GENE THERAPY
20200078408 ยท 2020-03-12
Inventors
- Luigi Naldini (Milan, IT)
- Giulia Escobar (Milan, IT)
- Bernhard Rudolf Gentner (Milan, IT)
- Adele Mucci (Milan, IT)
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
A61K48/0058
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
A61K48/0083
HUMAN NECESSITIES
A61K48/005
HUMAN NECESSITIES
C12N5/0647
CHEMISTRY; METALLURGY
A61K39/3955
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K31/405
HUMAN NECESSITIES
A61K31/405
HUMAN NECESSITIES
A61K35/28
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
A61K2039/545
HUMAN NECESSITIES
A01K2217/05
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C12N2740/16043
CHEMISTRY; METALLURGY
A61K45/06
HUMAN NECESSITIES
A01K2207/12
HUMAN NECESSITIES
A61K35/15
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C12N5/0645
CHEMISTRY; METALLURGY
International classification
A61K35/28
HUMAN NECESSITIES
A61K39/395
HUMAN NECESSITIES
A61K35/15
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
A61K48/00
HUMAN NECESSITIES
C12N7/00
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
A61K31/405
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
Abstract
A hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC) a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding interferon-alpha (IFN) for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor and/or a tumor associated antigen (TAA)-specific T-cell.
Claims
1. A hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor, a tumor associated antigen (TAA)-specific T-cell and/or 1-methyl-tryptophan (1-MT), preferably wherein the cytokine is an interferon (IFN), IL-12 or granulocyte-macrophage colony-stimulating factor (GM-CSF), preferably wherein the IFN is a type I IFN (preferably IFN or IFN), or a type II IFN (preferably IFN), more preferably wherein the type I IFN is IFN.
2. A HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte for use according to claim 1, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is used in combination with an immune checkpoint inhibitor and a TAA-specific T-cell.
3. A HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte for use according to claim 1 or 2, wherein the TAA-specific T-cell expresses a chimeric antigen receptor (CAR) and/or a transgenic T cell receptor (TCR)
4. A HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte for use according any preceding claim, wherein the TAA is selected from the group consisting of carcinoembryonic antigen (CEA), estrogen receptor, progesterone receptor, ephrinB2, ROR1, mesothelin, c-Met, GD-2, and MAGE A3 TCR, 4-1BB, adenocarcinoma antigen, alpha-fetoprotein, BAFF, B-lymphoma cell, C242 antigen, carbonic anhydrase 9 (CA-IX), CCR4, CD152, CD200, CD22, CD19, CD22, CD123, CD221, CD23 (IgE receptor), CD28, CD4, CD40, CD44, CD44 v6, CD51, CD52, CD56, CD74, CD80, CS-1, CNT0888, CTLA-4, DR5, EpCAM, CD3, fibronectin extra domain-B, folate receptor 1, glycoprotein 75, GPNMB, HGF, human scatter factor receptor kinase, IGF-1 receptor, IGF-I, IgGI, L1-CAM, IL-13, IL-6, insulin-like growth factor I receptor, integrin 51, integrin v3, MORAb-009, MS4A1, mucin CanAg, N-glycolylneuraminic acid, NPC-1C, PDGF-R, PDL192, phosphatidylserine, prostatic carcinoma cells, RANKL, RON, SCH 900105, SDC1, SLAMF7, tenascin C, TGF beta 2, TGF-, TRAIL-R1, TRAIL-R2, tumor antigen CTAA16.88, Vascular endothelial growth, factor (VEGF), VEGF-A, VEGFR-1, VEGFR2, vimentin, 5T4, CD5, CD19, CD20, CD21, CD25, CD37, CD30, CD33, CD45, CAMPATH-1 (CDw52), HLA-DR, Anti-idiotype, TAG-72, Ep-CAM, MUC1, Folate-binding protein, A33, G250, Prostate-specific membrane antigen, (PSMA), Prostate specific antigen (PSA), Ferritin, Gangliosides (e.g. GD2, GD3, GM2), Le.sup.y, CA-125, CA19-9, Epidermal growth factor receptor (EGFR), p185HER2, IL-2 receptor, de2-7 EGFR, Fibroblast activation protein (FAP), Tenascin, metalloproteinases, Endosialin, Carbonic anhydrase, Galectin 9, Aldolase A, elF4, Tyrosinase, Galectin 4, HERKV-K10, p53, NY-LU-12, Restin, NY-CO-38, MAGE-1, MAGE-4a, SSX2, NY-ESO-1, SCP-1, 707-AP, AFP, ART-4, BAGE, b-catenin/m, Bcr-abl, CAMEL, CAP-1, CASP-8, CDC27m, CDK4/m, CT, Cyp-B, DAM-6 (MAGE-B2) and DAM-10 (MAGE-B1), ELF2M, ETV6-AML1, G250, GAGE, GnT-V, Gp100, HAGE, HER-2/neu, HLA-A*0201-R170I, HPV-E7, HSP70-2M, HST-2, hTERT (hTRT), iCE, KIAA0205, LAGE, LDLR/FUT, MAGE, MART-1/Melan-A, MC1R, Myosin/m, MUC1, MUM-1, MUM-2, MUM-3, NA88-A, NY-ESO-1, P15, p190 minor bcr-abl, Pml/RARa, PRAME, RAGE, RU1, RU2, SAGE, SART-1, SART-3, TEL/AML1, TPI/m, TRP-1, protein 1, gp75, TRP-2, TRP-2/INT2 and WT1, preferably, wherein the TAA-specific T-cell expresses a CD19-specific CAR.
5. A HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte for use according to any preceding claim, wherein the TAA-specific T-cell is derived from a cell isolated from the patient.
6. A HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte for use according to any preceding claim, wherein the TAA-specific T-cell has been engineered to disrupt at least one endogenous gene, preferably wherein the at least one endogenous gene is selected from an endogenous gene encoding a TCR chain, a TCR chain and a major histocompatibility complex (MHC).
7. A HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte for use according to any preceding claim, wherein the immune checkpoint inhibitor is an antibody, preferably wherein the immune checkpoint inhibitor antibody is selected from the group consisting of an anti-CTLA4 antibody, an anti-PD1 antibody, an anti-PDL1 antibody, an anti-PDL2 antibody and an anti-LAG-3 antibody.
8. A HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte for use according to any preceding claim, wherein the vector comprises at least one mir-130a target sequence and at least one mir-126 target sequence, preferably wherein the vector comprises two mir-130a target sequences and two mir-126 target sequences.
9. A HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte for use according to any preceding claim, wherein the vector further comprises a tissue specific promoter operably linked to the nucleotide sequence encoding the cytokine, preferably wherein the tissue specific promoter is a TEK (Tie2) promoter.
10. A HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte for use according to any preceding claim, wherein the cancer is a hematological malignancy or a solid tumor, preferably wherein the hematological malignancy is selected from the group consisting of acute myeloid leukemia (AML), lymphoblastic leukemia, acute lymphoblastic leukemia (ALL), myelodysplastic syndromes (MDS), myeloproliferative neoplasms (MPN), primary myelofibrosis, essential thrombocythemia, polycythemia vera, atypical chronic myeloid leukemia, chronic myeloid leukemia (CML), lymphoma, multiple myeloma, non Hodgkin lymphoma and Hodgkin lymphoma; or preferably wherein the solid tumor is selected from the group consisting of lung cancer, breast cancer, oesophageal cancer, gastric cancer, colon cancer, cholangiocarcinoma, pancreatic cancer, ovarian cancer, head and neck cancers, synovial sarcoma, angiosarcoma, osteosarcoma, thyroid cancer, endometrial cancer, neuroblastoma, rabdomyosarcoma, liver cancer, melanoma, prostate cancer, renal cancer, soft tissue sarcoma, urothelial cancer, biliary cancer, glioblastoma, cervical cancer and colorectal cancer.
11. A tumor associated antigen (TAA)-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a hematopoietic stem cell (HSC) a hematopoietic progenitor cell (H PC), a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, preferably wherein the TAA is selected from the group consisting of carcinoembryonic antigen (CEA), estrogen receptor, progesterone receptor, ephrinB2, ROR1, mesothelin, c-Met, GD-2, and MAGE A3 TCR, 4-1BB, adenocarcinoma antigen, alpha-fetoprotein, BAFF, B-lymphoma cell, C242 antigen, carbonic anhydrase 9 (CA-IX), CCR4, CD152, CD200, CD22, CD19, CD22, CD123, CD221, CD23 (IgE receptor), CD28, CD4, CD40, CD44, CD44 v6, CD51, CD52, CD56, CD74, CD80, CS-1, CNT0888, CTLA-4, DR5, EpCAM, CD3, fibronectin extra domain-B, folate receptor 1, glycoprotein 75, GPNMB, HGF, human scatter factor receptor kinase, IGF-1 receptor, IGF-I, IgGI, L1-CAM, IL-13, IL-6, insulin-like growth factor I receptor, integrin 51, integrin v3, MORAb-009, MS4A1, mucin CanAg, N-glycolylneuraminic acid, NPC-1C, PDGF-R, PDL192, phosphatidylserine, prostatic carcinoma cells, RANKL, RON, SCH 900105, SDC1, SLAMF7, tenascin C, TGF beta 2, TGF-, TRAIL-R1, TRAIL-R2, tumor antigen CTAA16.88, Vascular endothelial growth, factor (VEGF), VEGF-A, VEGFR-1, VEGFR2, vimentin, 5T4, CD5, CD19, CD20, CD21, CD25, CD37, CD30, CD33, CD45, CAMPATH-1 (CDw52), HLA-DR, Anti-idiotype, TAG-72, Ep-CAM, MUC1, Folate-binding protein, A33, G250, Prostate-specific membrane antigen, (PSMA), Prostate specific antigen (PSA), Ferritin, Gangliosides (e.g. GD2, GD3, GM2), Le.sup.y, CA-125, CA19-9, Epidermal growth factor receptor (EGFR), p185HER2, IL-2 receptor, de2-7 EGFR, Fibroblast activation protein (FAP), Tenascin, metalloproteinases, Endosialin, Carbonic anhydrase, Galectin 9, Aldolase A, elF4, Tyrosinase, Galectin 4, HERKV-K10, p53, NY-LU-12, Restin, NY-CO-38, MAGE-1, MAGE-4a, SSX2, NY-ESO-1, SCP-1, 707-AP, AFP, ART-4, BAGE, b-catenin/m, Bcr-abl, CAMEL, CAP-1, CASP-8, CDC27m, CDK4/m, CT, Cyp-B, DAM-6 (MAGE-B2) and DAM-10 (MAGE-B1), ELF2M, ETV6-AML1, G250, GAGE, GnT-V, Gp100, HAGE, HER-2/neu, HLA-A*0201-R170I, HPV-E7, HSP70-2M, HST-2, hTERT (hTRT), iCE, KIAA0205, LAGE, LDLR/FUT, MAGE, MART-1/Melan-A, MC1R, Myosin/m, MUC1, MUM-1, MUM-2, MUM-3, NA88-A, NY-ESO-1, P15, p190 minor bcr-abl, Pml/RARa, PRAME, RAGE, RU1, RU2, SAGE, SART-1, SART-3, TEL/AML1, TPI/m, TRP-1, protein 1, gp75, TRP-2, TRP-2/INT2 and WT1, preferably wherein the TAA-specific T-cell expresses a chimeric antigen receptor (CAR) and/or a transgenic T-cell receptor (TCR), preferably wherein the cytokine is an interferon (IFN), IL-12 or granulocyte-macrophage colony-stimulating factor (GM-CSF), preferably wherein the IFN is a type I IFN (preferably IFN or IFN), or a type II IFN (preferably IFN), more preferably wherein the type I IFN is IFN, preferably, wherein the TAA-specific T-cell expresses a CD19-specific CAR.
12. An immune checkpoint inhibitor for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, preferably wherein the immune checkpoint inhibitor is an antibody, more preferably wherein the immune checkpoint inhibitor antibody is selected from the group consisting of an anti-CTLA4 antibody, an anti-PD1 antibody, an anti-PDL1 antibody, an anti-PDL2 antibody and an anti-LAG-3 antibody, preferably wherein the cytokine is an interferon (IFN), IL-12 or granulocyte-macrophage colony-stimulating factor (GM-CSF), preferably wherein the IFN is a type I IFN (preferably IFN or IFN), or a type II IFN (preferably IFN), more preferably wherein the type I IFN is IFN.
13. 1-methyl-tryptophan (1-MT) for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, preferably wherein the cytokine is an interferon (IFN), IL-12 or granulocyte-macrophage colony-stimulating factor (GM-CSF), preferably wherein the IFN is a type II IFN (preferably IFN).
14. A combination of an immune checkpoint inhibitor and a tumor associated antigen (TAA)-specific T-cell for use in treating or preventing a cancer in a patient wherein the patient has previously been administered with a hematopoietic stem cell (HSC) or a hematopoietic progenitor cell (HPC) comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, preferably wherein the TAA-specific T-cell expresses a chimeric antigen receptor (CAR) and/or a transgenic T-cell receptor (TCR), preferably wherein the cytokine is an interferon (IFN), IL-12 or granulocyte-macrophage colony-stimulating factor (GM-CSF), preferably wherein the IFN is a type I IFN (preferably IFN or IFN), or a type II IFN (preferably IFN), more preferably wherein the type I IFN is IFN.
15. A TAA-specific T-cell for use according to claim 11, an immune checkpoint inhibitor for use according to claim 12, 1-methyl-tryptophan (1-MT) for use according to claim 13 or a combination for use according to claim 14, wherein the vector comprises at least one mir-130a target sequence and at least one mir-126 target sequence, preferably wherein the vector comprises two mir-130a target sequences and two mir-126 target sequences.
16. A TAA-specific T-cell for use according to claim 11 or 15, an immune checkpoint inhibitor for use according to claim 12 or 15, 1-methyl-tryptophan (1-MT) for use according to claim 13 or 15, or a combination for use according to claim 14 or 15, wherein the vector further comprises a tissue specific promoter operably linked to the nucleotide sequence encoding the cytokine, preferably wherein the tissue specific promoter is a TEK (Tie2) promoter.
17. A TAA-specific T-cell for use according to any one of claims 11 and 15-16, an immune checkpoint inhibitor for use according to any one of claims 12 and 15-16, 1-methyl-tryptophan (1-MT) for use according to claim 13 or 15-16, or a combination for use according to any one of claims 14-16, wherein the cancer is a hematological malignancy or a solid tumor, preferably wherein the hematological malignancy is selected from the group consisting of acute myeloid leukemia (AML), lymphoblastic leukemia, acute lymphoblastic leukemia (ALL), myelodisplastic syndromes, lymphoma, multiple myeloma, non Hodgkin lymphoma and Hodgkin lymphoma; or preferably wherein the solid tumor is selected from the group consisting of lung cancer, breast cancer, oesophageal cancer, gastric cancer, colon cancer, cholangiocarcinoma, pancreatic cancer, ovarian cancer, head and neck cancers, synovial sarcoma, angiosarcoma, osteosarcoma, thyroid cancer, endometrial cancer, neuroblastoma, rabdomyosarcoma, liver cancer, melanoma, prostate cancer, renal cancer, soft tissue sarcoma, urothelial cancer, biliary cancer, glioblastoma, cervical cancer and colorectal cancer.
18. A method for treating or preventing a cancer, which comprises the step of administering a hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine to a patient in need thereof, wherein the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte is administered to the patient in combination with an immune checkpoint inhibitor, a tumor associated antigen (TAA)-specific T-cell and/or 1-methyl-tryptophan (1-MT), preferably wherein the TAA-specific T-cell expresses a chimeric antigen receptor (CAR) and/or a transgenic T-cell receptor (TCR), preferably wherein the cytokine is an interferon (IFN), IL-12 or granulocyte-macrophage colony-stimulating factor (GM-CSF), preferably wherein the IFN is a type I IFN (preferably IFN or IFN), or a type II IFN (preferably IFN), more preferably wherein the type I IFN is IFN.
19. A method for treating or preventing a cancer in a patient previously administered with a hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine, which comprises the step of administering a tumor associated antigen (TAA)-specific T-cell, the step of administering an immune checkpoint inhibitor, and/or the step of administering 1-methyl-tryptophan (1-MT), preferably wherein the TAA-specific T-cell expresses a chimeric antigen receptor (CAR) and/or a transgenic T-cell receptor (TCR), preferably wherein the cytokine is an interferon (IFN), IL-12 or granulocyte-macrophage colony-stimulating factor (GM-CSF), preferably wherein the IFN is a type I IFN (preferably IFN or IFN), or a type II IFN (preferably IFN), more preferably wherein the type I IFN is IFN.
20. A hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a first cytokine, and a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a second cytokine for use in treating or preventing a cancer in a patient, wherein the first and second cytokines are different, preferably wherein the first and second cytokines are each independently selected from an interferon (IFN) or tumour necrosis factor alpha (TNF), preferably wherein the first and second cytokines are each independently selected from the group consisting of a type I IFN (preferably IFN or IFN), a type II IFN (preferably IFN) and TNF, preferably wherein the first and second cytokines are each independently selected from the group consisting of IFN, IFN, IFN and TNF.
21. A population of hematopoietic stem cells (HSCs), hematopoietic progenitor cells (HPCs), myeloid/monocyte-committed progenitor cells, macrophages or monocytes, the population transduced with a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a first cytokine, and a vector comprising at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a second cytokine for use in treating or preventing a cancer in a patient, wherein the first and second cytokines are different, preferably wherein the first and second cytokines are each independently selected from an interferon (IFN) or tumour necrosis factor alpha (TNF), preferably wherein the first and second cytokines are each independently selected from the group consisting of a type I IFN (preferably IFN or IFN), a type II IFN (preferably IFN) and TNF, preferably wherein the first and second cytokines are each independently selected from the group consisting of IFN, IFN, IFN and TNF.
22. A HSC, a HPC, a myeloid/monocyte-committed progenitor cell, a macrophage, a monocyte or a population for use according to claim 20 or 21, wherein: (a) the first cytokine is IFN and the second cytokine is IFN; (b) the first cytokine is IFN and the second cytokine is TNF; or (c) the first cytokine is IFN and the second cytokine is TNF, preferably wherein the first cytokine is IFN and the second cytokine is TNF.
23. A hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte comprising a vector wherein the vector comprises at least one mir-130a and/or mir-126 target sequence operably linked to a nucleotide sequence encoding a cytokine for use in treating or preventing a cancer in a patient, wherein the cytokine is an interferon (IFN) or tumour necrosis factor alpha (TNF), preferably wherein the IFN is a type II IFN (preferably IFN) or a type I IFN (preferably IFN or IFN), more preferably wherein the type II IFN is IFN.
Description
DESCRIPTION OF THE DRAWINGS
[0146]
[0147] a, Schematic representation of the lentiviral vectors (LV) used to engineer HSC and generate spontaneous B-ALL. b, Experimental design. c, Absolute numbers (meanSEM) of parental ALL in the peripheral blood (PB) over time of CTRL (n=10, treated with isotype control antibody), IFN ((n=10, treated with isotype control antibody), CTRL+aCTLA4 (n=14) and IFN+aCTLA4 (n=13) mice. Each dot represents a single mouse. *p<0.05, **p<0.01, ****p<0.0001, nonparametric rank-based method for longitudinal data in factorial experiments. d, e, f Absolute numbers (meanSEM) of OVA-ALL (engineered with the NGFR/OVA bidirectional LV shown on top) in the PB over time (d), and in BM and spleen (e, f; 14 days after tumor injection) of IFN (n=15) and CTRL (n=15) mice (one out of 9 experiments shown). Each dot represents a single mouse. ****p<0.0001, nonparametric rank-based method for longitudinal data in factorial experiments (d); *p<0.05, ** p<0.01, Mann-Whitney (e, f). g, Splenic CD8+T cells from IFN mice, 13 days upon tumor injection, or from non tumor-bearing CTRL (nave C57BI/6, n=1) mice tested by IFNg-ELISPOT against the EL4 target cell line transduced with NGFR-OVA or NGFR-CD20 BdLV. Each dot represents a single mouse, meanSEM. Low tumor burden (n=5): 5.24.9 (meanSEM) % OVA-ALL; mid tumor burden (n=1): 33% OVA-ALL; high tumor burden (n=6): 514.9% OVA-ALL. h, Percentage (meanSEM) of OVA-specific T cells in the PB of IFN (n=14-6) and CTRL (n=15-8) mice. **p<0.01, Mann Whitney performed at 9 days upon OVA-ALL injection. Each dot represents a single mouse. T cells from transgenic OT-1 mice are used as positive control (not shown). i, j, Absolute numbers (meanSEM) of OVA-specific T cells in the BM (i) and spleen (j), 9 days upon tumor injection, in IFN (n=23) and CTRL (n=26) mice from 3 independent experiments. **p<0.01, ***p<0.001, Mann-Whitney. Each dot represents a single mouse. k, Splenic CD8+ T cells from IFN (n=7) and CTRL (n=8) mice 9 days upon tumor injection or from non tumor bearing mice tested as in (g). Concanavalin A (ConA) stimulation and T cells from OT-1 mice (not shown) are used as positive controls. Each dot represents a single mouse. I, m, Percentage (I) and absolute numbers (m) (meanSEM) of OVA-ALL in the PB of IFN (n=9), CD8-depleted IFN (n=7) and CTRL (n=9) mice. **p<0.01, ****p<0.0001, nonparametric rank-based method for longitudinal data in factorial experiments (I); *p<0.05, ****p<0.0001, Kruskall-Wallis with adjusted p-value by Dunn's test (m).
