade6::hphMX4 karyotype SZY862 Sk h90, wtf4 :kanMX4truncation(drugS), ura4::natMX4, leu1::hphMX4 SZY863 Sk h90, wtf4::kanMX4truncation(drugS), ura4::natMX4, leu1::hphMX4, ura4+ SZY871 Sk h90, leu1::hphMX4 SZY873 Sk h90, ura4::natMX4 SZY876 Sk h90, ura4::natMX4, lys1::kanMX4, wtf4::kanMX4(truncated drug S) SZY887 Sp h90, leu1-32, ura4-D18, ade6::Skwtf4::kanMX4::ade6 SZY925 Sp h90, leu1-32, ura4-D18, ade6::kanMX4::ade6 SZY960 Sp h90, leul-32, ura4-D18, ade6::Skwtf4-GFP::kanMX4::ade6 SZY958 Sp h-, lys4-95, ade6::Skwtf4-GFP::kanMX4::ade6 SZY1030 Sp h?, hht1-RFP::kanMX6, lys1-37 SZY1033 Sp h90, leu1-32, ura4-D18, ade6::Skwtf4(357A > T, 358T > A, 359G > C)::kanMX4::ade6 SZY1035 Sp h90, leu1-32, ura4-D18, ade6::mCherry5Xglycine- Skwtf4::kanMX4::ade6 SZY1044 Sp h90, leu1-32, ura4-D18, ade6::Skwtf28::kanMX4::ade6 SZY1049 Sp h90, leu1-32, ura4-D18, ade6::Skwtf4(M1X, M12X)- GFP::kanMX4::ade6 SZY1051 Sp h90, leu1-32, ura4-D18, ade6::Skwtf4(M1X, M12X)::kanMX4::ade6 SZY1064 Sp h-, lys4-95, ade6::Skwtf4::hphMX4::ade6 SZY1072 Sp h90, ura4-D18, leu1-32, hht1-RFP::kanMX4, ade6::Skw tf4::hphMX4::ade6+ SZY1095 Sp h-, lys4-95, ade6::Skwtf4-GFP::kanMX4::ade6, his5::ade6+ SZY1110 Sp h-, ade6::Skwtf4(357A > T, 358T > A, 359G > C)::kanMX4::ade6, lys4-95 SZY1140 Sp h90, hht1-CFP::hphMX4, his3-D1 SZY1142 Sp h90, ura4-D18, his5::ade6+, lys1-37, ade6::mCherry5Xglycine-Skwtf4::kanMX4::ade6
[0102] Sequencing data from all high-throughput sequencing was deposited to GenBank accession number PRJNA376152. A drive allele present on Sk chromosome 3 was first chosen to map via recombination mapping. To eliminate the effects of drivers and gross chromosome rearrangements from chromosomes 1 and 2, the mapping effort was begun using a strain (SZY558) that contains chromosomes 1 and 2 from Sk, but in which most of chromosome 3 was derived from Sp (the mosaic chromosome illustrated in
[0103] The generation of SZY558 is described in
[0104] For mapping Skwtf4, SZY558 was crossed to a differentially marked Sk strain (SZY210) to generate recombinant haploid progeny (introgression stains) that contained a smaller fraction of chromosome 3 from Sp (
[0105] SZY565 (the haploid parent that contributed the mosaic chromosome 3 to diploid 1 in
[0106] To narrow in on the key drive locus, SZY565 to SZY196 (Sk) were crossed to get a strain (SZY649) with the same chromosome 3 as SZY565, but with his5.sup.+ rather than his5::natMX4 on chromosome 2. The ura4 locus, at position 116,726-115,589 on chromosome 3, is within the Sp-derived region. An additional marker (kanMX4) was added within the Sp-derived region at position 214,491 to generate strain SZY659. To do this, plasmid pSZB134 was first generated which contains 1 kb of DNA (amplified from Sp genomic DNA with oligos 380 and 381) upstream of the target site (214,491) cloned into the BamHI and BglII sites of pFA6a, and 1 kb of DNA (amplified with oligos 382+383) downstream of the target site cloned into the SacI and SpeI sites of the pFA6a (40). The transformation cassette was released from pSZB134 via NotI digest and used to make SZY659.
[0107] SZY659 was then crossed to a differentially marked Sk strain (SZY320; rec12.sup.+) and screened for haploid progeny that had experienced a crossover within the Sp-derived region between the ura4::natMX4 allele from SZY320 and the kanMX4 allele in SZY659 (
[0108] Table IV shows the various plasmid contructs.
TABLE-US-00005 TABLE IV plasmids short description reference pFA6 contains kanMX4 40 pAG32 contains hphMX4 39 pSZB134 contains cassette to target kanMX to position 214,491 in Sp chr 3 this work pSZB184 pMZ283 expressing guide RNA to target wtf4 this work pMZ222 contains Cas9 44 pMZ283 empty vector for expressing Cas9 guide RNA 44 pSZB136 contains cassette to generate leu1::hphMX4 this work pKT127 contains yEGFP 30 pSZB188 derivative of pFA6a that integrates at ade6, yielding ade6- this work pSZB189 pSZB188 with Sk wtf4 cloned into SacI site this work pSZB209 pSZB188 with Sk wtf21 and wtf26 cloned into SacI site this work pSZB212 pSZB188 with Sk wtf2 cloned into SacI site this work pSZB217 pSZB188 with Sk wtf5 cloned into SacI site this work pSZB215 pSZB188 with Sk wtf6 and wtf28 cloned into SacI site this work pSZB252 pSZB188 with Sk wtf6 cloned into SacI site this work pSZB254 pSZB188 with Sk wtf28 cloned into SacI site this work pSZB203 pSZB188 with Sk wtf4-GFP cloned into SacI site this work pSZB204 pSZB188 with Sk wtf4-GFP cloned into SacI site this work pSZB215 pSZB188 with Sk wtf6 and wtf28 cloned into SacI site this work pSZB246 pSZB188 with Sk wtf4antidote (ATG to TAC at nucleotide this work position 356) cloned into SacI site pSZB244 pSZB188 with Sk wtf4 (ATG to TAG at nucleotide position 1) this work cloned into SacI site pSZB248 pSZB188 with Sk mCherry-wtf4 cloned into SacI site this work pSZB252 pSZB188 with Sk wtf6 cloned into SacI site this work pSZB254 pSZB188 with Sk wtf28 cloned into SacI site this work pSZB257 pSZB188 with Sk wtf4poison (ATG to TAG at nucleotide this work position 1 and ATG to TAG at position 34)-GFP cloned into SacI site pSZB258 pSZB188 with Sk wtf4poison (ATG to TAG at nucleotide this work position 1 and ATG to TAG at position 34) cloned into SacI site pAG25 contains natMX4 39
Sequencing of the Sk Wtf4 Locus
[0109] Using oligos MESZ176 and MESZ177, the region corresponding to the wtf3+wtf4 locus in Sp was amplified from Sk genomic DNA. The product amplified is at least 1.5 kb smaller than the corresponding product from Sp. The PCR product was then sequenced using oligos 557, 560, 565, 566, 567, 568, 569, 570, 595, 597, 598, 599, 601, 602, and 603, and assembled a 2,943 bp contig. This sequence has been deposited to GenBank, accession number KY652738. A BLAST search was performed comparing the Sk sequence contig to all Sp protein sequences and got Sp wtf13 and wtf4 as top hits. The Sk region contains only one wtf-like gene, whereas the Sp region has the complete wtf4 gene and the wtf3 pseudogene. As the Sk gene appears to be orthologous to Sp wtf4 based on synteny and sequence similarity, the gene was named Sk wtf4.