[0148]
[0149] a, b, Experimental design (a) and OVA-ALL growth over time (b, percentage in PB; meanSEM) in IFN (n=7) or CTRL (n=7) mice. c, Absolute numbers (meanSEM) of OTI T cells in BM and spleen of IFN (n=7), CTRL (n=7) and non tumor-bearing (C57BI/6 no tumor, n=3) mice 3 days upon OT-1 adoptive transfer. *p<0.05, **p<0.01, Mann-Whitney. Each dot represents a single mouse. d, Percentages (meanSEM) of nave (CD44-CD62L+), central memory (CD44+CD62L+) and effector memory (CD44+CD62L) cells within OT-1 T cells in the BM and spleen of mice from (c) 3 days upon adoptive transfer. **p<0.01, nonparametric combination test. e, f, Experimental design (e) and survival curve (f) of OVA-ALL-injected CTRL (n=12), IFN+OT-1 (n=9) and CTRL+OT-1 (n=10) mice. *p<0.05, ****p<0.0001 Mantel-Haenszel test, adjusted p-value by Bonferroni test. g, Absolute numbers (meanSEM) of adoptively transferred OT-1 T cells in the PB over time of CTRL+OT-1 and IFN+OT-1 mice from (f), and non tumor-bearing C57131/6 mice (n=3). Long-term surviving mice are shown in green. Each line represents a single mouse. h, Percentage (meanSEM) of Lag3 expression on OT-1 T cells in the PB of mice from (f, g). Each line represents a single mouse.
[0150]
[0151] a, Volcano plot showing changes in the expression of a panel of cancer immune genes in the BM and spleen of IFN and CTRL mice before and after OVA-ALL challenge. Horizontal dashed lines indicate threshold of significance (FDR<0.05). Vertical dashed lines indicate genes with 2-fold increased/decreased expression with respect to CTRL mice. ISGs are shown in orange, Th1 and T cell activation genes in light blue, genes common to IFN and Th1 responses in green, macrophage and DC activation genes in red, NK cell activation genes in purple, antigen processing genes in blue, leukemia associated genes in grey. Gated insets shown magnified on the right. n=3 mice for each sample, except for the CTRL BM+ALL, n=2. b, Expression analysis by RT-qPCR of the indicated Th1 genes (mean fold-change over OVA-ALL-injected CTRL miceSEM) in splenic CD4+T cells from OVA-ALL-injected IFN (n=6) and CTRL (n=5) mice 9 days upon tumor injection and from a non tumor-bearing C57BI/6 mouse. Each dot represents a single mouse. *p<0.05, Mann-Whitney. c, Percentage (meanSEM) of the indicated myeloid populations in the PB of IFN (n=11) and CTRL (n=13) mice before and after (12 days) OVA-ALL injection. *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001, Kruskall-Wallis, with adjusted p value by Dunn's test. Statistical analysis is performed within each individual myeloid cell population.
[0152]
[0153] a, b, c, d Survival curves of OVA-ALL-injected IFN and CTRL mice after the first (a; n=11,13; *p<0.05, Mantel-Haenszel test) and subsequent tumor challenges with the indicated ALL cells (b: n=3 long-term surviving IFN mice from (a) vs. 4 nave mice; c: same 3 surviving mice from (a, b) vs. 4 nave mice; d: 2 of the 3 surviving mice from (a, b, c) vs. 4 nave mice. e, Experimental design. f, g, Survival curves of OVA-ALL-injected (f) IFN (n=14), CTRL (n=14), IFN +aCTLA4 (n=14) and CTRL+aCTLA4 (n=15) mice, *p<0.05, ***p<0.001, Mantel-Haenszel test, adjusted p-value by Bonferroni method; and (g) IFN+aCTLA4 (n=10) and CTRL+aCTLA4 (n=12) mice, *p<0.05, Mantel-Haenszel test. h, PBMC from surviving mice from (f) (IFN n=3, CTRL n=1, IFN+aCTLA4 n=4, CTRL+aCTLA4 n=3) 51 days upon tumor injection and from non-tumor bearing (OT-I, n=1 and transplanted CTRL mice, n=2) mice tested by IFNg-ELISPOT against the EL4 target cell line transduced with NGFR-OVA or NGFR-CD20 BdLV or PGK-OFP or PGK-tTA LV. The dashed line indicates the higher median background level seen against the EL4 NGFR target cells. Each dot represents a single mouse tested against all four TAAs. i, Clonality and similarity of the TCR-beta CDR repertoire of surviving mice (each arrow represents a mouse) from (f) before OVA-ALL injection (start of the arrow, TO) and 4 days after second tumor re-challenge (tip of the arrow, T2). j, PBMC from mice from (g) (IFN+aCTLA-4 survivors, full blue symbols, n=3; CTRL+aCTLA-4 survivors, full red symbols, n=1; IFN+CTLA-4 non responders, empty blue symbols, n=7; CTRL+CTLA-4, empty red symbol, n=8 out of 12 non-responder controls) tested by IFNg-ELISPOT as in (h), 19 days upon tumor injection. Each dot represents a single mouse tested against all four TAAs. k, Survival curve of mice from (g) stratified based on their immune reactivity as assessed by IFNg-ELISPOT assay shown in (j). Mice shown in red react against 2 or more antigens; mice shown in black react against 1 or no antigens. Note that reactivity against OVA and NGFR count for 1 as their expression is co-regulated by a bidirectional promoter present within a BdLV.
[0154]
[0155] a, Schematic representation of the bidirectional LV (BdLV) used to generate OVA-ALL with representative plot showing NGFR expression on purified OVA-ALL. a, Gating strategy used to identify B-ALL (CD19+OFP+) and NGFR expression on ALL in PB of tumor-injected mice. c, Top: Percentage (meanSEM) of OVA-ALL in the PB of immune-competent C57BI/6 (n=5) and immune-deficient NSG (n=6) mice and of parental ALL in the PB of immune-competent C57BI/6 (n=5) mice. Bottom: expression of the NGFR marker on ALL present in the PB of immune-competent C57BI/6 (n=5) and immunedeficient NSG (n=6) mice. Note that expression of NGFR and OVA antigens is co-regulated by a bidirectional promoter present within a BdLV. d, e, Percentage (meanSEM) of OVA-ALL and expression of NGFR marker on leukemic cells present in the BM of immune competent C57BI/6 (n=6) (d) and immune-deficient NSG (n=6) mice (e) at the time of sacrifice.
[0156]
[0157] a, Gating strategy used to identify OVA-specific CD8+ T cells. b, c, d, Percentage (b) and absolute numbers (c, d) (meanSEM) of OVA-ALL in PB (b) and in BM and spleen (c, d) of IFN (n=14-6) and CTRL (n=15-8) mice, 9 days upon tumor injection. ***P<0.001, Mann-Whitney. Each dot represents a single mouse. e, Percentage of OVA-ALL in PB of IFN (n=9), CD8-depleted IFN (n=7) and CTRL (n=9) mice 9 days upon tumor challenge. Each dot represents a single mouse. *p<0.05, ***p<0.001, Kruskall-Wallis with adjusted p-value by Dunn's test.
[0158]
[0159] a, b, Gating strategy (a) and analysis (b) (percentage, meanSEM) of early apoptotic (Annexin+7-AAD-), late apoptotic (Annexin+7-ADD+), dead/necrotic (Annexin-7AAD+) and alive (Annexin-7-AAD-) OVA-ALL cells present in BM and spleen of IFN (n=11) and CTRL (n=15) mice, 9 days upon tumor injection. *p<0.05, Mann-Whitney. c, d, Gating strategy (c) and analysis (d: percentage, meanSEM) of OVAALL distribution in the GO (Ki67-Hoechst.sup.low), G1 (Ki67+Hoechst.sup.low) and S-G2-M (Ki67+Hoechsthigh) phase of the cell cycle in BM and spleen of IFN (n=11) and CTRL (n=15) mice, 9 days upon tumor injection. e, f, Gating strategy (e) and analysis (f: percentage, meanSEM) of proliferating EdU+ALL cells present in BM and spleen of IFN (n=11) and CTRL (n=15) mice, 9 days upon tumor injection. **p<0.01, Mann-Whitney.
[0160]
[0161] a, Absolute numbers (meanSEM) of OVA-ALL in the PB of CTRL (n=7) and IFN (n=7) mice at the indicated time upon OT-1 adoptive transfer. Each dot represents a single mouse. b, Lag3 expression on OT-1 T cells in BM and spleen of IFN (n=7), CTRL (n=7) and non tumor-bearing (C57BI/6 no tumor, n=3) mice, 3 days upon adoptive transfer of OT-1 T cells. Each dot represents a single mouse. c, Gating strategy used to identify adoptively transferred OT-1 T cells (CD45.2+) and Lag3 expression on OT-1 T cells present in BM and spleen of mice from (a, b). OVA-ALL cells are first excluded by gating on OFP-CD8+T cells. CD45.1 and CD45.2 markers are used to distinguish among radio-resistant recipient-derived CD8+T cells (CD45.1+), donor-derived CD8+T cells (CD45.1.2+) and adoptively transferred OT-1 T cells (CD45.2+). In non tumorbearing mice, adoptively transferred OT-1 T cells are defined as CD8+T cells and are distinguished from CD8+recipient-derived T cells (CD45.1+) by gating on CD45.2+CD8+T cells. d, Gating strategy used to identify nave (CD62L+CD44-), central memory (CD62L+CD44+) and effector memory (CD62L-CD44+) adoptively transferred OT-1 T cells. OT-1 T cells are identified as described in (c, OVA-ALL are first excluded by gating on CD19-CD8+T cells). e, f, Absolute numbers of OVA-ALL (e) (meanSEM) and NGFR marker expression (f) on ALL in BM and spleen from mice shown in (a, b) at 3 days upon adoptive transfer of OT-1 T cells. Each dot represents a single mouse. **p<0.01, ***p<0.001, Mann- Whitney (e).
[0162] Supplementary
[0163] a, Expression analysis by RT-qPCR of the indicated Th2 and Treg genes (mean fold-change over OVA-ALL-injected CTRL miceSEM) in splenic CD4+ T cells purified from OVA-ALL-injected IFN (n=6) and CTRL (n=5) mice, 9 days upon tumor injection and from a non tumor-bearing nave C57BI/6 mouse. Each dot represents a single mouse.
[0164]
[0165] a, b, c, d, Percentage (meanSEM) of ALL cells and expression of NGFR marker on ALL cells in the PB (a, b) and BM (c, d) of IFN+OT-1 (n=9, a, c) and CTRL+OT-1 (n=10, b, d) mice. Long-term surviving mice are shown in green. Note that NGFR expression is not shown for surviving mice that eradicate leukemia. Each individual mouse is represented as single dot (b, d) or line (a, b). e, f, Percentage (meanSEM) of naive (CD62L+CD44), central memory (CD62L+CD44+) and effector memory (CD62LCD44+) OT-1 T cells in the BM, spleen and lymph nodes of euthanized tumor-bearing mice from (a, b, c, d, CTRL+OT-I, n=8; IFN+OT-1, n=3). f, Percentage (meanSEM) of PD1 expression on OT-1 T cells present in the BM, spleen and lymph nodes of mice shown in (e). Each dot represents a single mouse.
[0166]
[0167] a, b, c, Gating strategy (a) and analysis (b, absolute numbers, meanSEM) of myeloid cell populations in the spleen of tumor-free and OVA-ALL-injected IFN and CTRL mice (CTRL: n=3, IFN n=2, CTRL+ALL: n=9, IFN+ALL: n=7), 10 days upon tumor injection. Macrophages (MF) are identified as CD19-CD11c-Ly6G-F4/80+ cells and further distinguished into MHC-II+MF and MHC-II- Mf using the IAb (MHC-II) marker. We distinguished CD19-F4/80-CD11c+MHCII- myeloid cells from the CD19-F4/80-CD11c+MHCII+ dendritic cells. We defined granulocytes as CD19-F4/80-CD11c-CD11b+Ly6C+Ly6G+, classical monocytes as CD19-F4/80-CD11c-CD11b+Ly6ClowLy6G- and non classical monocytes as CD19-F4/80-CD11c-CD11b+Ly6C-Ly6G-. **p<0.01, Kruskall-Wallis with adjusted p-value by Dunn's test. Statistics is performed within each individual myeloid population. d, Percentage of MHC-II macrophages present in tumor-free or tumor-bearing IFN and CTRL mice from (c). **p<0.01, Kruskall-Wallis with adjusted p-value by Dunn's test.
[0168]
[0169] a, b, Gating strategy and analysis (absolute numbers, meanSEM) of myeloid cell populations in the BM of tumor-free and OVA-ALL-injected IFN and CTRL mice (CTRL: n=3, IFN: n=2, CTRL+ALL: n=9, IFN+ALL: n=7), 10 days upon tumor injection. Each dot represents a single mouse. Macrophages (MF) are identified as CD19-CD11c-Ly6G-F4/80+ cells, dendritic cells (DCs) as CD19-F4/80-CD11c+MHCII+, granulocytes as CD19-F4/80-CD11c-CD11b+Ly6C+Ly6G+, classical monocytes as CD19-F4/80-CD11c-CD11b+Ly6ClowLy6G- and non classical monocytes as CD19-F4/80-CD11c-CD11b+Ly6CLy6G-.*p<0.05, **p<0.01, Kruskall-Wallis with adjusted p-value by Dunn's test. Statistics is performed within each individual myeloid population. c, d, Gating strategy (c) and analysis (d, absolute numbers, meanSEM) of T regulatory cells in BM and spleen of tumor-free and OVA-ALL-injected IFN and CTRL mice from (b). Each dot represents a single mouse. T regulatory cells are defined as CD3+CD4+CD25+FoxP3+. **p<0.01, Kruskall-Wallis with adjusted p-value by Dunn's test. Statistics is performed within each individual tissue.
[0170]
[0171] a, b, Gating strategy (a) and analysis (b, absolute numbers, meanSEM) of NK and NKT cells present in spleen and BM of tumor-free or OVA-ALL-injected IFN and CTRL mice (CTRL: n=3, IFN: n=2, CTRL+ALL: n=9, IFN+ALL: n=7), 10 days upon tumor injection. Each dot represents a single mouse. NK cells are identified as CD19-CD3-NK1.1+and NKT cells as CD19-CD3+NK1.1+. Using the CD11b and CD27 markers we further distinguished among the most immature (CD11b-CD27+), the mature and most cytotoxic and cytokine producers (CD11b+CD27+) and the mature and less cytotoxic and cytokine producers (CD11b+CD27) NK cells. **p<0.01, ***p<0.001, Kruskall-Wallis with adjusted p-value by Dunn's test. Statistics is performed within each individual population. c, Percentage (meanSEM) of the indicated sub-populations of NK cells in the spleen (top) and BM (bottom) of tumor-free or tumorbearing IFN and CTRL mice from (b). Each dot represents a single mouse. d, e, Percentage (meanSEM) of NKG2D and NKp46 expression on CD11b+CD27+(d) and CD11b+CD27-(d, e) NK cells present in the spleen (d) and BM (e) of mice from (b). Each dot represents a single mouse. *p<0.05, **p>0.01, Kruskall-Wallis with adjusted p-value by Dunn's test. Statistics is performed within each individual population.
[0172]
[0173] a, Percentage (meanSEM) of OVA-ALL in the PB of each individual IFN (n=11) and CTRL (n=13) mice. Each line represents a single mouse. b, NGFR expression on BM-infiltrating ALL (or PB circulating ALL for those mice for which BM analysis is not available) and absolute numbers (meanSEM) of OVA-specific T cells (each line represents a single mouse) in the PB of IFN (n=8) and CTRL (n=13) mice showing fast or delayed disease course (fast disease course: CTRL: 13-29 days (range), 20.41.3 (meanSEM), n=11; IFN:16-27 days, 20.81.8, n=5; delayed disease course: CTRL: 34-44 days, 395, n=2; IFN: 34-100 days, 5622, n=3). c, absolute numbers (meanSEM) of OVA-specific T cells in the PB of long term survival IFN (n=3) mice. Each line represents a single mouse. d, Percentage (meanSEM) of OVA-specific T cells in surviving IFN mice (n=3) vs. 4 nave mice from
[0174]
[0175] a, b, Percentage (meanSEM) of OVA-ALL in the PB of each individual (a) IFN (n=14), CTRL (n=14), IFN+aCTLA4 (n=14) and CTRL+aCTLA4 (n=15) mice and (b) IFN+aCTLA4 (n=10) and CTRL+aCTLA4 (n=12) mice. Each line represents a single mouse.
[0176]
[0177] a, NGFR expression on BM-infiltrating ALL (or PB circulating ALL for those mice for which BM analysis is not available) and absolute numbers (meanSEM) of OVA-specific T cells (each line represents a single mouse) in the PB of IFN (n=14), CTRL (n=14), IFN+aCTLA4 (n=14) and CTRL+aCTLA4 (n=15) mice showing fast, delayed disease course or long-term survival. Fast disease course: CTRL: 14-21 days (range), 15.660.8 (meanSEM), n=12; IFN: 17-25 days, 211.3, n=8; CTRL+CTLA4: 14-21 days, 191.2, n=6; IFN+CTLA4: 25 days, 250, n=2; delayed disease course: CTRL: 36 days, n=1; IFN: 30-36 days, 342, n=3; CTRL+CTLA4, 30-64 days, 427.4, n=5; IFN+CTLA4: 25-64 days, 444.9, n=7). b, Percentage of OVA-specific T cells within CD8+T cells in the PB of mice from (a). *p<0.05, **p<0.01, ****p<0.0001, nonparametric rank-based method for longitudinal data in factorial experiments. c, Clonality and similarity of the TCR-beta CDR repertoire of tumor-free long-term surviving mice (each arrow represents a mouse) from
[0178]
[0179] Absolute numbers (meanSEM) of parental ALL in the peripheral blood (PB) over time of CTRL (n=10, treated with isotype control antibody), IFN (n=10, treated with isotype control antibody), CTRL+CTLA4 (n=14) and IFN+CTLA4 (n=13) mice. Each dot represents a single mouse. *p<0.05, **p<0.01, ****p<0.0001, nonparametric rank-based method for longitudinal data in factorial experiments.
[0180]
[0181] Percentage of DCs presenting the immune-dominant OVA (SINFEKL) peptide on MHC-I molecules in the BM of mice from CTRL+ALL (n=7) and IFN+ALL (n=8). *p<0.05 Mann-Whitney test.
[0182]
[0183] a,b, Volcano plots (left panels) showing differentially expressed genes (abs. log.sub.2FC>1.5, FDR<0.05) up-regulated (green) or down-regulated (orange) in splenic macrophages from tumor-bearing (ALL) vs. control (CTRL) mice (a) or ALL mice treated (IFN+ALL) or not (ALL) with IFN gene therapy (b). Bar plots (right panel) show GO terms enriched in up-regulated (green) or down-regulated (orange) genes from the indicated comparisons. c,d, Selected RNA-Seq snapshots of deregulated genes in macrophages from ALL mice (c) or ISGs induced in IFN+ALL mice (d). e, f, tSNE plots incorporating scRNA-Seq data from 10,821 CD11b.sup.+ cells sorted from the spleen of CTRL or ALL mice, treated or not with IFN gene therapy. Transcriptionally defined clusters and associated cell types (e) are indicated by numbers and colours in the legend. Single-cell RNA-Seq data in cells from cluster 1 (non-classical monocytes), coloured based on the experimental condition (f). g, GO terms enriched in the top 100 genes (ranked by log.sub.2FC) up-regulated (green) or down-regulated (orange) in scRNA-Seq data from cluster 1 (non-classical monocytes) in the indicated comparisons. h, Mean expression (log transformed TPM values, normalized for number of cells) in non-classical monocytes of selected genes for the indicated conditions. i, Minimum spanning tree (MST) analysis of scRNA-Seq data from cluster 1 (non-classical monocytes), after sub-clustering. Each pie represents a sub-cluster and shows its size (number of cells) and composition (experimental condition). Pies marked by asterisks represent minor sub-clusters with dispersed composition.