[0110] The Sp PacBio meiotic transcriptome sequences were used to predict intron/exon boundaries in Sk wtf4 (29). wtf genes are not well-represented in the splice isoform summary tables generated for the Kuang et al. study due to the very high nucleotide identity between wtf paralogs and stringent filtering of multiply-mapping reads. Therefore the Iso-Seq data was re-mapped to the Sp reference genome assembly using GMAP (41), reporting only alignments with 99% identity and covering >99% of the length of the isoform sequence, and using the parameter --suboptimal-score 20 to reduce secondary matches (this parameter choice successfully eliminates cross-mapping between wtf4 and wtf13). IGV (42) was used to visualize splice isoforms for each gene. These data reveal a coding sequence that is slightly different from that of the currently annotated Sp wtf4 gene (http://www.pombase.org/spombe/result/SPCC548.03c). The long form of Sk wtf4 has six predicted exons and encodes a 337 amino acid protein with 82% amino acid identity to the 366 amino acid protein encoded by Sp wtf4. The TMHMM model predicts six transmembrane helices with high probability (>80%) and one with lower probability (<50%) (43).
[0111] Table V shows the various sequencing oligonucleotides.
TABLE-US-00006 TABLEV SEQID Oligo Sequence(5.fwdarw.3) NO: 255 TATTACATCAGTGCGCTATCAGTTTAAAAGGTTGGGCCTACTAACTTAA SEQID CATATA NO:5 CTACACCTCAAGAAAAAGAAAGAACACATACGATTTAGGTGACAC 256 TTTGCACAGCAGAAATTTGATTATTGCTTGGCTCAAGTACATGGTGAGT SEQID ATGACA NO:6 TTATTATTGAGAACGACCTGGCATAATACGACTCACTATAGGGAG 380 GTCGGATCCCATTCGTTATCGTTCCAAGTGTGCTGCCGTCG SEQID NO:7 381 GTCAGATCTCTGTTTTGGAAACTTTTTTATCCTCTAACGATGACGATAAA SEQID TTTAC NO:8 382 GTCGAGCTCAATACAGGTAAATGGTCTAAATCAGTATGTAAGCC SEQID NO:9 383 GTCACTAGTGCTATGATTCCGGGAATTGATGTTTCTTCTGAC SEQID NO:10 413 CTCTGAAGACGCAGGTAGTAAAAAACCCG SEQID NO:11 414 GTGAGTATGTACCTTCAATACACCCTTGATG SEQID NO:12 557 CTGCGTAGCTGACATGTTATTGCGATAAC SEQID NO:13 560 GCATTGCTTGAAAGATTCTGCGATGTTGG SEQID NO:14 565 GGTTAGAGTAAATTACAGGAATATATAACGAACCC SEQID NO:15 566 GGGTTCGTTATATATTCCTGTAATTTACTCTAACC SEQID NO:16 567 CTACCTTGCCGAATATCGACTTCTCCAAC SEQID NO:17 568 GTTGGAGAAGTCGATATTCGGCAAGGTAG SEQID NO:18 569 CTGAACGAGGCAGTGGATTGCTTCTG SEQID NO:19 570 CAGAAGCAATCCACTGCCTCGTTCAG SEQID NO:20 571 GTTATGATGGAGAACCCGGAAATTAGAGGC SEQID NO:21 572 GTGTCACCTAAATCGTATGTGGGGAACAGAAATAAACAAGTCTAAAGT SEQID GCC NO:22 573 CTCCCTATAGTGAGTCGTATTAAACTGCGTAGCTGACATGACACTGAAT SEQID TTC NO:23 574 CCAGGCAACATCCATTCTCATCAGATGAGG SEQID NO:24 575 ATTTCTGTTCCCCACATACGATTTAGGTGACAC SEQID NO:25 576 CAGCTACGCAGTTTAATACGACTCACTATAGGGAG SEQID NO:26 577 CATTTTCACAAATGGTTCGAGT SEQID NO:27 578 TCGAACCATTTGTGAAAATGTT SEQID NO:28 MESZ176 TGGTTAAGCATGTGATCTTCATACGACGC SEQID NO:29 MESZ177 AGAAATTCAGTGTCATGTCAGCTACGCAG SEQID NO:30 588 ATGAGCGAAAAACAGGTTGTAGGGATC SEQID NO:31 589 GGTACCTGACCTGAATTGTGAGGCCGAGG SEQID NO:32 590 CCATAGCAGCCAAAAGGGAGGGTTG SEQID NO:33 591 CACAATTCAGGTCAGGTACCCAACACCCAACTCTCGACTTCCAC SEQID NO:34 595 GGGTTGTAATGTTACCTATCACTAATATAGCTC SEQID NO:35 597 GCTTAATTATCATTTTTTCCATTTGTTTAATGGTTTAC SEQID NO:36 598 CGGGTAAGTAAAGAATCATTCATACAGTTGG SEQID NO:37 599 CCGCTAACACGCAGTTCGTCTTCC SEQID NO:38 601 CCCTTCTGAGACTACTAATATCAGTTCTTG SEQID NO:39 602 GGAATCGAGTCAGCAGTTGTTATCAACGGG SEQID NO:40 603 CCCGTTGATAACAACTGCTGACTCGATTCC SEQID NO:41 604 CTGAATATGGAGGCAATGTGCTCTCATC SEQID NO:42 605 ATGAAGAATAAAGATTATCCCTTGAGGTCGTCTATGG SEQID NO:43 606 TAAACCAGCACCGTCACCGACTTCGCTTTCAACTTCCATTTCCCCC SEQID NO:44 607 GGGGGAAATGGAAGTTGAAAGCGAAGTCGGTGACGGTGCTGGTTTA SEQID NO:45 619 AATATAGGAGCTCTGGTTAAGCATGTGATCTTCATACGACGC SEQID NO:46 620 AATATAGGAGCTCAGAAATTCAGTGTCATGTCAGCTACGCAG SEQID NO:47 633 AATATAGAGCTCAGAAATTCAGTGTCATGTCAGCTACGCAG SEQID NO:48 634 AATATAGAGCTCCGGGGACGAGGCAAGCTAAAC SEQID NO:49 643 AATATAGAGCTCAATGCTTCAAAATAATTTTGTAAATCATGTTATGCCG SEQID NO:50 644 AATATAGAGCTCTCTATCACAAAAAAGGTTGCAGCGGAGC SEQID NO:51 647 AATATAGAGCTCCGGCTACTGATAATTGCCTTGCACTCTTC SEQID NO:52 648 AATATAGAGCTCCGAATTGAGTTTGTAGGAAGAAACAAAGTTCC SEQID NO:53 649 AATATAGAGCTCGGCTCTTCGATGCAAAGTAAGGTAAGTAGTTG SEQID NO:54 650 AATATAGAGCTCCATCTCTAAACCCGTATTTGGTAGAAACGGC SEQID NO:55 651 AATATAGAGCTCCCGAAGTATCATATCAACGTAGTACACCATG SEQID NO:56 652 AATATAGAGCTCGGAGGCAAAGCCAAACGTTCTAGC SEQID NO:57 686 AATATAGGAGCTCTATAATAGATCACAAAGGAAAACTCGCCGCAG SEQID NO:58 687 AATATAGGAGCTCCTGCGTAGCTTACATGTTATTGCGATAACATTTCG SEQID NO:59 701 GTGTATATCATTCAATAATAGATTGTTTTTAAGAATAGAAGAATAAAGA SEQID TTATCCC NO:60 702 GGGATAATCTTTATTCTTCTATTCTTAAAAACAATCTATTATTGAATGAT SEQID ATACAC NO:61 732 AATATAGAGCTCGCGTTATTAATGTAGTTGTCGCTACAGTTGG SEQID NO:62 733 AATATAGAGCTCCTTCTTATTCACCCCAACTTAGATTTCCTTATGCATC SEQID NO:63 735 CCAAATTTCAAAAGTTATTTATTTTATTATACCTTTCAGAAATTTGGAAA SEQID TATATTAAAACTGTATCTGAAG NO:64 736 CTTCAGATACAGTTTTAATATATTTCCAAATTTCTGAAAGGTATAATAAA SEQID ATAAATAACTTTTGAAATTTGG NO:65 739 GTACTCAATTCATCCtTAAGACGACCTCAAGGG SEQID NO:66 740 CCCTTGAGGTCGTCTTAGGATGAATTGAGTAC SEQID NO:67 795 AAATGGAATGCCCATCCTGATCTTAACTTG SEQID NO:68 796 TCCCTACAACCTGTTTTTCGCTCAT SEQID CGTGATGCAAAACTACTCTTTTCAATTAGA NO:69 797 AAAGTTGGTTGGAAAAATTATTCTGCATAG SEQID AGATGAATTGGATTATGTCAGGAAAAGAAC NO:70 798 GTGAACGATTAGGGACGAATTATCAACTGT SEQID NO:71 799 TCTAATTGAAAAGAGTAGTTTTGCATCACGATGAGCGAAAAACAGGTTG SEQID TAGGGA NO:72 800 GTTCTTTTCCTGACATAATCCAATTCATCTCTATGCAGAATAATTTTTCC SEQID AACCAACTTT NO:73 A01112 TAACGCCGCCATCCAGTGTCG SEQID NO:74 678 GCCGAATATCGACTTCTCCAACGGG SEQID NO:75 861 GCCCTGTTAGACGAATTTATGCTCGTAATATGTC SEQID NO:76
Generation of Sk Wtf4 Mutants
[0112] To generate the Sk wtf4 mutant, the CRISPR-Cas9 system was used after first failing to generate the mutant via the standard homologous recombination approach (36). This system requires the starting strain to be ura4.sup. and leu1.sup.. A Sk mutant (SZY661) was generated in which leu1 was replaced with hphMX4 in strain SZY320 by first cloning a leu1::hphMX4 cassette (pSZB136). This plasmid was made by first cloning leu1.sup.+ (amplified from Sk genomic DNA with oligos 413 and 414) into pFA6a cut with NdeI and ClaI and blunted with Klenow fragment of DNA polymerase I. This new vector was then cut with ClaI and NdeI (within leu1) and blunted with Klenow: the hphMX4 cassette liberated from pAG32 with PvuII and ClaI was ligated into the gap (39). Oligos 413 and 414 were used again to amplify the leu1::hphMX4 cassette for transformation.
[0113] To generate plasmid pSZB184, which encodes a guide RNA targeting the Sk wtf4 region, oligos 577 and 578 were annealed and cloned into the CspCI site of pMZ283 (44). Overlap-PCR was used to generate a repair cassette containing 1 kb of homology upstream and downstream of the Sk wtf4 region flanking the kanMX4 cassette from pFA6a (40). The products of PCRs generated with oligos 571 and 572, 575 and 576, and 573 and 574 were stitched together to make the repair cassette. Strain SZY661 was then transformed with pMZ222, pSZB184, and the repair cassette. Ura.sup.+Leu.sup.+ transformants were screened containing both plasmids for wtf4 deletions via PCR and sequencing. It was found that strain SZY862 contained a deletion of wtf4, but unexpectedly was not resistant to G418. Sequencing of the region revealed a truncation of the kanMX4 gene. SZY863 contains the same deletion as SZY862, but is Ura.sup.+ due to retention of the ura4.sup.+ cassette from pSZB184 at an unknown location closely linked to the endogenous ura4 locus, although the strain retains the ura4::natMX4 allele at the endogenous ura4 locus.