[0184]
[0185] a, b, Experimental design (a) and ALL growth over time (b, absolute numbers in PB; meanSEM) in CTRL+CTRLT (n=5), IFN+CTRLT (n=5), CTRL+CART19 (n=7), IFN+CART19 (n=7). ****p<0.0001, nonparametric rank-based method for longitudinal data in factorial experiments. c, Percentage (meanSEM) of Lag3 expression on CD8+NGFR+CART19 cells in the PB of mice from (b). Long-term surviving mice are shown in green. Each line represents a single mouse. d, e, Experimental design (d) and ALL growth over time (e, absolute numbers in PB; meanSEM) in CTRL+CTRLT (n=7), IFN+CTRLT (n=6), CTRL +CART19 (n=7), IFN+CART19 (n=6), CTRL+iCART19 (n=7), IFN+iCART19 (n=6), IFN +CTRLT late (n=6, late intervention trial), IFN+iCART19 late (n=6, late intervention trial). ****p<0.0001, nonparametric rank-based method for longitudinal data in factorial experiments. Statistical analyses is performed on selected groups (see Supplementary Online Table 9 and 10) f, Percentage overtime (meanSEM) of Lag3 expression on CD8+NGFR+CART19 cells in the PB of mice from (b). CTRL+CART19 and CTRL +iCART19 mice are plotted together. Long-term surviving mice are shown in green. Each line represents a single mouse. g, Survival curve of mice treated with CART19 or iCART19 cells from (b and e). CTRL mice treated with CART19 and iCART19 from
[0186]
[0187] Survival curve of ALL-injected CTRL (n=10, treated with isotype control antibody), IFN (n=10, treated with isotype control antibody), CTRL+CTLA4 (n=14) and IFN+CTLA4 (n=13) mice. **p<0.01, Mantel-Haenszel test.
[0188]
[0189] a, Box plots showing expression levels in the indicated conditions of genes up-regulated (n=213) or down-regulated (n=258) in macrophages from ALL mice treated with IFN gene therapy (IFN+ALL) as compared to ALL controls. Numbers represent results of Wilcoxon signed-rank test in the indicated comparisons. b, Heatmap of correlation between RNA-Seq datasets in macrophages from the indicated conditions. Numbers indicate calculated coefficients of determination (R.sup.2). Samples are ordered based on unsupervised hierarchical clustering.
[0190]
[0191] a, tSNE plots showing single-cell expression levels of the indicated gene signatures (GS). Non-classical monocytes: Cd300e, 1700011I03Rik, Tspan9, Dmpk, Fxyd2; classical monocytes: Ly6c2, Tarm, Tfec, Psrc1, Mmp8; neutrophils: II1f9, Pglyrp4, NIrp12, Mrgpra2b, Mmp8, Ltf, Amer2, Sffa2I1, Gm5483; dendritic cells: Adam23, Procr, Mab21I3, Sucnr1, Fndc5, Rnf186, Flt3, Cd207, Adam11, Apol7c, Htr7; macrophages: Vcam1, Mertk, Actn1, Fcna, Crip2, Spic, Kcna2, Gfra2, Stab2, Jup; NK cells: Khdc1c, Khdc1b, Phactr3, Col8a2, Klra4, Adamts14, Gzma, Cma1, Gzmb, Clip4; T cells: Cd3g, Cd3e, Bclllb, Actn2, Camk4; B cells: Pax5, Cd79a, Cd19, Chst3, Scn4a, Cacnali, Ly6d, KIhI14, Mzb1. Colour scale reflects average expression (log transformed TPM) across genes within each signature. b, Heatmap showing expression (scaled log transformed TPM values) of top 20 discriminative genes for each cluster. Selected representative genes for each cluster are shown on the right. Up to 200 single cells are shown for each cluster.
[0192]
[0193] tSNE plots showing scRNA-Seq data from clusters 2-11, coloured based on the experimental condition.
[0194]
[0195] a, Flow cytometric plots showing OVA-ALL cells (top) and OVA-specific CD8 T cells (bottom) in the spleen from 3 representative ALL-injected CTRL (CTRL+ALL), IFN non responder (IFN+ALL NR) and IFN responder (IFN+ALL R) mice. CD11b+ cells from these mice were analysed by scRNA-seq. b, tSNE plots showing sub-cluster of cells within the non-classical monocyte population, coloured based on clustering (top plot) or experimental condition (bottom plot). Circled sub-clusters represent minor sub-clusters with dispersed composition and correspond to those marked by asterisks in
[0196]
[0197] a, Schematic representation of the bidirectional LV (BdLV) used to transduced mouse T cells and percentage of NGFR expression in un-transduced (UT) and transduced (CART19) CD4 and CD8 T cells prior to infusion in the mice from
[0198]
[0199] a, Percentage of NGFR expression in un-transduced (UT) and transduced (CART19) CD4 and CD8 T cells prior to infusion in the mice from
[0200]
[0201] Structure of constructs NGFR control (top), Tig126/130a (middle) and Tta126/130a (bottom)
[0202]
[0203] Assessment of IFN delivery on leukaemia growth and the protumoral microenvironment induced by the leukaemia.
[0204]
[0205] Assessment of contemporaneous delivery of several immunostimulatory cytokines into the leukaemia microenvironment using the Tie2 vector backbone.
[0206]
[0207] Assessment of synergy between gene therapy-based delivery of IFN with other immunotherapeutic strategies, including the checkpoint inhibitors anti-CTLA-4 and anti-LAG-3, and the indoleamine-2,3-dioxygenase (IDO) inhibitor, 1-Methyl-Tryptophan (1-MT).
DETAILED DESCRIPTION
[0208] Cells
[0209] A stem cell is able to differentiate into many cell types. A cell that is able to differentiate into all cell types is known as totipotent. In mammals, only the zygote and early embryonic cells are totipotent. Stem cells are found in most, if not all, multicellular organisms. They are characterised by the ability to renew themselves through mitotic cell division and differentiate into a diverse range of specialised cell types. The two broad types of mammalian stem cells are embryonic stem cells that are isolated from the inner cell mass of blastocysts, and adult stem cells that are found in adult tissues. In a developing embryo, stem cells can differentiate into all of the specialised embryonic tissues. In adult organisms, stem cells and progenitor cells act as a repair system for the body, replenishing specialised cells, but also maintaining the normal turnover of regenerative organs, such as blood, skin or intestinal tissues.
[0210] Haematopoietic stem cells (HSCs) are multipotent stem cells that may be found, for example, in peripheral blood, bone marrow and umbilical cord blood. HSCs are capable of self-renewal and differentiation into any blood cell lineage. They are capable of recolonising the entire immune system, and the erythroid and myeloid lineages in all the haematopoietic tissues (such as bone marrow, spleen and thymus). They provide for life-long production of all lineages of haematopoietic cells.
[0211] Haematopoietic progenitor cells (HPCs) have the capacity to differentiate into a specific type of cell. In contrast to stem cells however, they are already far more specific: they are pushed to differentiate into their target cell. A difference between HSCs and HPCs is that HSCs can replicate indefinitely, whereas HPCs can only divide a limited number of times.
[0212] In one embodiment, the present invention may use a mixed population of cells comprising HSCs and HPCs (e.g. a HSPC population).
[0213] A differentiated cell is a cell which has become more specialised in comparison to a stem cell or progenitor cell. Differentiation occurs during the development of a multicellular organism as the organism changes from a single zygote to a complex system of tissues and cell types. Differentiation is also a common process in adults: adult stem cells divide and create fully-differentiated daughter cells during tissue repair and normal cell turnover. Differentiation dramatically changes a cell's size, shape, membrane potential, metabolic activity and responsiveness to signals. These changes are largely due to highly-controlled modifications in gene expression. In other words a differentiated cell is a cell which has specific structures and performs certain functions due to a developmental process which involves the activation and deactivation of specific genes. Here, a differentiated cell includes differentiated cells of the haematopoietic lineage such as monocytes, macrophages, neutrophils, basophils, eosinophils, erythrocytes, megakaryocytes/platelets, dendritic cells, T-cells, B-cells and NK-cells. For example, differentiated cells of the haematopoietic lineage can be distinguished from HSCs and HPCs by detection of cell surface molecules which are not expressed or are expressed to a lesser degree on undifferentiated cells (HSCs and HPCs). Examples of suitable human lineage markers include CD33, CD13, CD14, CD15 (myeloid), CD19, CD20, CD22, CD79a (B), CD36, CD71, CD235a (erythroid), CD2, CD3, CD4, CD8 (T), CD56 (NK).
[0214] Cell Source
[0215] In one embodiment, the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte used in the present invention is obtained from a tissue sample.
[0216] For example, the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte can be obtained from adult and foetal peripheral blood, umbilical cord blood, bone marrow, liver or spleen. Preferably, these cells are obtained from peripheral blood or bone marrow. They may be obtained after mobilisation of the cells in vivo by means of growth factor treatment.
[0217] Mobilisation of HSC or HPC may be carried out using, for example, G-CSF, plerixaphor or combinations thereof. Other agents, such as NSAIDs, CXCR2 ligands (Grobeta) and dipeptidyl peptidase inhibitors may also be useful as mobilising agents.
[0218] With the availability of the stem cell growth factors GM-CSF and G-CSF, most haematopoietic stem cell transplantation procedures are now performed using stem cells collected from the peripheral blood, rather than from the bone marrow. Collecting peripheral blood stem cells provides a bigger graft, does not require that the donor be subjected to general anaesthesia to collect the graft, results in a shorter time to engraftment and may provide for a lower long-term relapse rate.
[0219] Bone marrow may be collected by standard aspiration methods (either steady-state or after mobilisation), or by using next-generation harvesting tools.
[0220] In addition, HSCs may also be derived from induced pluripotent stem cells.
[0221] HSC Characteristics
[0222] HSCs are typically of low forward scatter and side scatter profile by flow cytometric procedures. Some are metabolically quiescent, as demonstrated by Rhodamine labelling which allows determination of mitochondrial activity. HSCs may comprise certain cell surface markers such as CD34, CD45, CD133, CD90 and CD49f. They may also be defined as cells lacking the expression of the CD38 and CD45RA cell surface markers. However, expression of some of these markers is dependent upon the developmental stage and tissue-specific context of the HSC. Some HSCs called side population cells exclude the Hoechst 33342 dye as detected by flow cytometry. Thus, HSCs have descriptive characteristics that allow for their identification and isolation.
[0223] Negative Markers
[0224] CD38 is the most established and useful single negative marker for human HSCs.
[0225] Human HSCs may also be negative for lineage markers such as CD2, CD3, CD14, CD16, CD19, CD20, CD24, CD36, CD56, CD66b, CD271 and CD45RA. However, these markers may need to be used in combination for HSC enrichment.
[0226] By negative marker it is to be understood that human HSCs lack the expression of these markers.
[0227] Positive Markers
[0228] CD34 and CD133 are the most useful positive markers for HSCs.
[0229] Some HSCs are also positive for lineage markers such as CD90, CD49f and CD93. However, these markers may need to be used in combination for HSC enrichment.
[0230] By positive marker it is to be understood that human HSCs express these markers.
[0231] Accordingly, the therapeutic population of cells may be CD34.sup.+CD38.sup.. Further separations may be carried out to obtain, for example, CD34.sup.+CD38.sup.CD45RA.sup.CD90.sup.+CD49f.sup.+ cells.
[0232] miRNA Expression
[0233] The expression of miRNAs mir-126 and mir-130a in a cell indicates that the cell is a HSC or a HPC. More specifically, mir-126 expression indicates that the cell is a primitive HPC. Mir-130a expression indicates that the cell is a more primitive HPC.
[0234] Cytokines
[0235] Cytokines are a category of small proteins, typically approximately 5-20 kDa in size, that play an important role in cell signalling. Cytokines may include interferons, chemokines, interleukins, lymphokines and tumour necrosis factors, and are produced by a broad range of cells, including macrophages, B lymphocytes, T lymphocytes, mast cells, endothelial cells and fibroblasts.
[0236] Cytokines act through receptors, and have a particularly important role in the immune system, modulating the balance between humoral and cell-based immune responses.
[0237] Cytokines include interferons (IFNs), IL-12 and granulocyte-macrophage colony-stimulating factor (GM-CSF).
[0238] Interferons (IFNs) are a group of signalling proteins that are made by host cells in response to the presence of pathogens (e.g. viruses, bacteria and parasites) and tumour cells.
[0239] IFNs are typically divided into three classes: type I, type II, and type III.
[0240] Type I Interferons (IFNs)
[0241] Type I interferons (IFNs) are a class of cytokines produced by immunes cells (leukocytes, e.g. NK cells, B-cells, T-cells, macrophages etc.). Type I IFNs are referred to as pleiotropic cytokines as they can have a specific IFN effect on multiple cell types.
[0242] In one embodiment, the type I IFN is interferon-alpha (IFN). IFN is also known as IFN-alpha, IFN, INF-1/13.
[0243] An example IFN amino acid sequence is:
TABLE-US-00001 (SEQ ID NO: 6) MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLF SCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWD ETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRIT LYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
[0244] In one embodiment, the nucleotide sequence encoding the type I IFN encodes an IFN protein comprising the amino acid sequence of SEQ ID NO:6. In one embodiment, the nucleotide sequence encoding the type I IFN encodes an IFN protein comprising an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO:6, and wherein the functionality of a IFN protein having the amino acid sequence of SEQ ID NO:6 is substantially maintained.
[0245] An example nucleotide sequence encoding an IFN is:
TABLE-US-00002 (SEQ ID NO: 7) ATGGCCTTGACCTTTGCTTTACTGGTGGCCCTCCTGGTGCTCAGCTGCAA GTCAAGCTGCTCTGTGGGCTGTGATCTGCCTCAAACCCACAGCCTGGGTA GCAGGAGGACCTTGATGCTCCTGGCACAGATGAGGAGAATCTCTCTTTTC TCCTGCTTGAAGGACAGACATGACTTTGGATTTCCCCAGGAGGAGTTTGG CAACCAGTTCCAAAAGGCTGAAACCATCCCTGTCCTCCATGAGATGATCC AGCAGATCTTCAATCTCTTCAGCACAAAGGACTCATCTGCTGCTTGGGAT GAGACCCTCCTAGACAAATTCTACACTGAACTCTACCAGCAGCTGAATGA CCTGGAAGCCTGTGTGATACAGGGGGTGGGGGTGACAGAGACTCCCCTG ATGAAGGAGGACTCCATTCTGGCTGTGAGGAAATACTTCCAAAGAATCAC TCTCTATCTGAAAGAGAAGAAATACAGCCCTTGTGCCTGGGAGGTTGTCA GAGCAGAAATCATGAGATCTTTTTCTTTGTCAACAAACTTGCAAGAAAGT TTAAGAAGTAAGGAATGA
[0246] In one embodiment, the nucleotide sequence encoding IFN comprises the nucleotide sequence of SEQ ID NO: 7. In one embodiment, the nucleotide sequence encoding IFNa comprises a nucleotide sequence having at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO:7, wherein said nucleotide sequence encodes a protein having substantially the same function as the protein of SEQ ID NO: 6.
[0247] In one embodiment, the type 1 IFN is interferon-beta (IFN; IFNb).
[0248] An example IFN amino acid sequence is:
TABLE-US-00003 (SEQ ID NO: 8) MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLE YCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGW NETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRI LHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
[0249] In one embodiment, the nucleotide sequence encoding the type I IFN encodes an IFN protein comprising the amino acid sequence of SEQ ID NO: 8. In one embodiment, the nucleotide sequence encoding the type I IFN encodes a IFN protein comprising an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 8, and wherein the functionality of a IFN protein having the amino acid sequence of SEQ ID NO: 8 is substantially maintained.
[0250] An example nucleotide sequence encoding an IFN is:
TABLE-US-00004 (SEQ ID NO: 9) gaattctcaggtcgtttgctttcctttgctttctcccaagtcttgtttta caatttgctttagtcattcactgaaactttaaaaaacattagaaaacctc acagtttgtaaatctttttccctattatatatatcataagataggagctt aaataaagagttttagaaactactaaaatgtaaatgacataggaaaactg aaagggagaagtgaaagtgggaaattcctctgaatagagagaggaccatc tcatataaataggccatacccacggagaaaggacattctaactgcaacct ttcgaagcctttgctctggcacaacaggtagtaggcgacactgttcgtgt tgtcaacatgaccaacaagtgtctcctccaaattgctctcctgttgtgct tctccactacagctctttccatgagctacaacttgcttggattcctacaa agaagcagcaattttcagtgtcagaagctcctgtggcaattgaatgggag gcttgaatactgcctcaaggacaggatgaactttgacatccctgaggaga ttaagcagctgcagcagttccagaaggaggacgccgcattgaccatctat gagatgctccagaacatctttgctattttcagacaagattcatctagcac tggctggaatgagactattgttgagaacctcctggctaatgtctatcatc agataaaccatctgaagacagtcctggaagaaaaactggagaaagaagat ttcaccaggggaaaactcatgagcagtctgcacctgaaaagatattatgg gaggattctgcattacctgaaggccaaggagtacagtcactgtgcctgga ccatagtcagagtggaaatcctaaggaacttttacttcattaacagactt acaggttacctccgaaactgaagatctcctagcctgtgcctctgggactg gacaattgcttcaagcattcttcaaccagcagatgctgtttaagtgactg atggctaatgtactgcatatgaaaggacactagaagattttgaaattttt attaaattatgagttatttttatttatttaaattttattttggaaaataa attatttttggtgcaaaagtcaacatggcagttttaatttcgatttgatt tatataaccatccatattataaaattgccaagtacctattagttgttctt tttaaaatatacctgcaaagtagtatactttctggcccctgcctttaagg aatttaaaattcaagaaagccatgatggaatatataaggtaagagacaat aaggggacctgaaccttatgggggaataaatatggcatgaactgctgtgg gattaaaagagaaaaggaaagctggagggtctggaactaaacctggggtt cccattcctcctactgtgtgttccagattctctcatcataaagttagaat tgagctggccatcaggaatagccagaggaatatgtcagcttttgtgttct ccctaaccttccccagttatttgggggatcactttgctcctcgaaagatt tttaaataattatgtgccccccaccatccctgcaagcttaagggtgagaa gtcccatttacttccatgacactattaagcagcaatctctttattctgct catcatgggacagccaagatgtgtgggtatcttaggggagctgtgggtcc ctgtctgctggcatggcacaggcatcagaggaagaagaacctttttatac cctagccatctggttagttttctccctagtttttcaaaaaactaagcctg cttccagtccccactgccttgttcatacagaattc
[0251] In one embodiment, the nucleotide sequence encoding IFN comprises the nucleotide sequence of SEQ ID NO: 9. In one embodiment, the nucleotide sequence encoding IFN comprises a nucleotide sequence having at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO:9, wherein said nucleotide sequence encodes a protein having substantially the same function as the IFN protein of SEQ ID NO: 8.
[0252] In one embodiment, the nucleotide sequence encoding type I IFN is codon optimised.
[0253] Type II InterferonInterferon- (IFN)
[0254] Interferon- (IFN), also known as immune interferon, is activated by Interleukin-12 and plays an important role in regulating and activating the immune response.
[0255] An example IFN amino acid sequence is:
TABLE-US-00005 (SEQ ID NO: 12) MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGT LFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDM NVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTG KRKRSQMLFRGRRASQ
[0256] Amino acids 1-23 of SEQ ID NO: 12 may act as a signal peptide and be cleaved to form a mature protein that is represented by amino acids 24-161 of SEQ ID NO: 12. An example mature amino acid sequence of IFN is:
TABLE-US-00006 (SEQ ID NO: 13) QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIV SFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSV TDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
[0257] In one embodiment, the nucleotide sequence encoding the IFN encodes an IFN protein comprising the amino acid sequence of SEQ ID NO: 12 or 13. In one embodiment, the nucleotide sequence encoding the IFN encodes an IFN protein comprising an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 12 or 13, and wherein the functionality of an IFN protein having the amino acid sequence of SEQ ID NO: 12 or 13 is substantially maintained.
[0258] A further example IFN amino acid sequence is:
TABLE-US-00007 (SEQ ID NO: 17) MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLF LDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLIT TFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKR KRSRC
[0259] In one embodiment, the nucleotide sequence encoding the IFN encodes an IFN protein comprising the amino acid sequence of SEQ ID NO: 17. In one embodiment, the nucleotide sequence encoding the IFN encodes an IFN protein comprising an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 17, and wherein the functionality of an IFN protein having the amino acid sequence of SEQ ID NO: 17 is substantially maintained.
[0260] An example nucleotide sequence encoding an IFN is:
TABLE-US-00008 (SEQ ID NO: 14) ATGAAATATACAAGTTATATCTTGGCTTTTCAGCTCTGCATCGTTTTGGG TTCTCTTGGCTGTTACTGCCAGGACCCATATGTAAAAGAAGCAGAAAACC TTAAGAAATATTTTAATGCAGGTCATTCAGATGTAGCGGATAATGGAACT CTTTTCTTAGGCATTTTGAAGAATTGGAAAGAGGAGAGTGACAGAAAAAT AATGCAGAGCCAAATTGTCTCCTTTTACTTCAAACTTTTTAAAAACTTTA AAGATGACCAGAGCATCCAAAAGAGTGTGGAGACCATCAAGGAAGACATG AATGTCAAGTTTTTCAATAGCAACAAAAAGAAACGAGATGACTTCGAAAA GCTGACTAATTATTCGGTAACTGACTTGAATGTCCAACGCAAAGCAATAC ATGAACTCATCCAAGTGATGGCTGAACTGTCGCCAGCAGCTAAAACAGGG AAGCGAAAAAGGAGTCAGATGCTGTTTCGAGGTCGAAGAGCATCCCAGTA A
[0261] An example nucleotide sequence encoding a mature form of IFN is:
TABLE-US-00009 (SEQ ID NO: 15) CAGGACCCATATGTAAAAGAAGCAGAAAACCTTAAGAAATATTTTAATGC AGGTCATTCAGATGTAGCGGATAATGGAACTCTTTTCTTAGGCATTTTGA AGAATTGGAAAGAGGAGAGTGACAGAAAAATAATGCAGAGCCAAATTGTC TCCTTTTACTTCAAACTTTTTAAAAACTTTAAAGATGACCAGAGCATCCA AAAGAGTGTGGAGACCATCAAGGAAGACATGAATGTCAAGTTTTTCAATA GCAACAAAAAGAAACGAGATGACTTCGAAAAGCTGACTAATTATTCGGTA ACTGACTTGAATGTCCAACGCAAAGCAATACATGAACTCATCCAAGTGAT GGCTGAACTGTCGCCAGCAGCTAAAACAGGGAAGCGAAAAAGGAGTCAGA TGCTGTTTCGAGGT
[0262] A further example nucleotide sequence encoding an IFN is:
TABLE-US-00010 (SEQ ID NO: 16) ATGAACGCTACACACTGCATCTTGGCTTTGCAGCTCTTCCTCATGGCTGT TTCTGGCTGTTACTGCCACGGCACAGTCATTGAAAGCCTAGAAAGTCTGA ATAACTATTTTAACTCAAGTGGCATAGATGTGGAAGAAAAGAGTCTCTTC TTGGATATCTGGAGGAACTGGCAAAAGGATGGTGACATGAAAATCCTGCA GAGCCAGATTATCTCTTTCTACCTCAGACTCTTTGAAGTCTTGAAAGACA ATCAGGCCATCAGCAACAACATAAGCGTCATTGAATCACACCTGATTACT ACCTTCTTCAGCAACAGCAAGGCGAAAAAGGATGCATTCATGAGTATTGC CAAGTTTGAGGTCAACAACCCACAGGTCCAGCGCCAAGCATTCAATGAGC TCATCCGAGTGGTCCACCAGCTGTTGCCGGAATCCAGCCTCAGGAAGCGG AAAAGGAGTCGCTGCTGA
[0263] In one embodiment, the nucleotide sequence encoding IFN comprises the nucleotide sequence of SEQ ID NO: 14, 15 or 16. In one embodiment, the nucleotide sequence encoding IFN comprises a nucleotide sequence having at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 14, 15 or 16, wherein said nucleotide sequence encodes a protein having substantially the same function as the protein of SEQ ID NO: 12 or 13.
[0264] A further example nucleotide sequence encoding an IFN is:
TABLE-US-00011 (SEQ ID NO: 18) ATGAACGCTACACACTGCATCTTGGCTTTGCAGCTCTTCCTCATGGCTGT TTCTGGCTGTTACTGCCACGGCACAGTCATTGAAAGCCTAGAAAGTCTGA ATAACTATTTTAACTCAAGTGGCATAGATGTGGAAGAAAAGAGTCTCTTC TTGGATATCTGGAGGAACTGGCAAAAGGATGGTGACATGAAAATCCTGCA GAGCCAGATTATCTCTTTCTACCTCAGACTCTTTGAAGTCTTGAAAGACA ATCAGGCCATCAGCAACAACATAAGCGTCATTGAATCACACCTGATTACT ACCTTCTTCAGCAACAGCAAGGCGAAAAAGGATGCATTCATGAGTATTGC CAAGTTTGAGGTCAACAACCCACAGGTCCAGCGCCAAGCATTCAATGAGC TCATCCGAGTGGTCCACCAGCTGTTGCCGGAATCCAGCCTCAGGAAGCGG AAAAGGAGTCGCTGCTGA
[0265] In one embodiment, the nucleotide sequence encoding IFN comprises the nucleotide sequence of SEQ ID NO: 18. In one embodiment, the nucleotide sequence encoding IFN comprises a nucleotide sequence having at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 18, wherein said nucleotide sequence encodes a protein having substantially the same function as the protein of SEQ ID NO: 17.
[0266] In one embodiment, the nucleotide sequence encoding the IFN is codon optimised.
[0267] Tumour Necrosis Factor (TNF)
[0268] Tumor necrosis factor a (TNF) is a cytokine that is involved in systemic inflammation. Its primary role is in the regulation of immune cells.
[0269] TNF is mainly produced by activated macrophages, but is also produced by other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons.
[0270] An example TNF amino acid sequence is:
TABLE-US-00012 (SEQ ID NO: 19) MSTESMIRDVELAEEALPQKMGGFQNSRRCLCLSLFSFLLVAGATTLFCL LNFGVIGPQRDEKFPNGLPLISSMAQTLTLRSSSQNSSDKPVAHVVANHQ VEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPD YVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGG VFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
[0271] In one embodiment, the nucleotide sequence encoding TNF encodes a TNF protein comprising the amino acid sequence of SEQ ID NO: 19. In one embodiment, the nucleotide sequence encoding the TNF encodes a TNF protein comprising an amino acid sequence having at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 19, and wherein the functionality of a TNF protein having the amino acid sequence of SEQ ID NO: 19 is substantially maintained.
[0272] An example nucleotide sequence encoding a TNF is:
TABLE-US-00013 (SEQ ID NO: 20) ATGAGCACAGAAAGCATGATCCGCGACGTGGAACTGGCAGAAGAGGCACT CCCCCAAAAGATGGGGGGCTTCCAGAACTCCAGGCGGTGCCTATGTCTCA GCCTCTTCTCATTCCTGCTTGTGGCAGGGGCCACCACGCTCTTCTGTCTA CTGAACTTCGGGGTGATCGGTCCCCAAAGGGATGAGAAGTTCCCAAATGG CCTCCCTCTCATCAGTTCTATGGCCCAGACCCTCACACTCAGATCATCTT CTCAAAATTCGAGTGACAAGCCTGTAGCCCACGTCGTAGCAAACCACCAA GTGGAGGAGCAGCTGGAGTGGCTGAGCCAGCGCGCCAACGCCCTCCTGGC CAACGGCATGGATCTCAAAGACAACCAACTAGTGGTGCCAGCCGATGGGT TGTACCTTGTCTACTCCCAGGTTCTCTTCAAGGGACAAGGCTGCCCCGAC TACGTGCTCCTCACCCACACCGTCAGCCGATTTGCTATCTCATACCAGGA GAAAGTCAACCTCCTCTCTGCCGTCAAGAGCCCCTGCCCCAAGGACACCC CTGAGGGGGCTGAGCTCAAACCCTGGTATGAGCCCATATACCTGGGAGGA GTCTTCCAGCTGGAGAAGGGGGACCAACTCAGCGCTGAGGTCAATCTGCC CAAGTACTTAGACTTTGCGGAGTCCGGGCAGGTCTACTTTGGAGTCATTG CTCTG
[0273] In one embodiment, the nucleotide sequence encoding TNF comprises the nucleotide sequence of SEQ ID NO: 20. In one embodiment, the nucleotide sequence encoding TNFa comprises a nucleotide sequence having at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 20, wherein said nucleotide sequence encodes a protein having substantially the same function as the protein of SEQ ID NO: 19.
[0274] 1-Methyl-Tryptophan (1-MT)
[0275] 1-Methyltryptophan (1-MT) is an inhibitor of the tryptophan catabolic enzyme indoleamine 2,3-dioxygenase (IDO) and has the structure:
##STR00001##
[0276] The 1-MT of the present invention can be present as a salt or ester, in particular a pharmaceutically-acceptable salt or ester.
[0277] In one embodiment, the 1-ML is D-1-MT. In one embodiment, the 1-ML is L-1-MT. In one embodiment, the 1-ML is a racemic mixture.
[0278] Pharmaceutically-acceptable salts of the agents of the invention include suitable acid addition or base salts thereof. A review of suitable pharmaceutical salts may be found in Berge et al. (1977) J Pharm Sci 66: 1-19.
[0279] The invention also includes where appropriate all enantiomers and tautomers of the agents. The skilled person will recognise compounds that possess optical properties (e.g. one or more chiral carbon atoms) or tautomeric characteristics. The corresponding enantiomers and/or tautomers may be isolated/prepared by methods known in the art.
[0280] Micro RNA Target Sequence
[0281] MicroRNA genes are scattered across all human chromosomes, except for the Y chromosome. They can be either located in non-coding regions of the genome or within introns of protein-coding genes. Around 50% of miRNAs appear in clusters which are transcribed as polycistronic primary transcripts. Similar to protein-coding genes, miRNAs are usually transcribed from polymerase-II promoters, generating a so-called primary miRNA transcript (pri-miRNA). This pri-miRNA is then processed through a series of endonucleolytic cleavage steps, performed by two enzymes belonging to the RNAse Type III family, Drosha and Dicer. From the pri-miRNA, a stem loop of about 60 nucleotides in length, called mirna precursor (pre-mirna), is excised by a specific nuclear complex, composed of Drosha and DiGeorge syndrome critical region gene (DGCR8), which crops both strands near the base of the primary stem loop and leaves a 5 phosphate and a 2 bp long, 3 overhang. The pre-mirna is then actively transported from the nucleus to the cytoplasm by RAN-GTP and Exportin. Then, Dicer performs a double strand cut at the end of the stem loop not defined by the Drosha cut, generating a 19-24 bp duplex, which is composed of the mature miRNA and the opposite strand of the duplex, called miRNA*. In agreement with the thermodynamic asymmetry rule, only one strand of the duplex is selectively loaded into the RNA-induced silencing complex (RISC), and accumulates as the mature microRNA. This strand is usually the one whose 5 end is less tightly paired to its complement, as was demonstrated by single-nucleotide mismatches introduced into the 5 end of each strand of siRNA duplexes. However, there are some miRNAs that support accumulation of both duplex strands to similar extent.
[0282] MicroRNAs trigger RNAi, very much like small interfering RNAs (siRNA) which are extensively being used for experimental gene knockdown. The main difference between miRNA and siRNA is their biogenesis. Once loaded into RISC, the guide strand of the small RNA molecule interacts with mRNA target sequences preferentially found in the 3 untranslated region (3UTR) of protein-coding genes. It has been shown that nucleotides 2-8 counted from the 5 end of the miRNA, the so-called seed sequence, are essential for triggering RNAi. If the whole guide strand sequence is perfectly complementary to the mRNA target, as is usually the case for siRNAs and plant miRNAs, the mRNA is endonucleolytically cleaved by involvement of the Argonaute (Ago) protein, also called slicer of the small RNA duplex into the RNA-induced silencing complex (RISC). DGRC (DiGeorge syndrome critical region gene 8) and TRBP (TAR (HIV) RNA binding protein 2) are double-stranded RNA-binding proteins that facilitate mature miRNA biogenesis by Drosha and Dicer RNase III enzymes, respectively. The guide strand of the miRNA duplex gets incorporated into the effector complex RISC, which recognizes specific targets through imperfect base-pairing and induces post-transcriptional gene silencing. Several mechanisms have been proposed for this mode of regulation: miRNAs can induce the repression of translation initiation, mark target mRNAs for degradation by deadenylation, or sequester targets into the cytoplasmic P-body.
[0283] On the other hand, if only the seed is perfectly complementary to the target mRNA but the remaining bases show incomplete pairing, RNAi acts through multiple mechanisms leading to translational repression. Eukaryotic mRNA degradation mainly occurs through the shortening of the polyA tail at the 3 end of the mRNA, and de-capping at the 5 end, followed by 5-3 exonuclease digestion and accumulation of the miRNA in discrete cytoplasmic areas, the so called P-bodies, enriched in components of the mRNA decay pathway.
[0284] According to the present invention, expression of the cytokine, such as the type 1 IFN is regulated by endogenous miRNAs using corresponding miRNA target sequences. Using this method, a miRNA endogenously expressed in a cell prevents or reduces transgene expression in that cell by binding to its corresponding miRNA target sequence positioned in the vector or polynucleotide. This has a number of advantages over relying on tissue specific promoters, not least the fact that tissue specific promoters are often associated with leaky expression in a fraction of non-target cells.
[0285] miRNA target sequences that are useful in the present invention are miRNA target sequences which are expressed in HSCs but which are not expressed extensively in differentiated cells e.g., myeloid cells (including tumor-infiltrating macrophages). This is particularly important since IFN expression is known to be toxic to HSCs.
[0286] Preferred examples of miRNA target sequences for use in the invention are mir-130a and mir-126.
[0287] Binding of mir-126 miRNA to the mir-126 target sequence blocks expression most effectively in HSC and in cells of the erythroid lineage. Thus, the mir-126 target sequence is particularly suitable for gene therapy applications relying on robust transgene expression in the myeloid and lymphoid lineage.
[0288] The mir-126 miRNA may have the nucleotide sequence: UCGUACCGUGAGUAAUAAUGCG (SEQ ID NO: 1).
[0289] In one embodiment, the mir-126 target sequence comprises the nucleotide sequence of GCATTATTACTCACGGTACGA (SEQ ID NO:2).
[0290] In one embodiment, the vector or polynucleotide used in the present invention comprises at least one, at least two, or at least three, copies of the nucleotide sequence of SEQ ID NO:2. In a preferred embodiment, the mir-126 target sequence comprises two copies of the nucleotide sequence of SEQ ID NO: 2.
[0291] In one embodiment the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte used in the present invention comprise at least one, at least two, or at least three, copies of the nucleotide sequence of SEQ ID NO:2. In a preferred embodiment, the mir-126 target sequence comprises two copies of the nucleotide sequence of SEQ ID NO: 2.
[0292] The copies mir-126 target sequences may be separated by a spacer sequence. The spacer sequence may comprise at least one, at least two, at least three or at least four or at least five nucleotide bases.
[0293] Binding of mir-130a miRNA to the mir-130a target sequence blocks expression most effectively in HSC and in cells of the erythroid lineage (similar to miR-126). Thus, the miR-130a target sequence is particularly suitable for gene therapy applications relying on robust transgene expression in the myeloid and lymphoid lineage.
[0294] The mir-130a miRNA may have the nucleotide sequence of:
TABLE-US-00014 (SEQ ID NO: 3) CAGUGCAAUGUUAAAAGGGCAU.
[0295] In one embodiment, the mir-130a target sequence comprises the nucleotide sequence of ATGCCCTTTTAACATTGCACTG (SEQ ID NO: 4).
[0296] In one embodiment, the mir-130a target sequence comprises at least one, at least two or at least three copies of the nucleotide sequence of SEQ ID NO: 4. In a preferred embodiment, the mir-130a target sequence comprises two copies of the nucleotide sequence of SEQ ID NO: 4.
[0297] The copies mir-130a target sequences may be separated by a spacer sequence. The spacer sequence may comprise at least one, at least two, at least three, at least four, or at least five nucleotide bases.
[0298] In one embodiment, the vector comprises two copies of a mir-126 target sequence and two copies of a mir-130a target sequence.
[0299] In one embodiment, two copies of the mir-126 target sequence and two copies of the mir-130a target sequence are comprised in the nucleotide sequence of:
TABLE-US-00015 (SEQ ID NO: 5) GCATTATTACTCACGGTACGACGATGCATTATTACTCACGGTACGAACGC GTATGCCCTTTTAACATTGCACTGATGCATATGCCCTTTTAACATTGCAC TG.
[0300] Combination target sequence, e.g. a target sequence comprising two copies of the mir-126 target sequence and two copies of the mir-130a target sequence are a particular preferred for use in the present invention since use of this combination maximizes repression of the vector in HSC and expression in the myeloid progeny.
[0301] Furthermore, when using the combination target, transgene downregulation in HSC is assured by two independent miRNAs, and the risk of interfering with endogenous miRNA regulation is reduced, thus increasing safety and efficacy of the target sequence.
[0302] Vector
[0303] A vector is a tool that allows or facilitates the transfer of an entity from one environment to another. In accordance with the present invention, and by way of example, some vectors used in recombinant nucleic acid techniques allow entities, such as a segment of nucleic acid (e.g. a heterologous DNA segment, such as a heterologous Cdna segment), to be transferred into a target cell. The vector may serve the purpose of maintaining the heterologous nucleic acid (DNA or RNA) within the cell, facilitating the replication of the vector comprising a segment of nucleic acid, or facilitating the expression of the protein encoded by a segment of nucleic acid. Vectors may be non-viral or viral. Examples of vectors used in recombinant nucleic acid techniques include, but are not limited to, plasmids, chromosomes, artificial chromosomes and viruses. The vector may also be, for example, a naked nucleic acid (e.g. DNA). In its simplest form, the vector may itself be a nucleotide of interest.
[0304] The vectors used in the invention may be, for example, plasmid or virus vectors and may include a promoter for the expression of a polynucleotide and optionally a regulator of the promoter. In a preferred embodiment the vector is a viral vector.
[0305] Vectors comprising polynucleotides used in the invention may be introduced into cells using a variety of techniques known in the art, such as transformation, transfection and transduction. Several techniques are known in the art, for example transduction with recombinant viral vectors, such as retroviral, lentiviral, adenoviral, adeno-associated viral, baculoviral and herpes simplex viral vectors, Sleeping Beauty vectors; direct injection of nucleic acids and biolistic transformation.
[0306] Non-viral delivery systems include but are not limited to DNA transfection methods. Here, transfection includes a process using a non-viral vector to deliver a gene to a target cell. Typical transfection methods include electroporation, DNA biolistics, lipid-mediated transfection, compacted DNA-mediated transfection, liposomes, immunoliposomes, lipofectin, cationic agent-mediated transfection, cationic facial amphiphiles (CFAs) (Nature Biotechnology 1996 14; 556) and combinations thereof.
[0307] The term transfection is to be understood as encompassing the delivery of polynucleotides to cells by both viral and non-viral delivery.
[0308] In addition, the invention may employ gene targeting protocols, for example the delivery of DNA-modifying agents.
[0309] Viral delivery systems include but are not limited to adenovirus vector, an adeno-associated viral (AAV) vector, a herpes viral vector, a retroviral vector, a lentiviral vector, and a baculoviral vector.
[0310] Retroviruses are RNA viruses with a life cycle different to that of lytic viruses. In this regard, a retrovirus is an infectious entity that replicates through a DNA intermediate. When a retrovirus infects a cell, its genome is converted to a DNA form by a reverse transcriptase enzyme. The DNA copy serves as a template for the production of new RNA genomes and virally encoded proteins necessary for the assembly of infectious viral particles.
[0311] There are many retroviruses, for example murine leukemia virus (MLV), human immunodeficiency virus (HIV), equine infectious anaemia virus (EIAV), mouse mammary tumour virus (MMTV), Rous sarcoma virus (RSV), Fujinami sarcoma virus (FuSV), Moloney murine leukemia virus (Mo-MLV), FBR murine osteosarcoma virus (FBR MSV), Moloney murine sarcoma virus (Mo-MSV), Abelson murine leukemia virus (A-MLV), Avian myelocytomatosis virus-29 (MC29), and Avian erythroblastosis virus (AEV) and all other retroviridiae including lentiviruses.
[0312] A detailed list of retroviruses may be found in Coffin et al (Retroviruses 1997 Cold Spring Harbour Laboratory Press Eds: J M Coffin, S M Hughes, H E Varmus pp 758-763).
[0313] Lentiviruses also belong to the retrovirus family, but they can infect both dividing and non-dividing cells (Lewis et al (1992) EMBO J. 3053-3058).