Generation of the Ade6-Targeted Constructs
[0114] First generated was pSZB188, a plasmid containing the kanMX4 selectable marker and a mutant ade6 allele that has 5, central, and 3 deletions. This vector can be cut with KpnI within the mutant ade6 gene and then integrated into ade6.sup.+ to generate Ade.sup.G418-resistant transformants. Other genes can be added to the vector to introduce them into the genome at the ade6 locus. To construct pSZB188, first a mutant ade6 cassette was made via overlap PCR stitching a PCR product made from oligos 588 and 589 to one made from oligos 591 and 590. This ade6 cassette was then digested with BamHI and XhoI and cloned into the BamHI and SalI sites of pFA6a (40). The Sk wtf4 region was cloned into pSZB188 by first amplifying the region with oligos 619 and 620. The PCR product was digested with SacI and cloned into the SacI site of pSZB188 to generate pSZB189. KpnI-digested pSZB189 was introduced into yeast and transformants were selected on YEA with G418 plates. Red colonies were picked, as proper integrants should harbor a mutant ade6 allele flanking the sides of the plasmid sequence. The duplicated ade6 gene makes the locus unstable and Ade.sup.+ revertants that have popped out all plasmid-derived sequences are readily obtained.
[0115] The Sk wtf4-GFP allele was made using overlap PCR. The promoter region from Sk genomic DNA was amplified using oligos 633 and 604 and the open reading frame sequence using oligos 605 and 606. pKT127 was used as a template to amplify yEGFP using oligos 607 and 634 (30). The three PCR products were then stitched together using overlap PCR. The resulting cassette was cut with SacI and cloned into the SacI site of pSZB188 to generate pSZB204. This construct was integrated at ade6 as described above.
[0116] For the Sk wtf4.sup.antidote allele, using overlap PCR, the two PCR products generated with oligo pairs 735 and 686, and 620 and 736, both using pSZB189 as a template, were stitched together. The stitched PCR product was cloned into the SacI site of pSZB188 to generate pSZB246. pSZB246 was then cut and introduced into yeast as described above.
[0117] The Sk wtf4.sup.poison allele was generated using overlap PCR. Sk wtf4 has two in-frame start codons in the annotated exon 1. Mutating the first start codon had no phenotype (data not shown), so both were mutated. To mutate the first start codon, overlap PCR was used to stitch together two PCR products made by oligo pairs 701 and 686, and 620 and 702; both reactions used pSZB189 as a template. The stitched PCR product was cloned into the SacI site of pSZB188 to generate pSZB244. pSZB244 was used as a template to mutate the second start codon via overlap PCR. PCR fragments generated by oligo pairs 620 and 739, and 686 and 740 were stitched together and cloned into the SacI site of pSZB188 to generate pSZB258. pSZB258 was cut and introduced into yeast as described above.
[0118] The Sk mCherry.sup.antidote-wtf4 allele was cloned using overlap PCR. First was purchased, from IDT (Coralville, Iowa), a synthetic double-stranded DNA gene block including the Sk wtf4 promotor, the mCherry coding sequence (28), five glycine codons, and the first part of Sk wtf4 exon 1. That fragment was amplified with oligos 620 and 604 and then stitched to another that contained the rest of the Sk wtf4 gene amplified with oligos 605 and 687 from plasmid pSZB189. That product was then cloned into the SacI site of pSZB188 to generate pSZB248, which was cut and introduced into yeast as described above.
[0119] For the Sk wtf4.sup.poison-GFP allele, the 5 end of the gene was amplified with oligos 620 and 739 using plasmid pSZB244 as a template. The 3 end of the gene was amplified with oligos 740 and 634 using pSZB203 as a template. Overlap PCR was then used to stitch those PCR fragments together and the product was cloned into the SacI site of pSZB188 to generate pSZB257, which we cut and introduced it into yeast as described above.
[0120] The same strategy was used to integrate other Sk wtf genes into Sp. Sk genomic DNA was used as a template to amplify wtf2l+wtf26 with oligos 643 and 644, wtf2 with oligos 647 and 648, wtf5 with oligos 649 and 650, and wtf6+wtf28 with oligos 651 and 652. Each cassette was cut with SacI and cloned into the SacI site of pSZB188 to generate: pSZB209 (wtf21+wtf26), pSZB212 (wtf2), pSZB217 (wtf5), and pSZB215 (wtf6+wtf28). Sk wtf6 and Sk wtf28 were subcloned from pSZB215 by first amplifying the individual genes using oligo pairs 732+652 and 651+733, respectively. The genes were then cloned into the SacI site of pSZB188 to generate pSZB252 (wtf6) and pSZB254 (wtf28). All sequences of these genes have been deposited in GenBank, accession numbers KY652739-KY652742. These constructs were all integrated at ade6 as described above.
Assaying Allele Transmission in wtf4.sup.poison/wtf.sup.antidote Diploid
[0121] Because the alleles wtf4.sup.poison (SZY1051) and wtf4.sup.antidote (SZY1110) are marked with the same drug marker, to score transmission of alleles for this cross, sequencing was used. Diploids and spores were generated as described above. Spores were then plated on YEA, the colonies picked to a YEA master plate and replicated to score control markers. Lysates for PCR from the master plate were also prepared by scraping cells off the master plate into 20 l of 20 mM NaOH. The cells were boiled for 5 minutes, frozen in liquid nitrogen, boiled again for 10 minutes, and then the debris spun down. Using the supernatant lysate, the wtf4 region was amplified using oligos A01112 and 678. The exon 1 region was then sequenced using oligo 861, and analyzed for the start codon mutations mentioned above (
Introducing Ade6.SUP.+ at His5
[0122] To avoid ade6.sup. mutant auto-fluorescence in cytology, ade6.sup.+ at the his5 locus was introduced. A region upstream of his5 was amplified to generate piece A using oligo pair 795 and 796. A region downstream of his5 was amplified to generate piece C using oligo pair 797 and 798, and to amplify ade6.sup.+, piece B was generated using oligo pair 799 and 800. Pieces A, B and C were stitched together using oligo pair 795 and 798 and the product introduced into yeast.
Cytology
[0123] For the fertility assay, 5-10 l of propidium iodide (PI, 1 mg/ml) was added to 50 l of H.sub.2O, and the yeast scraped from the SPA plate into the PI mix. The yeast plus PI mixture was incubated at room temperature for 20 minutes. Images were taken on a Zeiss Observer Z1 wide-field microscope with a 40 (1.2 NA) water-immersion objective and the emission collected onto a Hamamatsu ORCA Flash 4.0 using Manager software. The PI images were acquired with BP 530-585 nm excitation and LP 615 emission, using an FT 600 dichroic filter.
[0124] For all other fluorescence microscopy, images were taken on a LSM-700 AxioObserver microscope (Zeiss), with a 40 C-Apochromat water-immersion objective (NA 1.2), with 488 and 555 nm excitation. GFP fluorescence was collected through a 490-55 nm bandpass filter and mCherry fluorescence through a 615 nm longpass filter. The continuously variable secondary dichroic filter was positioned at 578 nm. Images were also taken using a LSM-780 (Zeiss) microscope, with a 40 C-Apochromat water-immersion objective and 100 alpha Plan-Apochromat oil-immersion objective (NA 1.2 and 1.46, respectively), in photon-counting channel mode with 488 and 561 nm excitation. GFP fluorescence was collected through a 481-552 bandpass filter and mCherry through a 572 longpass filter. For all images acquired on the LSM-780 (Zeiss) microscope, using the same objectives as described above, images were also acquired in photon-counting lambda mode, with 488 and 561 nm excitation. Fluorescence emission was collected over the entire visible range. After acquisition, the images were linear unmixed using an in-house custom written plugin for ImageJ (https://imagej.nih.gov/ij/). Unmixing was achieved using spectra obtained from control cells. Unmixing was performed to verify that there was no auto-fluorescence in the cells (
Example 2
Results
Genetic Mapping Reveals a Complex Landscape of Drive Loci and Modifiers
[0125] To study meiotic drive in fission yeast, haploids were mated to generate diploids, the diploids induced to undergo meiosis and allele transmission into the gametes monitored using genetic markers. In Sk/Sp hybrid diploids, drive of loci on all three Sk chromosomes is due to the preferential death of gametes inheriting the corresponding Sp alleles (18) (
[0126] To genetically map a drive locus on chromosome 3, it was beneficial to generate a strain with Sk chromosomes 1 and 2, but Sp chromosome 3. Because Sp and Sk have different karyotypes on chromosomes 1 and 2 due to translocation (18), such a strain could not be generated as it would lack essential genes. Instead, a haploid strain with an Sk karyotype containing Sk chromosomes 1 and 2 and most, but not all, of chromosome 3 derived from Sp was generated (see
[0127] Three phenotypic classes were observed amongst our introgression diploids (diploids 1-8,
[0128] The finding of three distinct phenotypic classes amongst the introgression diploids (diploids 1-8) is inconsistent with the simple model of a single drive locus on Sk chromosome 3. A single gene model predicts two phenotypic classes: 1) introgression diploids in which the pure Sk chromosome exhibits drive because the Sk/Sp mosaic chromosome lacks the Sk drive allele and 2) introgression diploids in which the chromosomes show Mendelian transmission because the Sk/Sp mosaic contains the Sk drive allele.
[0129] Instead, the data is more consistent with the presence of a meiotic drive allele (or alleles) found on both Sk and Sp chromosome haplotypes and the existence of at least one genetically separable drive suppressor. The drive of the Sk/Sp mosaic chromosome over the pure Sk chromosome in class 2 (diploids 4-7) is consistent with the presence of an Sp drive allele in these strains. The full effects of this Sp drive locus could have been missed previously in Sk/Sp hybrid crosses due to the actions of an Sp drive suppressor not found in the class 2 introgressions (18).
[0130] Similar to what we previously observed in crosses between pure Sk/Sp hybrids (both rec12.sup.+ and rec12), we found that viable gametes produced by diploids of all three classes frequently inherited both alleles at the ade6 locus (
[0131] The high level of chromosome 3 aneuploidy and/or diploidy observed in the viable progeny of Sk/Sp hybrid crosses and our introgression diploids (1-8) is also consistent with the existence of both Sk and Sp active meiotic drive loci. It was previously shown in Sk/Sp hybrids that this phenotype was not due to elevated chromosome missegregation in meiosis, but rather preferential death of haploid gametes (18). As was proposed previously, this phenotype could result from distinct competing Sk and Sp driver loci on chromosome 3 (18, 21). In the absence of recombination, a given haploid gamete can inherit only the Sk or Sp drive locus and is thus sensitive to being killed by the one it does not inherit. Heterozygous diploids and heterozygous aneuploids, however, would inherit both loci and be resistant to both killers.
[0132] To map driver location(s) from the phenotypic data described above, the haplid strains were sequenced that contributed the Sk/Sp mosaic chromosomes to the introgression diploids (diploids 1-8) and combined genotype information with the phenotypic data described above. It was determined which regions of chromosome 3 were derived from Sk and which were from Sp in each strain (
[0133] To verify the candidate drive locus using a recombination-competent (rec12.sup.+) diploid, we generated introgression diploid 11 which contains the same Sk/Sp mosaic chromosome as diploid 1, but is rec12.sup.+. To follow the transmission of the candidate locus, a closely linked marker gene was needed, so we engineered heterozygous markers at the linked ura4 locus (Table I). It was found that the ura4 allele from the pure Sk chromosome is transmitted to 87% of the viable gametes produced by diploid 11, which is not significantly different from the 88% transmission of the Sk allele in diploid 1 (
[0134] To test whether the transmission bias observed in diploid 11 might be caused by increased cell death amongst gametes inheriting the Sp locus, propidium iodide (PI) was used to stain the meiotic sacs (asci) that hold the spores. PI efficiently stains dead cells that have lost their membrane integrity but fails to stain viable cells (
Example 3
Sk Wtf4 is a Meiotic Drive Locus
[0135] Near the center of the Sk 30 kb candidate region is wtf4 (
[0136] To test if Sk wtf4 is a meiotic drive gene, Sk wtf4 was deleted (Sk wtf4) in a pure Sk background and that haploid mated to one containing the same Sk/Sp mosaic found in diploid 11 (
Example 4
[0137] Sk Wtf4 Drive is Consistent with a Poison/Antidote Mechanism
[0138] There are two known means by which gamete-killers act to eliminate competing alleles (5, 26). Under one model, meiotic drivers kill gametes containing a particular target locus (7). For example, the Segregation Distorter (SD) system in Drosophila melanogaster kills sperm bearing an expansion of the Responder satellite DNA (12, 27). The second model is a poison/antidote model in which a gamete killing entity (the poison) is encoded at a position that is closely linked to that encoding a second substance (the antidote) which specifically protects gametes that inherit the drive locus. For example, the unidentified rfk gene (required for killing) acts as a poison and the rsk gene (resistance to spore killing) gene acts as an antidote in the Spore killer-2 drive locus from Neurospora intermedia (16, 28).