[0314] In one embodiment, the vector is a lentiviral vector.
[0315] Promoter
[0316] In one embodiment the vector comprises a tissue specific promoter. Preferably, the tissue specific promoter drives specific expression to a subset of tumor infiltrating myeloid cells, such as Tie2 expressing monocytes (TEM) or M2-polarized macrophages.
[0317] In a preferred embodiment, the tissue specific promoter is the TEK (Tie2) promoter.
[0318] An example TEK promoter nucleotide sequence is:
TABLE-US-00016 (SEQ ID NO: 10) gatcacgagactagcctcgagtcacacctgcaaactggaaacattaattg gttcttaagatcatcatcgacgtgataaaacctgggacagaaattagtca agactagctgcatctgccttttcctctggtgggtaggaaaaggaggagta taatgatttcctcaggcatgaaggtcgatgatgagcaaagtgtatactct ctaatctaatgtcataattcatattgtggagtaattatctggataagtgt agggtctctgacctcattctagatattgtacattccatggctattttcat tttggtccatgaactctctttgctctcatgagcaccatttttatcccaat ctaatcctgtatgtttgtgtttttacacagattagtttttaaatgttata tataatttgcttctgaaacaccattgctcaatgactaccaaatctttctc attaccaaaatccttctatgccaacttcttcaagaaatttgatcaccttt agatgaattgttaatgaaaattaaagctatagccggcaacatgggtatct ttgggctaatggccaaccaacaggccatctgtgtgaaagaaaacaggcta acaattttggactctggtctcttggggctacattgagcattgacctcacc ggtgctcactgaaattaattgcttttcaggttgtattttctcatcacgga aaccttcttctcccaattcaaaccatgtgggttaaaatgagaaaacaaaa gccaaaacggcttcccacacccaaaagctccttctgtcagagatcccagt agccccgggagagctgttagaagtctgagaaggattggtcatcatcgcat accatacataggtggagggcttgttattctcagtttcccgcctatgagag gatacccctattgtttctgaaaatgctgaccgggacccacacttccaaca aaaattcctctgcccctacagcagcagcaaaagcagcagcagaagcaaca gcaacagataagtgttttgatgaattgcgagatggatagggcttgagtgc ccccagccctgctgataccaaatgcctttaagatacagcctttcccatcc taatctacaaaggaaacaggaaaaaggaacttaaaactccctgtgctcag acagaaatgagactgttacagcctgcttctgtgctgttccttcttgcctc taacttgtaaacaagacgtagtaggacgatgctaatggaaagtcacaaac cgctgggtttttgaaaggatcctagactcgagcggccgcca
[0319] In one embodiment, the TEK promoter comprises the nucleotide sequence of SEQ ID NO: 10. In one embodiment, the TEK promoter comprises a nucleotide sequence having at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO:10.
[0320] The TEK (Tie2) promoter may be combined with the mir-126 target sequence and/or the mir-130a target sequence. This enables specific transgene expression in a subset of tumor-infiltrating myeloid cells, e.g. tumor infiltrating macrophages.
[0321] In one embodiment, the vector may further comprise a TEK (Tie2) enhancer sequence.
[0322] An example TEK (Tie2) enhancer sequence is:
TABLE-US-00017 (SEQ ID NO: 11) cttcagacctggaggaggagatatgagggaccaattgtggccagacgatt ccttaactcgtgttacacctgcagaatgagttttagatctagctgtgacc tcttcccccagccccacccccattgtccccttgtgtgccttcaggaatct gatcattcttctctcctgctccttcccaaaggctgcaggagcaggtgtga agacgtggatgtgccagatgcagagtcctgacacttttcaacacatctgc atattagaggaagtacatacccattgcttggtggtttcatgtctaatgtg gtatgagtgtgacaaagagagggagaaaatttggactagccaaagaagcc agtcaggcgtggggtttgaagggcatcgtgggcggctgtcatttgctctc tgcttgtcacagccccttgcccagggcttgaccagtgaggtgtatgtgct ggtcacacccatctcagcagatctgtcagctttcccgcttttgttaaagg gtgatatcatgcttcctggggggagcactggaagacaatgctcggccact ttcctccagatacaataggcggagtcaggaaggcagtattgacattgctg gggctggggaggcactcactgctctgcggccgtcagatggtgaaccagct taaccttggcacacagggcctgggttgtgcaaggcgtctggctgcagagc caaaggggactccaccctggggacaggagtgctttagacatctgggaatc tgggatgggcttcaaattctgatccctgtgtcagaaacaaccacaaaaca ataagagtaccagtaataacaaaaatgactaccctaggttgaatgccttt atgtgccaagtgtcaattg
[0323] In one embodiment, the TEK enhancer sequence comprises the nucleotide sequence of SEQ ID NO: 11. In one embodiment, the TEK enhancer comprises a nucleotide sequence having at least 50%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% identity to SEQ ID NO: 11.
[0324] CODON OPTIMISATION
[0325] The polynucleotides used in the present invention may be codon-optimised. Codon optimisation has previously been described in WO 1999/41397 and WO 200.sup.1/.sub.79518. Different cells differ in their usage of particular codons. This codon bias corresponds to a bias in the relative abundance of particular tRNAs in the cell type. By altering the codons in the sequence so that they are tailored to match with the relative abundance of corresponding tRNAs, it is possible to increase expression. By the same token, it is possible to decrease expression by deliberately choosing codons for which the corresponding tRNAs are known to be rare in the particular cell type. Thus, an additional degree of translational control is available.
[0326] Many viruses, including HIV and other lentiviruses, use a large number of rare codons and by changing these to correspond to commonly used mammalian codons, increased expression of the packaging components in mammalian producer cells can be achieved.
[0327] Codon usage tables are known in the art for mammalian cells, as well as for a variety of other organisms.
[0328] Codon optimization may also involve the removal of mRNA instability motifs and cryptic splice sites.
[0329] Tumor Associated Antigen (TAA)
[0330] As used herein the term tumor associated antigen (TAA; also known as a tumor antigen) refers to an antigenic molecule expressed by a cancer cell, e.g. a tumor cell. A TAA may be recognised by an immune cell which expresses an immune receptor (e.g. a TCR, a transgenic TCR or a CAR) that is able to specifically bind to a portion (e.g. an epitope) of the TAA molecule.
[0331] As used herein, the term TAA-specific T-cell refers to a T-cell which expresses a TCR or a CAR that is specific for a TAA.
[0332] A T-cell expressing a TAA-specific TCR or TAA-specific CAR may be able to specifically target and kill tumor cells expressing the TAA. The TAA-specific TCR may be a transgenic TCR
[0333] In one embodiment, the TAA-specific T-cell may not be genetically engineered. The T cells may be naturally induced tumor-specific T cells. For example, the T cells used in the present invention may be expanded from the tumor or lymph node.
[0334] A particular TAA may be expressed at a high relative abundance on a particular type of tumor cell compared to a non-tumor cell (e.g. a healthy cell).
[0335] Examples of TAAs include carcinoembryonic antigen (CEA), estrogen receptor, progesterone receptor, ephrinB2, ROR1, mesothelin, c-Met, GD-2, and MAGE A3 TCR, 4-1BB, adenocarcinoma antigen, alpha-fetoprotein, BAFF, B-lymphoma cell, C242 antigen, carbonic anhydrase 9 (CA-IX), CCR4, CD152, CD200, CD22, CD19, CD22, CD123, CD221, CD23 (IgE receptor), CD28, CD4, CD40, CD44, CD44 v6, CD51, CD52, CD56, CD74, CD80, CS-1, CNT0888, CTLA-4, DR5, EpCAM, CD3, fibronectin extra domain-B, folate receptor 1, glycoprotein 75, GPNMB, HGF, human scatter factor receptor kinase, IGF-1 receptor, IGF-I, IgGI, L1-CAM, IL-13, IL-6, insulin-like growth factor I receptor, integrin 51, integrin v3, MORAb-009, MS4A1, mucin CanAg, N-glycolylneuraminic acid, NPC-1C, PDGF-Ra, PDL192, phosphatidylserine, prostatic carcinoma cells, RANKL, RON, SCH 900105, SDC1, SLAMF7, tenascin C, TGF beta 2, TGF-, TRAIL-R1, TRAIL-R2, tumor antigen CTAA16.88, Vascular endothelial growth, factor (VEGF), VEGF-A, VEGFR-1, VEGFR2, vimentin, 5T4, CD5, CD19, CD20, CD21, CD25, CD37, CD30, CD33, CD45, CAMPATH-1 (CDw52), HLA-DR, Anti-idiotype, TAG-72, Ep-CAM, MUC1, Folate-binding protein, A33, G250, Prostate-specific membrane antigen, (PSMA), Prostate specific antigen (PSA), Ferritin, Gangliosides (e.g. GD2, GD3, GM2), Le.sup.y, CA-125, CA19-9, Epidermal growth factor receptor (EGFR), p185HER2, IL-2 receptor, de2-7 EGFR, Fibroblast activation protein (FAP), Tenascin, metalloproteinases, Endosialin, Carbonic anhydrase, Galectin 9, Aldolase A, elFy4, Tyrosinase, Galectin 4, HERKV-K10, p53, NY-LU-12, Restin, NY-CO-38, MAGE-1, MAGE-4a, SSX2, NY-ESO-1, SCP-1, 707-AP, AFP, ART-4, BAGE, b-catenin/m, Bcr-abl, CAMEL, CAP-1, CASP-8, CDC27m, CDK4/m, CT, Cyp-B, DAM-6 (MAGE-B2) and DAM-10 (MAGE-B1), ELF2M, ETV6-AML1, G250, GAGE, GnT-V, Gp100, HAGE, HER-2/neu, HLA-A*0201-R170I, HPV-E7, HSP70-2M, HST-2, hTERT (hTRT), iCE, KIAA0205, LAGE, LDLR/FUT, MAGE, MART-1/Melan-A, MC1R, Myosin/m, MUC1, MUM-1, MUM-2, MUM-3, NA88-A, NY-ESO-1, P15, p190 minor bcr-abl, Pml/RARa, PRAME, RAGE, RU1, RU2, SAGE, SART-1, SART-3, TEL/AML1, TPI/m, TRP-1, protein 1, gp75, TRP-2, TRP-2/INT2 or WT1.
[0336] Additional TAAs may be identified using methods known in the art - see, e.g. the review article by Zilberberg et al. 2015 (Biology of Blood and Marrow Transplantation, Volume 21, Issue 6, June 2015, Pages 1000-1007) the content of which is incorporated herein by reference.
[0337] T-Cell
[0338] As used herein the term T-cell may refer to CD8+ T-cells, CD4+ T-cells, naive T-cells, memory stem T-cells, central memory T-cells, double negative T-cells, effector memory T-cells, effector T-cells, Th0 cells, Tc0 cells, Th1 cells, Tc1 cells, Th2 cells, Tc2 cells, Th17 cells, Th22 cells, gamma/delta T-cells.
[0339] The T-cell used in the present invention may be used for adoptive T-cell transfer. The present invention also encompasses adoptive transfer of tumor-infiltrating lymphocytes (TIL) and/or marrow infiltrating lymphocytes (MIL).
[0340] As used herein the term adoptive T-cell transfer refers to the administration of a T-cell population to a patient. A T-cell may be isolated from a subject and then genetically modified and cultured in vitro (ex vivo) in order to express a TAA-specific TCR or CAR before being administered to the patient.
[0341] Adoptive cell transfer may be allogenic or autologous.
[0342] By autologous cell transfer it is to be understood that the starting population of cells is obtained from the same subject as that to which the transduced T-cell population is administered. Autologous transfer is advantageous as it avoids problems associated with immunological incompatibility and is available to subjects irrespective of the availability of a genetically matched donor.
[0343] By allogeneic cell transfer it is to be understood that the starting population of cells is obtained from a different subject as that to which the transduced cell population is administered. Preferably, the donor will be genetically matched to the subject to which the cells are administered to minimise the risk of immunological incompatibility. Alternatively, the donor may be mismatched and unrelated to the patient.
[0344] Suitable doses of transduced cell populations are such as to be therapeutically and/or prophylactically effective. The dose to be administered may depend on the subject and condition to be treated, and may be readily determined by a skilled person.
[0345] The T-cell may be derived from a T-cell isolated from a patient. The T-cell may be part of a mixed cell population isolated from the subject, such as a population of peripheral blood lymphocytes (PBL). T-cells within the PBL population may be activated by methods known in the art, such as using anti-CD3 and/or anti-CD28 antibodies or cell sized beads conjugated with anti-CD3 and/or anti-CD28 antibodies.
[0346] The T-cell may be a CD4.sup.+ helper T cell or a CD8.sup.+ cytotoxic T cell. The T-cell may be in a mixed population of CD4.sup.+ helper T cell/CD8.sup.+ cytotoxic T-cells. Polyclonal activation, for example using anti-CD3 antibodies optionally in combination with anti-CD28 antibodies will trigger the proliferation of CD4.sup.+ and CD8.sup.+ T-cells.
[0347] The T-cell may be isolated from the subject to which the genetically modified cell is to be adoptively transferred. In this respect, the cell may be made by isolating a T-cell from a subject, optionally activating the T-cell, transferring the TCR gene to the cell ex vivo. Subsequent immunotherapy of the subject may then be carried out by adoptive transfer of the TCR-transduced cells. As used herein this process refers to autologous T-cell transferi.e. the TCR-transduced cells are administered to the same subject from which the T-cells were originally derived.
[0348] Alternatively the T-cell may be isolated from a different subject, such that it is allogeneic. The T-cell may be isolated from a donor subject. For example, if the subject is undergoing allogeneic haematopoietic stem cell transplantation (Allo-HSCT) or solid organ transplantation or cell transplantation or stem cell therapy, the cell may be derived from the donor, from which the organs, tissues or cells are derived. The donor and the subject undergoing treatment may be siblings.
[0349] Alternatively the T-cell may be derived from a stem cell, such as a haemopoietic stem cell (HSC). Gene transfer into HSCs does not lead to TCR expression at the cell surface as stem cells do not express CD3 molecules. However, when stem cells differentiate into lymphoid precursors that migrate to the thymus, the initiation of CD3 expression leads to the surface expression of the introduced TCR in thymocytes.
[0350] An advantage of this approach is that the mature T-cells, once produced, express only the introduced TCR and little or no endogenous TCR chains, because the expression of the introduced TCR chains suppresses rearrangement of endogenous TCR gene segments to form functional TCR alpha and beta genes. A further benefit is that the gene-modified stem cells are a continuous source of mature T-cells with the desired antigen specificity. Accordingly, the HSC, the HPC, or the vector as defined herein may be used in combination with a gene-modified stem cell, preferably a gene-modified hematopoietic stem cell, which, upon differentiation, produces a T-cell expressing a TAA-specific TCR.
[0351] Other approaches known in the art may be used to reduce, limit, prevent, silence, or abrogate expression of endogenous genes in the cells of the present invention or cells prepared by the methods of the present invention.
[0352] As used herein the term disrupting refers to reducing, limiting, preventing, silencing, or abrogating expression of a gene. The person skilled in the art is able to use any method known in the art to disrupt an endogenous gene, e.g., any suitable method for genome editing, gene silencing, gene knock-down or gene knock-out.
[0353] For example, an endogenous gene may be disrupted with an artificial nuclease. An artificial nuclease is, e.g., an artificial restriction enzyme engineered to selectively target a specific polynucleotide sequence (e.g. encoding a gene of interest) and induce a double strand break in said polynucleotide sequence. Typically, the double strand break (DSB) will be repaired by error-prone non-homologous end joining (NHEJ) thereby resulting in the formation of a non-functional polynucleotide sequence, which may be unable to express an endogenous gene.
[0354] In some embodiments, the artificial nuclease is selected from the group consisting of zinc finger nucleases (ZFN), transcription activator-like effector nucleases (TALEN) and CRISPR/Cas (e.g. CRISPR/Cas9).
[0355] T-Cell Receptor (TCR)
[0356] During antigen processing, antigens are degraded inside cells and then carried to the cell surface by major histocompatibility complex (MHC) molecules. T-cells are able to recognise this peptide:MHC complex at the surface of the antigen presenting cell. There are two different classes of MHC molecules: MHC I and MHC II, each class delivers peptides from different cellular compartments to the cell surface.
[0357] A T cell receptor (TCR) is a molecule found on the surface of T-cells that is responsible for recognizing antigens bound to MHC molecules. The TCR heterodimer consists of an alpha () and beta () chain in around 95% of T-cells, whereas around 5% of T-cells have TCRs consisting of gamma () and delta () chains.
[0358] Engagement of the TCR with antigen and MHC results in activation of the T lymphocyte on which the TCR is expressed through a series of biochemical events mediated by associated enzymes, co-receptors, and specialized accessory molecules.
[0359] Each chain of the TCR is a member of the immunoglobulin superfamily and possesses one N-terminal immunoglobulin (Ig)-variable (V) domain, one Ig-constant (C) domain, a transmembrane/cell membrane-spanning region, and a short cytoplasmic tail at the C-terminal end.
[0360] The variable domain of both the TCR chain and chain have three hypervariable or complementarity determining regions (CDRs). CDR3 is the main CDR responsible for recognizing processed antigen, although CDR1 of the alpha chain has also been shown to interact with the N-terminal part of the antigenic peptide, whereas CDR1 of the beta chain interacts with the C-terminal part of the peptide. CDR2 is thought to recognize the MHC molecule.
[0361] The constant domain of the TCR domain consists of short connecting sequences in which a cysteine residue forms a disulfide bond, making a link between the two chains.
[0362] The TCR used in the present invention may have one or more additional cysteine residues in each of the and chains such that the TCR may comprise two or more disulphide bonds in the constant domains.
[0363] The structure allows the TCR to associate with other molecules like CD3 which possess three distinct chains (, , and ) in mammals and the -chain. These accessory molecules have negatively charged transmembrane regions and are vital to propagating the signal from the TCR into the cell. The CD3- and -chains, together with the TCR, form what is known as the T cell receptor complex.
[0364] The signal from the T cell complex is enhanced by simultaneous binding of the MHC molecules by a specific co-receptor. For helper T-cells, this co-receptor is CD4 (specific for class II MHC); whereas for cytotoxic T-cells, this co-receptor is CD8 (specific for class I MHC). The co-receptor allows prolonged engagement between the antigen presenting cell and the T cell and recruits essential molecules (e.g., LCK) inside the cell involved in the signalling of the activated T lymphocyte.
[0365] Accordingly, as used herein the term T-cell receptor (TCR) refers to a molecule capable of recognising a peptide when presented by an MHC molecule. The molecule may be a heterodimer of two chains and (or optionally and ) or it may be a single chain TCR construct.
[0366] The TCR used in the present invention may be a hybrid TCR comprising sequences derived from more than one species. For example, it has surprisingly been found that murine TCRs are more efficiently expressed in human T-cells than human TCRs. The TCR may therefore comprise human variable regions and murine constant regions.
[0367] A disadvantage of this approach is that the murine constant sequences may trigger an immune response, leading to rejection of the transferred T-cells. However, the conditioning regimens used to prepare patients for adoptive T-cell therapy may result in sufficient immunosuppression to allow the engraftment of T-cells expressing murine sequences.
[0368] The portion of the TCR that establishes the majority of the contacts with the antigenic peptide bound to the major histocompatibility complex (MHC) is the complementarity determining region 3 (CDR3), which is unique for each T cell clone. The CDR3 region is generated upon somatic rearrangement events occurring in the thymus and involving non-contiguous genes belonging to the variable (V), diversity (D, for and chains) and joining (J) genes. Furthermore, random nucleotides inserted/deleted at the rearranging loci of each TCR chain gene greatly increase diversity of the highly variable CDR3 sequence. Thus, the frequency of a specific CDR3 sequence in a biological sample indicates the abundance of a specific T cell population. The great diversity of the TCR repertoire in healthy human beings provides a wide range protection towards a variety of foreign antigens presented by MHC molecules on the surface of antigen presenting cells. In this regard, it is of note that theoretically up to 10.sup.15 different TCRs can be generated in the thymus.
[0369] T-cell receptor diversity is focused on CDR3 and this region is primarily responsible for antigen recognition.
[0370] The CDRs may, for example, comprise one, two, or three substitutions, additions or deletions from the given sequence, provided that the TCR retains the capacity to bind TAA derived peptide when presented by an MHC molecule.
[0371] TCRs specific for TAA may be generated easily by the person skilled in the art using any method known in the art.
[0372] For example, TAA-specific TCRs maybe identified by the TCR gene capture method of Linnemann et al (Nature Medicine 19, 1534-1541 (2013)). Briefly, this method uses a high-throughput DNA-based strategy to identify TCR sequences by the capture and sequencing of genomic DNA fragments encoding the TCR genes and may be used to identify TAA-specific TCRs.
[0373] Improved TCR Expression and Reduced TCR Mispairing
[0374] Increasing the supply of CD3 molecules may increase TCR expression, for example, in a cell that has been modified to express the TCRs of the present invention. Accordingly, the T cell may be modified (e.g. using a vector) to comprise one or more genes encoding CD3-gamma, CD3-delta, CD3-epsilon and/or CD3-zeta. In one embodiment, the T cell comprises a gene encoding CD3-zeta. The T cell may comprise a gene encoding CD8. The vector encoding such genes may encode a selectable marker or a suicide gene, to increase the safety profile of the genetically engineered cell. The genes may be linked by self-cleaving sequences, such as the 2A self-cleaving sequence.
[0375] Alternatively one or more separate vectors encoding a CD3 gene may be provided for co-transfer to a T cell simultaneously, sequentially or separately with one or more vectors encoding TCRs.
[0376] The transgenic TCR may be expressed in a T-cell used in the present invention to alter the antigen specificity of the T-cell. TCR-transduced T-cells express at least two TCR alpha and two TCR beta chains. While the endogenous TCR alpha/beta chains form a receptor that is self-tolerant, the introduced TCR alpha/beta chains form a receptor with defined specificity for the given target antigen.
[0377] However, TCR gene therapy requires sufficient expression of transferred (i.e. transgenic) TCRs as the transferred TCR might be diluted by the presence of the endogenous TCR, resulting in suboptimal expression of the tumor specific TCR. Furthermore, mispairing between endogenous and introduced chains may occur to form novel receptors, which might display unexpected specificities for self-antigens and cause autoimmune damage when transferred into patients.
[0378] Hence, several strategies have been explored to reduce the risk of mispairing between endogenous and introduced TCR chains. Mutations of the TCR alpha/beta interface is one strategy currently employed to reduce unwanted mispairing. For example, the introduction of a cysteine in the constant domains of the alpha and beta chain allows the formation of a disulfide bond and enhances the pairing of the introduced chains while reducing mispairing with wild type chains.
[0379] Accordingly, the TCRs used in the present invention may comprise one or more mutations at the chain/ chain interface, such that when the chain and the chain are expressed in a T-cell, the frequency of mispairing between said chains and endogenous TCR and chains is reduced. In one embodiment, the one or more mutations introduce a cysteine residue into the constant region domain of each of the a chain and the chain, wherein the cysteine residues are capable of forming a disulphide bond between the chain and the chain.
[0380] Another strategy to reduce mispairing relies on the introduction of polynucleotide sequences encoding siRNA, added to the genes encoding for the tumor specific TCR and or chains, and designed to limit the expression of the endogenous TCR genes (Okamoto S. Cancer research 69, 9003-9011, 2009).
[0381] Accordingly, the vector or polynucleotide encoding the TCRs used in the present invention may comprise one or more siRNA or other agents aimed at limiting or abrogating the expression of the endogenous TCR genes.
[0382] It is also possible to combine artificial nucleases, such as zinc finger nucleases (ZFN), transcription activator-like effector nucleases (TALEN) or CRISPR/Cas systems, designed to target the constant regions of the endogenous TCR genes (TRAC and, or TRBC), to obtain the permanent disruption of the endogenous TCR alpha and/or beta chain genes, thus allowing full expression of the tumor specific TCR and thus reducing or abrogating the risk of TCR mispairing. This process, known as the TCR gene editing proved superior to TCR gene transfer in vitro and in vivo (Provasi E., Genovese P., Nature Medicine May; 18(5):807-15; 2012).
[0383] In addition, the genome editing technology allows targeted integration of a expression cassette, comprising a polynucleotide encoding a TCR used in the present invention, and optionally one or more promoter regions and/or other expression control sequences, into an endogenous gene disrupted by the artificial nucleases (Lombardo A., Nature biotechnology 25, 1298-1306; 2007).
[0384] Another strategy developed to increase expression of transgenic TCRs and to reduce TCR mispairing consists in murinization, which replaces the human TCR and TCR constant regions (e.g. the TRAC, TRBC1 and TRBC2 regions) by their murine counterparts. Murizination of TCR constant regions is described in, for example, Sommermeyer and Uckert J Immunol; 2010 (184:6223-6231). Accordingly, the TCR used in the present invention may be murinized.
[0385] Chimeric Antigen Receptor (CAR)
[0386] CARs comprise an extracellular ligand binding domain, most commonly a single chain variable fragment of a monoclonal antibody (scFv) linked to intracellular signaling components, most commonly CD3 alone or combined with one or more costimulatory domains. A spacer is often added between the extracellular antigen-binding domain and the transmembrane moiety to optimize the interaction with the target.
[0387] A CAR for use in the present invention may comprise: [0388] (i) an antigen-specific targeting domain; [0389] (ii) a transmembrane domain; [0390] (iii) optionally at least one costimulatory domain; and [0391] (iv) an intracellular signaling domain.
[0392] Preferably the antigen-specific targeting domain comprises an antibody or fragment thereof, more preferably a single chain variable fragment.
[0393] Preferably the antigen-specific targeting domain targets a TAA.
[0394] In one embodiment, the antigen-specific targeting domain targets CD19.
[0395] Examples of transmembrane domains include a transmembrane domain of a zeta chain of a T cell receptor complex, CD28 and CD8a.
[0396] Examples of costimulatory domains include a costimulating domain from CD28, CD137 (4-1BB), CD134 (OX40), DapIO, CD27, CD2, CD5, ICAM-1, LFA-1, Lck, TNFR-I, TNFR-II, Fas, CD30 and CD40.
[0397] In one embodiment, the costimulatory domain is a costimulating domain from CD28.
[0398] Examples of intracellular signaling domains include human CD3 zeta chain, FcyRIII, FcsRI, a cytoplasmic tail of a Fc receptor and an immunoreceptor tyrosine-based activation motif (ITAM) bearing cytoplasmic receptors.
[0399] Chimeric Antigen Receptors
[0400] Chimeric antigen receptor or CAR or CARs as used herein refers to engineered receptors which can confer an antigen specificity onto cells (for example T cells such as naive T cells, central memory T cells, effector memory T cells or combinations thereof). CARs are also known as artificial T-cell receptors, chimeric T-cell receptors or chimeric immunoreceptors. Preferably the CARs of the invention comprise an antigen-specific targeting region, an extracellular domain, a transmembrane domain, optionally one or more co-stimulatory domains, and an intracellular signaling domain.
[0401] Antigen-Specific Targeting Domain
[0402] The antigen-specific targeting domain provides the CAR with the ability to bind to the target antigen of interest. The antigen-specific targeting domain preferably targets an antigen of clinical interest against which it would be desirable to trigger an effector immune response that results in tumor killing.
[0403] The antigen-specific targeting domain may be any protein or peptide that possesses the ability to specifically recognize and bind to a biological molecule (e.g., a cell surface receptor or tumor protein, or a component thereof). The antigen-specific targeting domain includes any naturally occurring, synthetic, semi-synthetic, or recombinantly produced binding partner for a biological molecule of interest.
[0404] Illustrative antigen-specific targeting domains include antibodies or antibody fragments or derivatives, extracellular domains of receptors, ligands for cell surface molecules/receptors, or receptor binding domains thereof, and tumor binding proteins.
[0405] In a preferred embodiment, the antigen-specific targeting domain is, or is derived from, an antibody. An antibody-derived targeting domain can be a fragment of an antibody or a genetically engineered product of one or more fragments of the antibody, which fragment is involved in binding with the antigen. Examples include a variable region (Fv), a complementarity determining region (CDR), a Fab, a single chain antibody (scFv), a heavy chain variable region (VH), a light chain variable region (VL) and a camelid antibody (VHH).
[0406] In a preferred embodiment, the binding domain is a single chain antibody (scFv). The scFv may be murine, human or humanized scFv.
[0407] Complementarity determining region or CDR with regard to an antibody or antigen-binding fragment thereof refers to a highly variable loop in the variable region of the heavy chain or the light chain of an antibody. CDRs can interact with the antigen conformation and largely determine binding to the antigen (although some framework regions are known to be involved in binding). The heavy chain variable region and the light chain variable region each contain 3 CDRs.
[0408] Heavy chain variable region or VH refers to the fragment of the heavy chain of an antibody that contains three CDRs interposed between flanking stretches known as framework regions, which are more highly conserved than the CDRs and form a scaffold to support the CDRs.
[0409] Light chain variable region or VL refers to the fragment of the light chain of an antibody that contains three CDRs interposed between framework regions.
[0410] Fv refers to the smallest fragment of an antibody to bear the complete antigen binding site. An Fv fragment consists of the variable region of a single light chain bound to the variable region of a single heavy chain.
[0411] Single-chain Fv antibody or scFv refers to an engineered antibody consisting of a light chain variable region and a heavy chain variable region connected to one another directly or via a peptide linker sequence.
[0412] Antibodies that specifically bind a tumor cell surface molecule can be prepared using methods well known in the art. Such methods include phage display, methods to generate human or humanized antibodies, or methods using a transgenic animal or plant engineered to produce human antibodies. Phage display libraries of partially or fully synthetic antibodies are available and can be screened for an antibody or fragment thereof that can bind to the target molecule. Phage display libraries of human antibodies are also available. Once identified, the amino acid sequence or polynucleotide sequence coding for the antibody can be isolated and/or determined.
[0413] With respect to targeting domains that target cancer antigens, the selection of the targeting domain will depend on the type of cancer to be treated, and may target tumor antigens. A tumor sample from a subject may be characterized for the presence of certain biomarkers or cell surface markers. For example, breast cancer cells from a subject may be positive or negative for each of Her2Neu, Estrogen receptor, and/or the Progesterone receptor. A tumor antigen or cell surface molecule is selected that is found on the individual subject's tumor cells. Preferably the antigen-specific targeting domain targets a cell surface molecule that is found on tumor cells and is not substantially found on normal tissues, or restricted in its expression to non-vital normal tissues.
[0414] TAA which may be targeted by the CAR used in the present invention include but are not limited to any one or more of carcinoembryonic antigen (CEA), estrogen receptor, progesterone receptor, ephrinB2, ROR1, mesothelin, c-Met, GD-2, and MAGE A3 TCR, 4-1BB, adenocarcinoma antigen, alpha-fetoprotein, BAFF, B-lymphoma cell, C242 antigen, carbonic anhydrase 9 (CA-IX), CCR4, CD152, CD200, CD22, CD19, CD22, CD123, CD221, CD23 (IgE receptor), CD28, CD4, CD40, CD44, CD44 v6, CD51, CD52, CD56, CD74, CD80, CS-1, CNT0888, CTLA-4, DR5, EpCAM, CD3, fibronectin extra domain-B, folate receptor 1, glycoprotein 75, GPNMB, HGF, human scatter factor receptor kinase, IGF-1 receptor, IGF-I, IgGI, L1-CAM, IL-13, IL-6, insulin-like growth factor I receptor, integrin 51, integrin v3, MORAb-009, MS4A1, mucin CanAg, N-glycolylneuraminic acid, NPC-1C, PDGF-R, PDL192, phosphatidylserine, prostatic carcinoma cells, RANKL, RON, SCH 900105, SDC1, SLAMF7, tenascin C, TGF beta 2, TGF-I3, TRAIL-R1, TRAIL-R2, tumor antigen CTAA16.88, Vascular endothelial growth, factor (VEGF), VEGF-A, VEGFR-1, VEGFR2, vimentin, 5T4, CD5, CD19, CD20, CD21, CD25, CD37, CD30, CD33, CD45, CAMPATH-1 (CDw52), HLA-DR, Anti-idiotype, TAG-72, Ep-CAM, MUC1, Folate-binding protein, A33, G250, Prostate-specific membrane antigen, (PSMA), Prostate specific antigen (PSA), Ferritin, Gangliosides (e.g. GD2, GD3, GM2), Le.sup.y, CA-125, CA19-9, Epidermal growth factor receptor (EGFR), p185HER2, IL-2 receptor, de2-7 EGFR, Fibroblast activation protein (FAP), Tenascin, metalloproteinases, Endosialin, Carbonic anhydrase, Galectin 9, Aldolase A, elFy4, Tyrosinase, Galectin 4, HERKV-K10, p53, NY-LU-12, Restin, NY-CO-38, MAGE-1, MAGE-4a, SSX2, NY-ESO-1, SCP-1, 707-AP, AFP, ART-4, BAGE, b-catenin/m, Bcr-abl, CAMEL, CAP-1, CASP-8, CDC27m, CDK4/m, CT, Cyp-B, DAM-6 (MAGE-B2) and DAM-10 (MAGE-B1), ELF2M, ETV6-AML1, G250, GAGE, GnT-V, Gp100, HAGE, HER-2/neu, HLA-A*0201-R170I, HPV-E7, HSP70-2M, HST-2, hTERT (hTRT), iCE, KIAA0205, LAGE, LDLR/FUT, MAGE, MART-1/Melan-A, MC1R, Myosin/m, MUC1, MUM-1, MUM-2, MUM-3, NA88-A, NY-ESO-1, P15, p190 minor bcr-abl, Pml/RARa, PRAME, RAGE, RU1, RU2, SAGE, SART-1, SART-3, TEL/AML1, TPI/m, TRP-1, protein 1, gp75, TRP-2, TRP-2/INT2 or WT1.
[0415] Co-Stimulatory Domain
[0416] The CAR used in the present invention may also comprise one or more co-stimulatory domains. This domain may enhance cell proliferation, cell survival and development of memory cells.
[0417] Each co-stimulatory domain comprises the co-stimulatory domain of any one or more of, for example, members of the TNFR super family, CD28, CD137 (4-1BB), CD134 (OX40), DaplO, CD27, CD2, CD5, ICAM-1, LFA-1, Lck, TNFR-1, TNFR-II, Fas, CD30, CD40 or combinations thereof. Co-stimulatory domains from other proteins may also be used with the CAR used in the present invention. Additional co-stimulatory domains will be apparent to those of skill in the art.
[0418] Intracellular Signaling Somain
[0419] The CAR used in the present invention may also comprise an intracellular signaling domain. This domain may be cytoplasmic and may transduce the effector function signal and direct the cell to perform its specialized function. Examples of intracellular signaling domains include, but are not limited to, chain of the T-cell receptor or any of its homologs (e.g., chain, FccR1 and chains, MB1 (Ig) chain, B29 (Ig) chain, etc.), CD3 polypeptides (, and ), syk family tyrosine kinases (Syk, ZAP 70, etc.), src family tyrosine kinases (Lck, Fyn, Lyn, etc.) and other molecules involved in T-cell transduction, such as CD2, CD5 and CD28. The intracellular signaling domain may be human CD3 zeta chain, FcyRIII, FcsRI, cytoplasmic tails of Fc receptors, immunoreceptor tyrosine-based activation motif (ITAM) bearing cytoplasmic receptors or combinations thereof.
[0420] Transmembrane Domain
[0421] The CAR used in the present invention may also comprise a transmembrane domain. The transmembrane domain may comprise the transmembrane sequence from any protein which has a transmembrane domain, including any of the type I, type II or type III transmembrane proteins. The transmembrane domain of the CAR used in the present invention may also comprise an artificial hydrophobic sequence. The transmembrane domains of the CARs used in the present invention may be selected so as not to dimerize. Additional transmembrane domains will be apparent to those of skill in the art. Examples of transmembrane (TM) regions used in CAR constructs are: 1) The CD28 TM region (Pule et al, Mol Ther, 2005, November;12(5):933-41; Brentjens et al, CCR, 2007, Sep. 15; 13(18 Pt 1):5426-35; Casucci et al, Blood, 2013, Nov. 14; 122(20):3461-72.); 2) The OX40 TM region (Pule et al, Mol Ther, 2005, November; 12(5):933-41); 3) The 41BB TM region (Brentjens et al, CCR, 2007, Sep. 15; 13(18 Pt 1):5426-35); 4) The CD3 zeta TM region (Pule et al, Mol Ther, 2005, November; 12(5):933-41; Savoldo B, Blood, 2009, Jun. 18; 113(25):6392-402.); 5) The CD8a TM region (Maher et al, Nat Biotechnol, 2002, January; 20(1):70-5.; Imai C, Leukemia, 2004, April; 18(4):676-84; Brentjens et al, CCR, 2007, Sep. 15; 13(18 Pt 1):5426-35; Milone et al, Mol Ther, 2009, August; 17(8):1453-64.).
[0422] Immune Checkpoint Inhibitor
[0423] As used herein the term immune checkpoint inhibitor refers to a molecule, compound, antibody or drug that inhibits, blocks, prevents, reduces or downregulates the expression of, or is otherwise antagonistic to, an inhibitory checkpoint molecule. When expressed on the cell surface, an inhibitory checkpoint molecule inhibits or dampens the T-cell-mediated immune response to said cell. For example, expression of inhibitory checkpoint molecules may prevent a cell from being killed by a T-cell response. This mechanism is particularly deleterious where a cancer cell expresses inhibitory checkpoint molecules as this may allow the cancer cell to evade the host T-cell response. Accordingly, when inhibitory checkpoint molecules on tumor cells are inhibited by an immune checkpoint inhibitor, an enhanced host T-cell response against the tumor cell should occur.
[0424] In one embodiment, the immune checkpoint inhibitor inhibits an inhibitory checkpoint molecule selected from the group consisting of A2AR (Adenosine A2A receptor), B7-H3 (CD276), B7-H4 (VTCN1), BTLA (B and T Lymphocyte Attenuator; CD272), HVEM (Herpesvirus Entry Mediator), CTLA-4 (Cytotoxic T-Lymphocyte-Associated protein 4; CD152), IDO (Indoleamine 2,3-dioxygenase), TDO (tryptophan 2,3-dioxygenase), KIR (Killer-cell Immunoglobulin-like Receptor), LAG3 (Lymphocyte Activation Gene-3), PD-1 (Programmed Death 1 receptor), PD-L1 (PD-1 ligand 1), PD-L2 (PD-1 ligand 2), TIM-3 (T-cell Immunoglobulin domain and Mucin domain 3), VISTA (V-domain Ig Suppressor of T cell Activation), B7-1 (CD80), B7-2 (CD86). Combinations of check point inhibitors may also be used.
[0425] In one embodiment, the immune checkpoint inhibitor is a PD-1 inhibitor; preferably the PD-1 inhibitor is an anti-PD-1 antibody.
[0426] In another embodiment, the immune checkpoint inhibitor is a PD-L1 inhibitor; preferably the PD-L1 inhibitor is an anti-PD-L1 antibody.
[0427] In another embodiment, the immune checkpoint inhibitor is a PD-L2 inhibitor, preferably the PD-L2 inhibitor is an anti-PD-L2 antibody.
[0428] In another embodiment, the immune checkpoint inhibitor is a CTLA4 inhibitor, preferably the CTLA4 inhibitor is an anti-CTLA4 antibody.
[0429] In another embodiment, the immune checkpoint inhibitor is a LAG-3 inhibitor; preferably the LAG-3 inhibitor is an anti-LAG-3 antibody.
[0430] As used herein, the term antibody is understood as a polypeptide substantially encoded by an immunoglobulin gene or immunoglobulin genes, or fragments thereof, which specifically bind and recognize an antigen (e.g. a cell surface marker). As used herein, the term antibody refers to a whole or intact antibody molecule (e.g., IgM, IgG (including IgG1, IgG2, IgG3, and IgG4), IgA, IgD, or IgE) or any antigen-binding fragment thereof.
[0431] An antibody may be a polyclonal antibody or a monoclonal antibody. Monoclonal antibodies are produced by identical immune cells (e.g. hybridomas that may be generated from the fusion of an antibody producing B-cell line and a cancerous B-cell line). A monoclonal antibody directed to a particular antigen will recognise a single specific epitope on said antigen. In contrast, polyclonal antibodies are produced from multiple non-identical cell lines and therefore recognise several different epitopes on a particular antigen.
[0432] Antigen-binding fragments of an antibody include, e.g., a single chain antibody, a single chain Fv fragment (scFv), an Fd fragment, an Fab fragment, an Fab fragment, or an F(ab).sub.2 fragment. An scFv fragment is a single polypeptide chain that includes both the heavy and light chain variable regions of the antibody from which the scFv is derived. In addition, intrabodies, minibodies, triabodies, and diabodies (see, e.g., Todorovska et al. (2001) J Immunol Methods 248(1):47-66; Hudson and Kortt (1999) J Immunol Methods 231(1):177-189; Poljak 25 (1994) Structure 2(12): 1121-1123; Rondon and Marasco (1997) Annual Review of Microbiology 21:257-283, are also included in the definition of antibody and are compatible for use in the methods described herein. The term antibody, as used herein, also includes antibody fragments either produced by the modification of whole antibodies or those synthesized de novo using recombinant methods.