[0139] It was first tested if Sk wtf4 acts analogously to SD to kill gametes that inherit a particular Sp chromosomal locus. To test this idea, the effect of deleting Sk wtf4/Sk wtf4.sup.+ heterozygosity in a pure Sk strain background was analyzed (diploid 14,
[0140] The results are, however, consistent with a poison/antidote model of meiotic drive. The phenotype of the Sk wtf4/Sk wtf4 heterozygote (
[0141] To further test the idea that Sk wtf4 encodes an autonomous poison/antidote drive locus, the gene was moved to a nave genome and tested to determine if it could induce drive. Sk wtf4 was integrated into the Sp genome at the ade6 locus, which is unlinked to the endogenous wtf4 locus. An Sp diploid that is hemizygous for Sk wtf4 (Sk wtf4/ade6) produces fewer viable spores (54% PI-excluding spores, versus 96% in the vector-only control) and showed a marked transmission bias (96%) favoring Sk wtf4.sup.+ (
Example 5
[0142] Sk Wtf4 Generates a Poison and an Antidote from Alternate Transcripts
[0143] It was hypothesized that Sk wtf4 encodes two products to achieve drive (
[0144] To test the feasibility of this model, the localization of Sk Wtf4-GFP was investigated in Sp diploids induced to undergo meiosis (30). The gene was c-terminally tagged to visualize proteins generated by both the putative Sk wtf4 isoforms; this tag does not interfere with Sk wtf4's ability to function as a drive allele (see data for GFP diploid in
[0145] It was hypothesized that the diffuse Wtf4-GFP localization in the ascus corresponded to the poison whereas the enrichment within the mature spores might reflect the localization of the antidote. If this hypothesis is correct, Wtf4-GFP should be enriched in the two spores that inherit the chromosome carrying Sk wtf4-GFP. Consistent with this idea, it was observed in stained asci from Sk wtf4-GFP/ade6 diploids with PI that the surviving PI-negative spores (95% of which inherit Sk wtf4-GFP) are indeed those with the strong Wtf4-GFP signal (
[0146] To further test the poison-antidote model, alleles were generated that could produce only the poison or only the antidote. First, the start codon was mutated (ATG to TAC) that is present only in the putative short transcript. The results suggest that this mutant allele retains the antidote function but no longer functions as a poison: this allele is called Sk wtf4.sup.antidote (
[0147] Next a Sk wtf4.sup.poison allele was generated by mutating the two putative start codons (ATG to TAG) found in exon 1 of the long transcript (
[0148] To confirm that the toxicity of the Sk wtf4.sup.poison allele was due to its lacking the Sk wtf4 antidote, Sk wtf4.sup.poison/Sk wtf4.sup.+ heterozygotes were generated. As expected, the spores that inherited the complete Sk wtf4.sup.+ gene from these diploids were immune to Sk wtf4.sup.poison toxicity, while those that inherit Sk wtf4.sup.poison die (
[0149] As a final test of the model, the separated poison and antidote mutant alleles were brought back together in one diploid, but on opposite haplotypes. If they function as expected, it is predicted that the Sk wtf4.sup.poison spores will die but the spores that inherit the Sk wtf4.sup.antidote will survive. This was indeed the case. Only 45% of the spores produced by Sk wtf4.sup.antidote/Sk wtf.sup.poison heterozygotes can exclude PI stain and 88% of the surviving gametes inherit the Sk wtf4.sup.antidote allele (
Example 6
The Sk Wtf4 Poison is Trans-Acting, Whereas the Wtf4 Antidote is Gamete-Specific
[0150] Next, the localization patterns of the antidote and poison polypeptides were specifically determined. To visualize the antidote peptide, an Sk mCherry.sup.antidote-wtf4 allele (
[0151] To observe the localization of the poison peptide, a Sk wtf4.sup.poison-GFP allele was generated (
Example 7
[0152] Expansion and Rapid Evolution of the Wtf Family is Consistent with a Role in Meiotic Drive
[0153] It was hypothesized that if Sk wtf4 is not unusual amongst the wtf genes in its ability to drive, meiotic drive could explain the driving force behind the expansion of the wtf gene family (23). The large number of wtfs could also explain the complex drive landscape revealed in our recombination mapping (
[0154] Six Sk wtf genes (wtf2, wtf5, wtf6, wtf28, and wtf21 plus wtf26 together) were cloned and tested for evidence of meiotic drive. As for the tests of Sk wtf4, the above Sk wtf genes were integrated at the ade6 locus of Sp, which disrupted the ade6.sup.+ gene. Those haploids were then mated to ade6.sup.+ to generate heterozygous diploids and the transmission of the Sk wtf gene(s) into viable progeny was monitored using the heterozygous ade6 markers. Five of the six genes had no observable drive phenotype. Sk wtf2 was transmitted to 47% (n=114) of progeny, Sk wtf5 was transmitted to 44% (n=454), Sk wtf6 was transmitted to 51% (n=471) and the combination of Sk wtf21 and wtf26 (cloned and integrated together) was transmitted to 46% (n=111). However, like Sk wtf4, Sk wtf28 caused strong drive (90% transmission bias and only 57% of spores excluded PI;
[0155] The sequences of each of these Sk wtfs were also compared to the Sp wtf genes at the syntenic loci. wtf26 and wtf28 are not found in Sp, so have either been lost in Sp, or gained in Sk since divergence. While Sk wtf2 is a 1,036 bp full length gene, Sp wtf2 is likely a 388 bp pseudogene (it has a large deletion relative to other wtf genes and multiple in-frame stop codons). Sk wtf21 is likely a pseudogene (multiple in frame stop codons) whereas Sp wtf21 is intact. The two loci share 83% DNA sequence identity. The wtf5 gene is intact in both species, and the loci share 99% DNA sequence identity and 97% amino acid identity. Sp and Sk wtf6 share 82% nucleotide identity, but only 74% amino acid identity. Altogether, the wtf loci show much greater sequence divergence than the 99.5% genome average identity between Sp and Sk. Such rapid evolution is a hallmark of genes involved in genetic conflicts, such as loci involved in causing or suppressing meiotic drive (25, 26, 33).
[0156] Intriguingly, the Sk wtf28 drive gene is also the only one of the six genes tested that also has a putative alternate start codon in exon two that could be used to make a short putative short poison isoform. Additionally, Hu et al. (34) also identified two different wtf drivers in another Sp isolate (CBS5557) and both have a potential alternate start codon in exon 2. Of the 25 wtf loci in Sp, four (wtf4, wtf13, wtf19 and wtf23) also appear to be capable of encoding two proteins and it is predicted that these are active drive genes. In contrast, the intact genes tested that did not confer drive, Sk wtf2, wtf5, wtf6, and wtf26, all encode genes similar to the antidote isoform of Sk wtf4 but appear to lack a shorter poison isoform. Together, the results shown here and those of Hu et al. (34) are consistent with the hypothesis that the ancestral function of the wtf family is to confer meiotic drive.
Example 8
Sk Wtf4 Uses Distinct Transcripts to Encode a Meiotic Drive System
[0157] The present disclosure demonstrates that Sk wtf4 is a novel, gamete-killing meiotic drive locus. The present disclosure shows that wtf4 achieves these disparate functions by a previously undescribed mechanism in which the gene encodes a poison protein from one transcriptional start site and an antidote protein from an alternative transcriptional start site. Also shown, is that the poison protein is trans-acting and has the capacity to destroy all gametes, but that the antidote remains in the gametes that inherit the wtf4 locus and specifically rescues them from destruction.
[0158] The poison-antidote mechanism of Sk wtf4 is comparable to the bacterial toxin-antitoxin (TA) systems. These systems are found in most prokaryotes and have been extensively studied. TA systems consist of a toxin that will prevent cell growth or viability and an antitoxin that neutralizes the toxin using a wide variety of mechanisms, typically being classified into six different types (35). Interestingly, some toxins are stable, transmembrane proteins that act by disrupting membrane integrity and are counteracted by either an unstable small RNA (35, 36) or a protein that degrades the toxin mRNA (37). In the poison-antidote meiotic drive system disclosed here, Sk wtf4 creates two putative transmembrane proteins: a trans-acting poison and spore-specific antidote. While the exact mechanism of toxicity of Wtf4.sup.poison is unknown, it is hypothesize that it could be disrupting membrane integrity in a similar manner to the membrane-lytic toxins of some TA systems (35, 36). In contrast, it is speculated that Wtf4.sup.antidote protects the spores that inherited Sk wtf4 by sequestering the poison for degradation. The spore specificity of Wtf4.sup.antidote could be due to late translation or a spore retention signal within exon 1, because that is the only region that Wtf4.sup.poison is lacking. In addition, work by Hu et al. suggests that the C-termini of Wtf proteins may be more important for the poison than for the antidote functions, despite both proteins being generated by a single given wtf gene sharing a common C-terminus (34).
[0159] Outside of its role in meiotic drive, wtf4 has no apparent role in promoting fertility (
[0160] The evolution of wtf4 elicits the question of how the gene can rapidly evolve while maintaining specificity between the poison and antidote it encodes. Uncoupling these components leads to sterility, an evolutionary dead-end. It is possible that such variants do arise and are quickly purged from populations. The present disclosure provides that the coding sequence overlap between the poison and antidote could promote specificity between the two components, e.g., by the antidote acting as a dominant suppressor of the poison. In this manner, the poison could diverge without losing the self-protection conferred by the antidote. Using a shared sequence to confer specificity between drive components may be a recurring theme amongst gamete-killers.
[0161] The present disclosure provides that the varied phenotypes of our Sp chromosome 3 introgressions reveal a complex landscape of meiotic drive loci in the Sk and Sp genomes (15). As Sk wtf4 is a member of the large wtf gene family, the most likely candidates underlying these drive phenotypes are wtf genes. Consistent with the idea that the Sk wtf4 drive phenotype is not unique, it is shown that Sk wtf28 can also cause drive.
[0162] Although not all wtfs are capable of autonomously causing meiotic drive, their rapid evolution is still consistent with their involvement in meiotic drive (23). The present disclosure provides that different wtf genes represent distinct evolutionary stages. The putative ancestral type (Sk wtf4 and wtf28) are still active as meiotic drivers and encode both poison and antidote proteins. The next stratum represent genes (Sk wtf2, wtf5, wtf6 and wtf26) that have lost poison, but not antidote function. As shown for the Sk wtf4.sup.antidote allele, such alleles are unlikely to cause meiotic drive as they have lost their poison-coding capacity, but they still have protective function against the ancestral drive allele and thus may have been selectively retained as domesticated parasites. Over time, when the protective function is no longer beneficial and selected for (e.g., if the ancestral drive allele is lost from the population), such antidote genes may also eventually degenerate. Therefore, the final stratum represents putative wtf pseudogenes such as Sk wtf21, in which both the poison and antidote function have decayed.
[0163] There are 25 wtf loci in the Sp genome and the present disclosure provides that these genes cause and or modify meiotic drive (23, 24). Meiotic drive has therefore played a significant role in the evolution of the Sp group of fission yeasts, in despite the heavy fitness costs these selfish loci can levy.
[0164] The embodiments described in this disclosure can be combined in various ways. Any aspect or feature that is described for one embodiment can be incorporated into any other embodiment mentioned in this disclosure. While various novel features of the inventive principles have been shown, described and pointed out as applied to particular embodiments thereof, it should be understood that various omissions and substitutions and changes can be made by those skilled in the art without departing from the spirit of this disclosure. Those skilled in the art will appreciate that the inventive principles can be practiced in other than the described embodiments, which are presented for purposes of illustration and not limitation.
CITED DOCUMENTS