[0433] Suitable methods for producing an antibody or antigen binding fragments thereof directed to a particular antigen are known in the art (see, e.g., Greenfield (2014) Antibodies: A Laboratory Manual, Second Edition 201-221).
[0434] Variants, Derivatives, Analogues, Homologues and Fragments
[0435] In addition to the specific proteins and polynucleotides mentioned herein, the present invention also encompasses the use of variants, derivatives, analogues, homologues and fragments thereof.
[0436] In the context of the present invention, a variant of any given sequence is a sequence in which the specific sequence of residues (whether amino acid or nucleic acid residues) has been modified in such a manner that the polypeptide or polynucleotide in question substantially retains at least one of its endogenous functions. A variant sequence can be obtained by addition, deletion, substitution, modification, replacement and/or variation of at least one residue present in the naturally-occurring protein.
[0437] The term derivative as used herein, in relation to proteins or polypeptides of the present invention includes any substitution of, variation of, modification of, replacement of, deletion of and/or addition of one (or more) amino acid residues from or to the sequence providing that the resultant protein or polypeptide substantially retains at least one of its endogenous functions.
[0438] The term analogue as used herein, in relation to polypeptides or polynucleotides includes any mimetic, that is, a chemical compound that possesses at least one of the endogenous functions of the polypeptides or polynucleotides which it mimics.
[0439] Proteins used in the present invention may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent protein. Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity and/or the amphipathic nature of the residues as long as the endogenous function is retained. For example, negatively charged amino acids include aspartic acid and glutamic acid; positively charged amino acids include lysine and arginine; and amino acids with uncharged polar head groups having similar hydrophilicity values include asparagine, glutamine, serine, threonine and tyrosine.
[0440] A substitution may involve replacement of an amino acid for a similar amino acid (a conservative substitution). A similar amino acid is one which has a side chain moiety with related properties as grouped together, for example as shown below: [0441] (i) basic side chains: lysine (K), arginine (R), histidine (H); [0442] (ii) acidic side chains: aspartic acid (D) and glutamic acid (E); [0443] (iii) uncharged polar side chains: asparagine (N), glutamine (Q), serine (S), threonine (T) and tyrosine (Y); or [0444] (iv) non-polar side chains: glycine (G), alanine (A), valine (V), leucine (L), isoleucine (I), proline (P), phenylalanine (F), methionine (M), tryptophan (W) and cysteine (C).
[0445] Variant sequences may comprise amino acid substitutions, additions, deletions and/or insertions.
[0446] Conservative substitutions, additions or deletions may be made, for example according to the Table below. Amino acids in the same block in the second column and preferably in the same line in the third column may be substituted for each other:
TABLE-US-00018 ALIPHATIC Non-polar G A P I L V Polar - uncharged C S T M N Q Polar - charged D E K R AROMATIC H F W Y
[0447] The present invention also encompasses homologous substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue, with an alternative residue), e.g. like-for-like substitution such as basic for basic, acidic for acidic, polar for polar etc. Non-homologous substitution may also occur e.g. from one class of residue to another or alternatively involving the inclusion of unnatural amino acids, such as ornithine.
[0448] The term variant as used herein may mean an entity having a certain homology with the wild type amino acid sequence or the wild type nucleotide sequence. The term homology can be equated with identity.
[0449] A variant sequence may include an amino acid sequence which may be at least 50%, 55%, 65%, 75%, 85% or 90% identical, preferably at least 95%, at least 97%, or at least 99% identical to the subject sequence. Typically, the variants will comprise the same active sites etc. as the subject amino acid sequence. Although homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity.
[0450] A variant sequence may include a nucleotide sequence which may be at least 40%, 45%, 50%, 55%, 65%, 75%, 85% or 90% identical, preferably at least 95%, at least 97%, or at least 99% identical to the subject sequence. Although homology can also be considered in terms of similarity, in the context of the present invention it is preferred to express homology in terms of sequence identity.
[0451] Preferably, reference to a sequence which has a percent identity to any one of the SEQ ID NOs detailed herein refers to a sequence which has the stated percent identity over the entire length of the SEQ ID NO referred to.
[0452] Identity comparisons can be conducted by eye or, more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs can calculate percentage homology or identity between two or more sequences.
[0453] Percentage homology may be calculated over contiguous sequences, i.e. one sequence is aligned with the other sequence and each amino acid in one sequence is directly compared with the corresponding amino acid in the other sequence, one residue at a time. This is called an ungapped alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
[0454] Although this is a very simple and consistent method, it fails to take into consideration that, for example, in an otherwise identical pair of sequences, one insertion or deletion in the nucleotide sequence may cause the following codons to be put out of alignment, thus potentially resulting in a large reduction in percent homology when a global alignment is performed. Consequently, most sequence comparison methods are designed to produce optimal alignments that take into consideration possible insertions and deletions without penalising unduly the overall homology score. This is achieved by inserting gaps in the sequence alignment to try to maximise local homology.
[0455] However, these more complex methods assign gap penalties to each gap that occurs in the alignment so that, for the same number of identical amino acids, a sequence alignment with as few gaps as possible, reflecting higher relatedness between the two compared sequences, will achieve a higher score than one with many gaps. Affine gap costs are typically used that charge a relatively high cost for the existence of a gap and a smaller penalty for each subsequent residue in the gap. This is the most commonly used gap scoring system. High gap penalties will of course produce optimised alignments with fewer gaps. Most alignment programs allow the gap penalties to be modified. However, it is preferred to use the default values when using such software for sequence comparisons. For example when using the GCG Wisconsin Bestfit package the default gap penalty for amino acid sequences is 12 for a gap and 4 for each extension.
[0456] Calculation of maximum percentage homology therefore firstly requires the production of an optimal alignment, taking into consideration gap penalties. A suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (University of Wisconsin, U.S.A.; Devereux et al. (1984) Nucleic Acids Res. 12: 387). Examples of other software that can perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al. (1999) ibidCh. 18), FASTA (Atschul et al. (1990) J. Mol. Biol. 403-410) and the GENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubel et al. (1999) ibid, pages 7-58 to 7-60). However, for some applications, it is preferred to use the GCG Bestfit program. Another tool, called BLAST 2 Sequences is also available for comparing protein and nucleotide sequences (see FEMS Microbiol. Lett. (1999) 174: 247-50; FEMS Microbiol. Lett. (1999) 177: 187-8).
[0457] Although the final percentage homology can be measured in terms of identity, the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pairwise comparison based on chemical similarity or evolutionary distance. An example of such a matrix commonly used is the BLOSUM62 matrixthe default matrix for the BLAST suite of programs. GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table if supplied (see the user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
[0458] Once the software has produced an optimal alignment, it is possible to calculate percentage homology, preferably percentage sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.
[0459] Fragments are also variants and the term typically refers to a selected region of the polypeptide or polynucleotide that is of interest either functionally or, for example, in an assay. Fragment thus refers to an amino acid or nucleic acid sequence that is a portion of a full-length polypeptide or polynucleotide.
[0460] Such variants may be prepared using standard recombinant DNA techniques such as site-directed mutagenesis. Where insertions are to be made, synthetic DNA encoding the insertion together with 5 and 3 flanking regions corresponding to the naturally-occurring sequence either side of the insertion site may be made. The flanking regions will contain convenient restriction sites corresponding to sites in the naturally-occurring sequence so that the sequence may be cut with the appropriate enzyme(s) and the synthetic DNA ligated into the cut. The DNA is then expressed in accordance with the invention to make the encoded protein. These methods are only illustrative of the numerous standard techniques known in the art for manipulation of DNA sequences and other known techniques may also be used.
[0461] Combination
[0462] The HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with an immune checkpoint inhibitor.
[0463] Alternatively, the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with a TAA-specific T cell.
[0464] Alternatively, the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with a TAA-specific T cell expressing a CAR.
[0465] Alternatively, the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with a TAA-specific T cell expressing a transgenic TCR.
[0466] Alternatively, the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with an immune checkpoint inhibitor and a TAA-specific T cell expressing a transgenic TCR.
[0467] Alternatively, the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with an immune checkpoint inhibitor and a TAA-specific T cell expressing a CAR.
[0468] Alternatively, the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention may be used in combination with 1-methyl-tryptophan (1-MT).
[0469] As used herein, the phrase used in combination with encompasses administration of the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention sequentially, separately or simultaneously with an immune checkpoint inhibitor and/or a TAA-specific T cell.
[0470] The HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least 5 minutes, at least 10 minutes, at least 15 minutes, at least 30 minutes, at least 45 minutes, at least 60 minutes prior a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0471] The HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least 1 hour, at least 2 hours, at least 3 hours, at least 4 hours, at least 5 hours, at least 6 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 72 hours prior to a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0472] The HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, or at least 14 days prior to a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0473] The HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one week, at least two weeks, at least three weeks, at least four weeks, at least five weeks, at least six weeks, at least seven weeks, at least eight weeks, at least nine weeks, at least 10 weeks, at least 11 weeks, or at least 12 weeks prior to a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0474] The HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 11 months, or at least 12 months prior to a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0475] The HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 11 months, or at least 12 months prior to a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0476] As used herein, the phrase used in combination with encompasses administration of the HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vectors of the present invention sequentially, separately or simultaneously with 1-methyl-tryptophan (1-MT).
[0477] The HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least 5 minutes, at least 10 minutes, at least 15 minutes, at least 30 minutes, at least 45 minutes, at least 60 minutes prior to 1-methyl-tryptophan (1-MT).
[0478] The HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least 1 hour, at least 2 hours, at least 3 hours, at least 4 hours, at least 5 hours, at least 6 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 72 hours prior to 1-methyl-tryptophan (1-MT).
[0479] The HSC, HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, or at least 14 days prior to 1-methyl-tryptophan (1-MT).
[0480] The HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one week, at least two weeks, at least three weeks, at least four weeks, at least five weeks, at least six weeks, at least seven weeks, at least eight weeks, at least nine weeks, at least 10 weeks, at least 11 weeks, or at least 12 weeks prior to 1-methyl-tryptophan (1-MT).
[0481] The HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 11 months, or at least 12 months prior to 1-methyl-tryptophan (1-MT).
[0482] The HSC, the HPC, myeloid/monocyte-committed progenitor cells, macrophages, monocytes or the vector of the present invention may be administered at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 11 months, or at least 12 months prior to 1-methyl-tryptophan (1-MT).
[0483] Pharmaceutical Composition
[0484] The HSCs, HPCs, myeloid/monocyte-committed progenitor cells, macrophages, monocytes immune checkpoint inhibitors, TAA-specific T-cells, vectors, 1-methyl-tryptophan (1-MT) and combinations thereof for use according to the present invention may be formulated with a pharmaceutically acceptable carrier, diluent or excipient.
[0485] Patient
[0486] The patient may be a human patient. The patient may be a non-human animal.
[0487] The patient may be afflicted with a cancer. Alternatively, the patient may be at risk of developing a cancer.
[0488] The patient may have been previously determined to be at risk of developing a cancer. The increased risk may have been determined by genetic screening and/or by reviewing the patient's family history. The patient may have been determined to express one or more genetic markers indicative of an increased risk of developing a cancer.
[0489] Suitably, a person skilled in the art will be aware of genetic risk factors (e.g. genetic markers) associated with increased risk of developing a cancer. The skilled person may use any suitable method or technique known in the art to determine whether the subject has an increased risk of developing a cancer.
[0490] The subject may have previously received treatment for the cancer. The subject may be in remission from the cancer. The subject may be resistant to chemotherapy.
[0491] In some aspects of the present invention, the patient has been previously administered a hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte of the invention prior to administration of a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0492] In one embodiment, the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least 6 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 72 hours prior to administration with a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0493] In one embodiment, the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, or at least 14 days prior to administration with a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0494] In one embodiment, the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one week, at least two weeks, at least three weeks, at least four weeks, at least five weeks, at least six weeks, at least seven weeks, at least eight weeks, at least nine weeks, at least 10 weeks, at least 11 weeks, or at least 12 weeks prior to administration with a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0495] In one embodiment, the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 11 months, or at least 12 months prior to administration with a TAA-specific T-cell and/or an immune checkpoint inhibitor.
[0496] In some aspects of the present invention, the patient has been previously administered a hematopoietic stem cell (HSC), a hematopoietic progenitor cell (HPC), a myeloid/monocyte-committed progenitor cell, a macrophage or a monocyte of the invention prior to administration of 1-methyl-tryptophan (1-MT).
[0497] In one embodiment, the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least 6 hours, at least 12 hours, at least 24 hours, at least 48 hours, at least 72 hours prior to administration with 1-methyl-tryptophan (1-MT).
[0498] In one embodiment, the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one day, at least two days, at least three days, at least four days, at least five days, at least six days, at least seven days, or at least 14 days prior to administration 1-methyl-tryptophan (1-MT).
[0499] In one embodiment, the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one week, at least two weeks, at least three weeks, at least four weeks, at least five weeks, at least six weeks, at least seven weeks, at least eight weeks, at least nine weeks, at least 10 weeks, at least 11 weeks, or at least 12 weeks prior to administration with 1-methyl-tryptophan (1-MT).
[0500] In one embodiment, the HSC, the HPC, the myeloid/monocyte-committed progenitor cell, the macrophage or the monocyte of the present invention is administered to the patient at least one month, at least two months, at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least 10 months, at least 11 months, or at least 12 months prior to administration with 1-methyl-tryptophan (1-MT).
[0501] Both human and veterinary treatments are within the scope of the present invention.
[0502] The terms comprising, comprises and comprised of as used herein are synonymous with including or includes; or containing or contains, and are inclusive or open-ended and do not exclude additional, non-recited members, elements or steps. The terms comprising, comprises and comprised of also include the term consisting of.
[0503] The practice of the present invention will employ, unless otherwise indicated, conventional techniques of cell biology, molecular biology, histology, immunology, oncology, which are within the capabilities of a person of ordinary skill in the art. Such techniques are explained in the literature.
[0504] See, for example, Sambrook, J., Fritsch, E. F. and Maniatis, T. (1989) Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold Spring Harbor Laboratory Press; Ausubel, F. M. et al. (1995 and periodic supplements) Current Protocols in Molecular Biology, Ch. 9, 13 and 16, John Wiley & Sons; Roe, B., Crabtree, J. and Kahn, A. (1996) DNA Isolation and Sequencing: Essential Techniques, John Wiley & Sons; Polak, J.M. and McGee, J. O'D. (1990) In Situ Hybridization: Principles and Practice, Oxford University Press; Gait, M. J. (1984) Oligonucleotide Synthesis: A Practical Approach, IRL Press; and Lilley, D. M. and Dahlberg, J. E. (1992) Methods in Enzymology: DNA Structures Part A: Synthesis and Physical Analysis of DNA, Academic Press. Each of these general texts is herein incorporated by reference.
[0505] Various preferred features and embodiments of the present invention will now be described by way of non-limiting examples.
EXAMPLES
Example 1
Tumor-Targeted IFN Boosts T Cell-Mediated Anti-Tumor Responses in a ALL Model
[0506] We transplanted C57131/6 mice with HSC transduced with either mTie2-IFN-mirT LV (IFN mice) or mTie2-GFP-mirT LV or Mock-transduced (both used as control mice), to target IFN/GFP expression to the differentiated TIE2+monocyte progeny, which is highly enriched in tumors.sup.15,16. As shown previously, reconstitution with mTie2-IFN-mirT LV transduced cells results in a functional multi-lineage graft, with no overt side effects.sup.8-10. We then challenged reconstituted mice with our previously described B-ALL model (
[0507] When injected into immunocompetent C57BI/6 mice, OVA-ALL showed slower growth kinetics and delayed onset in a fraction of the mice as compared to parental ALL. At necropsy, all mice showed massive BM infiltration by ALL cells, with outgrowth of NGFR negative blasts in the mice with delayed disease (
[0508] ALL rapidly expanded in control mice (
[0509] In vitro stimulated purified splenic CD8+T cells from IFN mice showed induction of specific response against OVA by g-IFN-ELISPOT, with increasing number of responder cells in the mice showing the lowest tumor burden (
[0510] We also noted an initial lower tumor burden in CD8-depleted IFN mice as compared to control, suggesting that additional mechanisms beside CD8-mediated control may contribute, at least initially and temporarily, to tumor inhibition (
Example 2
Adoptively Transferred Transgenic OT-I T Cells Only Expand and Contain Leukemia in IFN Mice
[0511] To investigate the effect of type-I IFN on T cell recruitment and activation, we adoptively transferred nave transgenic OVA-specific T cells (OT-I) in IFN and control mice (
[0512] These findings were in sharp contrast to tumor-free control mice, in which OT-I cells maintained the nave phenotype of the harvest (
[0513] We then explored the synergy of IFN cell therapy and the adoptive transfer of OT-I T cells in promoting survival (
[0514] At necropsy, whereas a good fraction of OT-1 T cells in the BM, spleen and lymph nodes of IFN+OT-1 mice remained as memory pool and had down-regulated the PD1 inhibitory marker, the majority of OT-1 T cells in CTRL+OT-1 mice had features of exhausted effectors, as they all expressed the PD1 marker (
Example 3
Primed Immune Gene Signature Towards M1 and Th1 Responses in IFN mice; and IFN gene therapy offsets leukemia-induced changes in the tumor Microenvironment (TME) and Imposes an Immunostimulatory Program
[0515] To study whether our IFN gene delivery strategy alters the leukemia microenvironment favoring the induction of effective immune responses, we performed multiplexed measurement of gene expression on a 750 gene panel used for cancer immune profiling on the spleen and BM of control and IFN mice, before and after leukemia challenge. Nearly all significantly up-regulated genes in both tissues of IFN vs. control mice were IFN stimulated genes (ISG) and, in the spleen, T-cell activation, antigen processing, macrophage/DC activation, NK activation and innate immunity genes confirming that our treatment imposed an IFN/Th1 response signature in these tissues. These changes remained evident after tumor challenge and were accompanied by down-regulation of leukemia-associated genes (
[0516] We then characterized the phenotype of myeloid cells in the blood, spleen and BM. We found increased percentage of classical (Ly6C+Ly6Glow) and reduced percentage of non-classical (Ly6C-Ly6G-) monocytes in the blood of IFN vs. control mice, and such differences were further enhanced upon leukemia challenge (
[0517] RNA-sequencing (RNA-Seq) analyses revealed leukemia-induced transcriptional changes in macrophages, which were substantially counteracted by IFN gene therapy (
[0518] To dissect the impact of the leukemia and IFN gene therapy on the TME in a more unbiased manner, we performed single-cell (sc)RNA-Seq on CD11 b+cells isolated from the spleen of control and tumor-bearing mice, treated or not with IFN gene therapy. Using a droplet-based approach (Zheng, G. X. et al. (2017) Nat. Commun. 8: 14049), we generated scRNA-Seq data from 10,821 cells, detecting a mean of 1,338 genes/cell. Graph-based clustering and gene signature analyses using published datasets (Lavin, Y. et al. (2014) Cell 159: 1312-1326; Varol, D. et al. (2017) Immunity 46: 1030-1044; ImmGen) identified 11 clusters corresponding to monocytes (cl. 1-3), neutrophils (cl. 4-6), dendritic cells (cl. 7), macrophages (cl. 8), natural killer and T cells (cl. 9), mast cells (cl. 10) and B cells (cl. 11). Heterogeneity was observed within the monocyte and neutrophil populations, encompassing non-classical (cl. 1) and classical (cl. 2) monocytes, a cluster co-expressing monocyte and neutrophil genes (cl. 3) (Yez, A. et al. (2017) Immunity 47: 890-902) and neutrophil maturation intermediates (
[0519] Unexpectedly, we also found increased numbers of FOXP3+CD25+CD4+ T cells in the BM of tumor-injected IFN mice (
Example 4
IFN Treatment Induces Durable Anti-Tumor Responses Targeting Multiple Tumor Antigens
[0520] We then investigated whether tumor-targeted IFN treatment could also promote long-term durable responses in the mice. Strikingly, an average of 24% (average of 5 different experiments, n=11, 14, 8, 16, 12) of IFN mice survived long-term and were effectively cured of the disease, whereas only 2% of control mice (n=13, 14, 8, 16, 13) survived to it (one representative experiment shown in
Example 5
Combination of IFN Treatment and CTLA-4 Blockade Enhances Survival to Leukemia
[0521] We then investigated the combination of CTLA-4 blockade therapy with tumor-targeted IFN treatment in our experimental OVA-ALL model (
[0522] These findings indicate that spreading of the immune response towards additional neo-antigens occurred in the majority of long term surviving mice. We then re-challenged these mice with a 1:1 ratio of OVA-positive and negative ALL and found that the majority of them survived the re-challenge. Intriguingly, analysis of individual mice indicated that those failing to survive had failed to generate a broad response against tumor antigens and/or succumbed to the selection of ALL clones lacking more than one neo-antigens (Supplementary Table 1). As a further indication of an adaptive immune response underlying the survival of the mice, we compared the TCR- complementary determining region (CDR) repertoire of PBMCs before and after the leukemia challenges. Both the productive clonality (a measure of diversity ranging from 0=polyclonal to 1=monoclonal within each mouse) and the similarity of the repertoire among different mice increased upon leukemia re-challenge, indicating the expansion of tumor-reactive T cell clones against a common set of TAAs among the surviving mice (
[0523] To further assess whether generation of responses towards multiple neo-antigens is a predictor of long-term survival, we performed a new experiment and collected PBMCs early after OVA-ALL challenge to investigate T cell reactivity against all known TAAs by IFNg-ELISPOT assay. Mice showing an anti-tumor repertoire encompassing multiple TAAs had a much higher likelihood of long-term survival than mice responding to a single or no TAA, which all died of the disease (
[0524] Altogether, these data show that both IFN gene therapy and CTLA4 blockade increase T-cell priming and broaden the repertoire of response against tumor neo-antigens, and that these responses can be additive and protect long-term from the tumor.