[0165] The following documents, to the extent they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference. [0166] 1. M. E. Thoma et al., Prevalence of infertility in the United States as estimated by the current duration approach and a traditional constructed approach. Fertil Steril 99, 1324-31 e1321 (2013). [0167] 2. L. Segurel, E. M. Leffler, M. Przeworski, The case of the fickle fingers: how the PRDM9 zinc finger protein specifies meiotic recombination hotspots in humans. PLoS Biol 9, e1001211 (2011). [0168] 3. D. C. Presgraves, The molecular evolutionary basis of species formation. Nat Rev Genet 11, 175-80 (2010). [0169] 4. N. A. Johnson, Hybrid incompatibility genes: remnants of a genomic battlefield? Trends Genet 26, 317-25 (2010). [0170] 5. A. K. Lindholm et al., The Ecology and Evolutionary Dynamics of Meiotic Drive. Trends Ecol Evol 31, 315-26 (2016). [0171] 6. L. Sandler, E. Novitski, Meiotic Drive as an Evolutionary Force. The American Naturalist 91, 105-110 (1957). [0172] 7. J. F. Crow, Why is Mendelian segregation so exact? Bioessays 31, 305-12 (1991). [0173] 8. J. P. Didion et al., A multi-megabase copy number gain causes maternal transmission ratio distortion on mouse chromosome 2. PLoS Genet 11, e1004850 (2015). [0174] 9. C. S. Ottolini et al., Genome-wide maps of recombination and chromosome segregation in human oocytes and embryos show selection for maternal recombination rates. Nat Genet 47, 727-35 (2015). [0175] 10. P. Grognet et al., Genes that bias Mendelian segregation. PLoS Genet 10, e1004387 (2014). [0176] 11. A. Burt, R. Trivers, Genes in conflict: the biology of selfish genetic elements. (Belknap Press of Harvard University Press, Cambridge, Mass., 2006), pp. viii, 602 p., 608 p. of plates. [0177] 12. A. M. Larracuente, D. C. Presgraves, The selfish Segregation Distorter gene complex of Drosophila melanogaster. Genetics 192, 33-53 (2012). [0178] 13. H. Bauer et al., The nucleoside diphosphate kinase gene Nme3 acts as quantitative trait locus promoting non-Mendelian inheritance. PLoS Genet 8, e1002567 (2012). [0179] 14. H. Bauer, N. Veron, J. Willert, B. G. Herrmann, The t-complex-encoded guanine nucleotide exchange factor Fgd2 reveals that two opposing signaling pathways promote transmission ratio distortion in the mouse. Genes Dev 21, 143-147 (2007). [0180] 15. H. Bauer, J. Willert, B. Koschorz, B. G. Herrmann, The t complex-encoded GTPase-activating protein Tagap1 acts as a transmission ratio distorter in mice. Nat Genet 37, 969-973 (2005). [0181] 16. T. M. Hammond, D. G. Rehard, H. Xiao, P. K. Shiu, Molecular dissection of Neurospora Spore killer meiotic drive elements. Proc Natl Acad Sci USA 109, 12093-12098 (2012). [0182] 17. N. Rhind et al., Comparative functional genomics of the fission yeasts. Science 332, 930-936 (2011). [0183] 18. S. E. Zanders et al., Genome rearrangements and pervasive meiotic drive cause hybrid infertility in fission yeast. Elife 3, e02630 (2014). [0184] 19. A. T. Avelar, L. Perfeito, I. Gordo, M. G. Ferreira, Genome architecture is a selectable trait that can be maintained by antagonistic pleiotropy. Nat Commun 4, 2235 (2013). [0185] 20. N. Phadnis, R. W. Hyppa, G. R. Smith, New and old ways to control meiotic recombination. Trends Genet 27, 411-421 (2011). [0186] 21. K. Bomblies, Cheaters divide and conquer. Elife 3, e03371 (2014). [0187] 22. A. Moore, C. J. Donahue, K. D. Bauer, J. P. Mather, Simultaneous measurement of cell cycle and apoptotic cell death. Methods Cell Biol 57, 265-278 (1998). [0188] 23. N. J. Bowen, I. K. Jordan, J. A. Epstein, V. Wood, H. L. Levin, Retrotransposons and their recognition of pol II promoters: a comprehensive survey of the transposable elements from the complete genome sequence of Schizosaccharomyces pombe. Genome Res 13, 1984-1997 (2003). [0189] 24. J. Mata, R. Lyne, G. Burns, J. Bahler, The transcriptional program of meiosis and sporulation in fission yeast. Nat Genet 32, 143-147 (2002). [0190] 25. M. D. Daugherty, H. S. Malik, Rules of engagement: molecular insights from host-virus arms races. Annu Rev Genet 46, 677-700 (2012). [0191] 26. R. N. McLaughlin, Jr., H. S. Malik, Genetic conflicts: the usual suspects and beyond. J Exp Biol 220, 6-17 (2017). [0192] 27. C. I. Wu, T. W. Lyttle, M. L. Wu, G. F. Lin, Association between a satellite DNA sequence and the Responder of Segregation Distorter in D. melanogaster. Cell 54, 179-189 (1988). [0193] 28. A. M. Harvey et al., A critical component of meiotic drive in Neurospora is located near a chromosome rearrangement. Genetics 197, 1165-1174 (2014). [0194] 29. Z. Kuang, J. D. Boeke, S. Canzar, The dynamic landscape of fission yeast meiosis alternative-splice isoforms. Genome Res (2016). [0195] 30. M. A. Sheff, K. S. Thorn, Optimized cassettes for fluorescent protein tagging in Saccharomyces cerevisiae. Yeast 21, 661-670 (2004). [0196] 31. D. W. Hailey, T. N. Davis, E. G. Muller, Fluorescence resonance energy transfer using color variants of green fluorescent protein. Methods Enzymol 351, 34-49 (2002). [0197] 32. G. R. Smith, Genetic analysis of meiotic recombination in Schizosaccharomyces pombe. Methods Mol Biol 557, 65-76 (2009). [0198] 33. S. Henikoff, K. Ahmad, H. S. Malik, The centromere paradox: stable inheritance with rapidly evolving DNA. Science 293, 1098-1102 (2001). [0199] 34. W. Hu et al., A large gene family in fission yeast encodes spore killers that subvert Mendel's law Submitted. [0200] 35. K. Y. Lee, B. J. Lee, Structure, Biology, and Therapeutic Application of Toxin-Antitoxin Systems in Pathogenic Bacteria. Toxins (Basel) 8, (2016). [0201] 36. S. J. Unterholzner, B. Poppenberger, W. Rozhon, Toxin-antitoxin systems: Biology, identification, and application. Mob Genet Elements 3, e26219 (2013). [0202] 37. X. Wang et al., A new type V toxin-antitoxin system where mRNA for toxin GhoT is cleaved by antitoxin GhoS. Nat Chem Biol 8, 855-61 (2012). [0203] 38. L. C. De Veaux, N. A. Hoagland, G. R. Smith, Seventeen complementation groups of mutations decreasing meiotic recombination in Schizosaccharomyces pombe. Genetics 130, 251-262 (1992). [0204] 39. A. L. Goldstein, J. H. McCusker, Three new dominant drug resistance cassettes for gene disruption in Saccharomyces cerevisiae. Yeast 15, 1541-1553 (1999). [0205] 40. A. Wach, A. Brachat, R. Pohlmann, P. Philippsen, New heterologous modules for classical or PCR-based gene disruptions in Saccharomyces cerevisiae. Yeast 10, 1793-1808 (1994). [0206] 41. T. D. Wu et al., GMAP and GSNAP for Genomic Sequence Alignment: Enhancements to Speed, Accuracy, and Functionality. Methods Mol Biol 1418, 283-334 (2016). [0207] 42. H. Thorvaldsdottir, J. T. Robinson, J. P. Mesirov, Integrative Genomics Viewer (IGV): high-performance genomics data visualization and exploration. Brief Bioinform 14, 178-92 (2013). [0208] 43. A. Krogh, B. Larsson, G. von Heijne, E. L. Sonnhammer, Predicting transmembrane protein topology with a hidden Markov model: application to complete genomes. J Mol Biol 305, 567-580 (2001). [0209] 44. J. Z. Jacobs, K. M. Ciccaglione, V. Tournier, M. Zaratiegui, Implementation of the CRISPR-Cas9 system in fission yeast. Nat Commun 5, 5344 (2014). [0210] 45. J. A. Young et al., Meiotic recombination remote from prominent DNA break sites in S. pombe. Mol Cell 9, 253-63 (2002).