Example 6
IFN Gene Therapy Boosts Activation and Expansion of Adoptively Transferred CAR19-Transduced T Cells and Enhances Survival
[0525] To further explore the synergy between IFN gene therapy and adoptive T-cell transfer in a clinically relevant model, we generated T cells expressing a previously described second generation (2G) CAR targeting the mouse CD19 (CART19 cells) and incorporating the CD28 endocostimulatory domain (Kochenderfer, J. N. et al. (2010) Blood 116: 3875-3886), and treated mice injected with the parental (OVA-negative) ALL. For CAR gene transfer we exploited LV that coordinately express the CAR and the NGFR marker from a bidirectional promoter (Casucci, M. et al. (2013) Blood 122: 3461-3472) (
[0526] Materials and Methods
[0527] Experimental Design
[0528] Sample size was chosen according to previous experience with experimental models and assays. No sample or animal was excluded from the analyses. Mice were randomly assigned to each experimental group. Investigators were not blinded.
[0529] Plasmid Construction and LV Production
[0530] The mTie2-IFN-mirT, mTie2-GFP-mirT, PGK-OFP, PGK-tTA LV were previously described.sup.9,10,14. The NGFR-OVA transfer BdLV was generated by cloning the OVA cDNA (Agel-Sall) amplified from the PGK-OVA LV37 by PCR in place of the GFP cDNA (Agel-Sall) in the NGFR-GFP BdLV38 . The primers used were the followings: primer Fw: 5-CGACCGGTCCACAAAGACAGCACCATGACA; primer Rv: 5-ATTGTCGACTTAAGGGGAAACACATCTGCCAAAGA The NGFR-CD20 transfer BdLV was generated by cloning the codon optimized human CD20 cDNA from a synthetized plasmid (Kpnl bluntSall) in place of the GFP cDNA (Agel bluntSall) in the NGFR-GFP BdLV. The NGFR-CAR19 and NGFR-iCAR19 transfer BdLVs were generated by cloning the CAR19 and inactive CAR19 sequences previously described (Kochenderfer, J. N. et al. (2010) Blood 116: 3875-3886) by PCR in place of the GFP cDNA (Agel-Sall) in the NGFR-GFP BdLV using the following primers: primer Rv (inactive CAR19): 5-AAACAGCTCCTCGAGTTATCTAGGGGCCA; primer Rv (CAR19): 5-AAACAGCTCCCTCGAGTCATCTAGGGGCCAGT; primer Fw (CAR19 and inactive CAR19): 5-AACACCGGTGTACCGAATTCATGGGCGTG. Concentrated VSV-G-pseudotyped LVs were produced and titered as previously described (Follenzi, A. et al. (2000) Nat. Genet. 25: 217-222).
[0531] Mice
[0532] C57BI/6 Ly45.2 and Ly45.1 mice were purchased from Charles River Laboratory. C57BI/6 Ly45.1/Ly45.2 were obtained by crossing C57BI/6 Ly45.2 and C57BI/6 Ly45.1 mice in the San Raffaele Scientific Institute animal research facility and used as donors for HPC transplant. Transgenic OT-1 C57BI/6 Ly45.2 mice were maintained as colony at the San Raffaele Scientific Institute animal research facility. All animal procedures were performed according to protocols approved by the Animal Care and Use Committee of the San Raffaele Scientific Institute (IACUC 600) and communicated to the Ministry of Health and local authorities according to the Italian law.
[0533] Hematopoietic Stem Progenitor Cell (HSPC) Transplantation
[0534] HSPC transplantation in C57BI/6 mice
[0535] Six-week-old C57BI/6 Ly45.2/Ly45.1 mice were euthanized with CO2 and BM was harvested by flushing the femurs and tibias. Lineage-negative cells enriched in HS/PCs were isolated from total BM using an immuno-magnetic column-based cell purification system (lineage cell depletion kit mouse, Miltenyi, #130-090-858). 10.sup.6 lineage negative cells/ml were then pre-stimulated for 3-4 hr in a serum-free StemSpan medium (StemCell Technologies) containing a cocktail of cytokines (20 ng/ml IL-3, 100 ng/ml SCF, 100 ng/ml FLT-3L, 50 ng/ml TPO all from Peprotech) and then transduced with the indicated lentiviral vectors at a dose of 10.sup.8 transducing units/ml for 12 hr in the same cytokine-containing medium. After transduction, cells were washed and 10.sup.6 cells were infused into the tail vein of lethally irradiated 6-week-old C57BI/6 Ly45.1 females. Radiation doses were 935 cGy split in two doses. Transduced cells were also cultured in vitro for 15 days in IMDM supplemented with 10% FBS, SCF (100 ng/ml), FLT3L (100 ng/ml), penicillin (100 IU/ml), streptomycin (100 ug/ml) and 2% glutamine and then tested together with the PBMC cells isolated from transplanted mice at stable hematopoietic reconstitution (6 weeks) to quantify the VCN by qPCR as previously described (De Palma et al., Blood 2005).
[0536] Tumor Studies
[0537] Mouse OVA-ALL
[0538] The OVA-ALL sub-clone was generated by transducing the parental ALL clone #1114 with the NGFR-OVA BdLV. Briefly, ALL were kept in culture at a concentration of 210.sup.6 cell/ml in Stem Span supplemented with 10% FBS, penicillin (100 IU/ml), streptomycin (100 ug/ml), 2% glutamine, IL3 (20 ng/ml), SCF (100 ng/ml), FLT3L (100 ng/ml), TPO (50 ng/ml) and transduced at 2107 TU/ml with the NGFR-OVA BdLV. After 6 hours of LV exposure, transduced ALL were washed and intravenously injected in sub-lethally irradiated (450 cGy) recipient C57BI/6 Ly45.2 mice. Leukemic mice were sacrificed 14 days later, when ALL reached 90% of total PB cells, and BM was harvested by flushing the femurs and tibias.
[0539] NGFR+ transduced cells were isolated by immune-magnetic cell labeling (CD271 MicroBead Kit, Miltenyi, #130-099-023). Purity of selected ALL was determined by flow cytometer analysis by labeling cells with an anti NGFR antibody and was estimated to be 98% (NGFR+ALL; see
[0540] In Vivo CD8 T Cell Depletion
[0541] For in vivo T cell depletion, an anti CD8 depleting monoclonal antibody (mAb 53-6.72 BioXCell, #BE0004-1) was administered intra-peritoneally to the mice at a dose of 200 ug/mouse one day before OVA-ALL injection and then every 3 days for the entire duration of the experiment.
[0542] Adoptive OT-1 T Cell Transfer
[0543] For adoptive T cell experiments, OT-1 T cells were purified from the spleen of 8 week-old transgenic female OT-1 C57BI/6 Ly45.2 mice by immune-magnetic selection (CD8+ T cell isolation kit, Miltenyi, #130-104-075). Purity of selected OT-1 T cells was evaluated by cytofluorimetric analysis using a panel of anti CD8, CD4 and CD3 antibodies. 110.sup.6 nave OT-1 T cells were intravenously injected in transplanted IFN or CTRL mice at the indicated time upon OVA-ALL injection.
[0544] Generation of CART19 Cells
[0545] T cells were first purified from the spleen of 8 weeks-old female C57BI/6 CD45.2+mice by immune-magnetic selection (Pan T cell isolation kit, Miltenyi, # 130-095-130) and subsequently activated with anti-CD3/CD28 Dyna beads (ThermoFisher #11452D), according to manufacturer's instructions. T cells were cultured in RPMI supplemented with 10% FBS, penicillin (100 U/ml), streptomycin (100 ug/ml), 1% glutamine, IL2 (30 u/ml), IL7 (5 ng/ml), IL15 (5 ng/ml), Na Pyruvate (1 mM), Hepes (20 mM), NEAA (1 uM) and Beta-Mercaptoethanol (0.05 mM). One day after activation, T cells were transduced at a concentration of 110.sup.6 cells/ml with 10.sup.8TU/ml of the NGFR-CAR19 or NGFR-iCAR19 BdLVs. 12 hours after LV exposure T cells were washed and expanded in culture for 8 days prior to infusion in mice at a dose of 710.sup.6 (experiment from
[0546] In Vivo Edu Proliferation Assay
[0547] In vivo proliferation assays were performed using 5-ethynyl-2deoxyuridine (EdU, Invitrogen), a thymidine analogue used in alternative to BrdU. EdU was dissolved in sterile 1 PBS at a concentration of 10 mg/ml. Mice were injected i.p. with 100 g of EdU 24 h before analysis. BM and spleen were harvested and processed according to manufacturer's instructions (Click-iT EdU Flow Cytometry Assay Kit, Invitrogen, #C10636), and percentages of EdU incorporation into leukemic cell were measured by flow cytometric analysis.
[0548] Cell Culture and Transduction
[0549] The mouse EL4 C57BI/6-derived lymphoma cell line was maintained in IMDM supplemented with 10% FBS, penicillin (100 IU/ml), streptomycin (100 g/ml) and 2% glutamine. Transduction was performed at a concentration of 106 cell/ml with a dose of 10.sup.8 TU/ml of the indicated vector stock. Cells were incubated for 12 hours and then washed to remove the vector. OFP on transduced cells was assessed upon 7 days of culture by flow cytometric analysis. NGFR and CD20 expression were evaluated by staining the cells with an anti-NGFR or anti-CD20 antibody at 7 days upon transduction (see flow cytometry section). The VCN of transduced cells was determined by real-time qPCR upon 15 days of culture as previously described (De Palma et al., Blood 2005).
[0550] Flow Cytometry
[0551] All cytometric analyses were performed using the FACSCanto II and LSRFortessa instruments (BD Bioscience) and analysed with the FlowJo software (v. 9.3, Tree Star Inc.).
[0552] Cultured Cells
[0553] EL4 cells were washed and resuspended in PBS containing 2% FBS. For immunostaining, cells were incubated with anti-mouse Fc receptor blocking antibodies for 15 min at 4 C. and then stained for 20 min at 4 C. with the anti NGFR or anti CD20 antibodies (for antibodies see Supplementary Table 1). To exclude dead cells from the analysis, cells were washed and resuspended in PBS containing 10 ng/ml 7-aminoactinomycin D (7-AAD).
[0554] Peripheral Blood
[0555] For each mouse, 250 l of peripheral blood were added to 10 L of PBS containing 45 mg/mL EDTA. For immunostaining a known volume of whole blood (100 l) was first incubated with anti-mouse FcIII/II receptor (Cd16/Cd32) blocking antibodies for 10 min at room temperature and then incubated in the presence of monoclonal antibodies (for antibodies see Supplementary Table 1) for 15 min at room temperature. Erythrocytes were removed by lyses with the TQ-Prep workstation (Beckman-Coulter) in the presence of an equal volume of FBS (100 l) to protect white blood cells. For quantitative flow cytometry we first stained and lysed a known volume of blood (100 l), as described above, and we then added a fixed volume (50 l) of Flow-count Fluorospheres, with a known concentration Beckman Coulter, #7547053). To determine the absolute number of cells we used theformula: Absolute Count (cell/l)=[Total number of cells counted/(Total number of Fluorospheres counted2)]Concentration of the Flow-count Fluorospheres. For OVA- specific pentamer staining, whole blood was first lysed with H.sub.2O. 110.sup.6 PBMC were then resuspended in 50 ul of PBS containing 2 mM EDTA and 0.5% bovine serum albumine (BSA) and incubated with anti-mouse FcIII/II receptor (Cd16/Cd32) blocking antibodies for 10 min at room temperature and then with OVA-specific pentamer reagent (0.5 g/110.sup.6 cells) and monoclonal antibodies (for antibodies see Supplementary Table 1) for other 10 min at room temperature. To exclude dead cells from the analysis, cells were washed and resuspended in PBS containing 2% FBS and 10 ng/ml of 7-aminoactinomycin D (7-AAD). For Treg cells staining in PB we first performed surface staining on 50 l of whole blood (for antibodies see Supplementary Table 1), as described above. Stained whole blood was then washed and resuspended in 100 ul of the Fixation/Permeabiliation solution (eBioscience, #00-5523-00) and incubated for 20 min at room temperature, washed and resuspended in 50 l of Permeabilization solution containing the anti-mouse FoxP3 or isotype control antibodies and incubated for 20 min at room temperature.
[0556] Bone Marrow BM cells were obtained by flushing the femurs in PBS 2% FBS solution and by passing cell suspension through a 40 m nylon filter. Cells (1106-3106 cells) were washed, resuspended in 100 l of PBS containing 2 mM EDTA and 0.5% bovine BSA, and incubated with anti-mouse FcIII/II receptor (Cd16/Cd32) blocking antibodies for 15 min at 4 C. Staining was then performed with monoclonal antibodies (for antibodies see Supplementary Table 1) for 20 min at 4 C. For OVA-specific pentamer staining, 110.sup.6 BM cells were stained as described above for PB. For all intracellular staining and for some surface staining the LIVE/DEAD Fixable Dead Cell Staining (ThermoFisher, #L34959) was used to discriminate alive and dead cells according to manufacturer's instructions. For Treg staining in BM, we first performed surface staining on 110.sup.6 BM cells, as described above for PB.
[0557] Spleen
[0558] Spleens were first smashed and the resulting cell suspension was passed through 40 m nylon filter. Erythrocytes were lysed by H20 and the obtained cells suspension was further passed through 40 m nylon filter and washed in cold PBS containing 2 mM EDTA and 0.5% BSA. Cells were processed and immunostained as described above for BM.
[0559] Cell Cycle Staining
[0560] BM cells and splenocytes from OVA-ALL injected mice were harvested as described above. Cells were then stained for surface markers, washed and fixed using BD Cytofix buffer (BD #554655), washed and permeabilized with BD Perm 2 (BD #347692), washed and stained with PerCP-Cy5.5- or APC-conjugated Ki67 antibody and finally resuspended in BD Cytofix buffer with Hoechst at 1 g/mL. Cells were then analyzed on a BD LSRFortessa machine with UV laser.
[0561] Cell Apoptosis Staining
[0562] BM cells and splenocytes from OVA-ALL injected mice were harvested as descrived above. Cells were then stained with surface markers as described above. Stained cells were then washed twice with the cell staining buffer (BioLegend, #420201) and resuspended in the Annexin V Binding Buffer (Biolegend #422201) and incubated with 5 l of Pacific blue conjugated Annexin V and 10 l of 7-AAD (Biolegend, #420403/420404) for 15 minutes at room temperature. 400 l of Annexin V Binding Buffer is then added to each sample and percentages of apoptotic/dead cells in OVA-ALL were measured by flow cytometric analysis within 30 min from staining.
[0563] ELISPOT Assay
[0564] The g-IFN ELISPOT was performed in 96-well flat-bottomed plate (Millipore) coated with 5 g/ml of anti mouse IFN-g primary antibody (BD, #554430). Splenic CD8+ effector T cells were first purified by immune-magnetic cell labeling (CD8 MicroBead Kit, Miltenyi, #130-049-401) and purity was evaluated by cytofluorimetric analysis using a panel of anti CD8, CD4 and CD3 antibodies. Effector T cells were subsequently plated at a final concentration of 105 or 210.sup.5 cells/well in presence of irradiated (6000 cGy) 10.sup.5 EL4 target cells. For some experiments, we also stimulated effector T cells with 2.5 g/ml of Concanavalin A, as control. After 46 hours of incubation at 37 C./5% CO2, cells were washed and incubated with the biotinylated anti-mouse IFN-g antibody (clone XMG 1.2, BD #554410, 1 g/ml) for two hours. Plates were then washed four times with PBS-Tween followed by 3 washes with PBS and then the avidin-POD (Roche #11089153001) was added (1:5000 diluted in PBS) for 1 hour. Plates were then washed four times with PBS-Tween followed by 3 washes with PBS and then 50 l of the 3-amino-9-ethylcarbazole substrate (AEC, SIGMA #A6926/50tab) was added to each well for 15-20 minutes. The reaction was stopped by the addition of tap water, and the spots were quantified with ELI-Expert.Elispot-Reader and analyzed by Eli.Analyze Version 5.1 (A.EL.VIS). When using total PBMC as effector cells, total blood was first lysed with H2O to eliminate erythrocytes, recovered PBMC were counted and plated at a final concentration of 10.sup.5 cells/well.
[0565] RNA Extraction, qPCR and Gene Expression Analysis
[0566] RNA extraction from BM cells, splenocytes and purified splenic CD4+ T cells was performed using the RNeasy Plus mini Kit (Qiagen). Cells were lysed in Buffer RLT plus, supplemented with beta-mercaptoethanol. The lysate was then passed through a 20-gauge needle. RNA was then extracted according to manufacturer's instructions. The extracted mRNAs were retro-transcribed using the SuperScript Vilo kit (11754250; Invitrogen). All Q-PCR analyses on single genes were done using TaqMan probes from Applied Biosystems (see below). QPCR was run for 40 cycles using the Viia 7 instrument while the Viia 7 software was then used to extract the raw data (Ct). To determine gene expression, the difference (Ct) between the threshold cycle (Ct) of each gene and that of the reference gene was calculated. The lower the Ct, the higher the gene expression level. To obtain relative quantification values, we then calculated the fold-change expression of the gene of interest over its expression in the reference sample, by the formula 2.sup.Ct. The p values are calculated based on Mann-Whitney of the mean 2.sup.Ct values for each gene between the two groups.
[0567] The following Taqman probes were used on purified splenic mouse CD4+ T cells: II10 Mm00439616_m1), II17 (Mm00439618_m1), Ifn-g (Mm01168134_m1), II2 Mm00434256_m1), Tbx21 (TBET) (Mm00450960_m1), Rorc (Mm01261022_m1), Foxp3 Mm00475156_m1), Gata3 (Mm00484683_m1), 1122 (Mm00444241_m1), II4 Mm00445259_m1).
[0568] TCR Sequencing
[0569] Input DNA was obtained from PBMC of IFN and CTRL mice before tumor injection (T0), 30 days upon OVA-ALL injection in tumor-free long-term surviving mice (T1) and 4 days upon re-challenge with OVA-ALL and parental ALL mixed at 1:1 ratio (T2). TCR chain sequencing was performed at Adaptive Biotechnologies using the ImmunoSEQ platform with primers specific for all 54 known expressed V and all 13 J regions. Each unique CDR template at the aminoacid level was quantified in counts per million (cpm). Clonality was evaluated as 1Pielou's evenness.sup.39:
[0570] Where H is the entropy of a sample, calculated on template counts higher than 0 (i.e., the set of all observable template in a mouse) and H is the maximal theoretical entropy for a mouse, defined by
H=ln(S)
[0571] Where S is the number of distinct templates in a mouse. Similarity was evaluated as the 1Bray-Curtis distance between a sample s and the mean of template counts at time t.
[0572] This measure is equivalent to Sorensen-Dice similarity index and it was evaluated including all i observed templates at time t.
[0573] Bulk RNA-Sequencing
[0574] RNA was extracted from 10,000-50,000 sorted cells using the ReliaPrep RNA MiniPrep System (Promega) and RNA-Seq libraries were prepared with the SMART-Seq2 protocol (Picelli, S. et al. (2014) Nat. Protoc. 9: 171-181), with minor modification. Briefly, RNA (1-5 ng) was reverse transcribed using custom oligodT and template-switching LNA oligos (sequences), followed by PCR amplification and clean-up (Ampure XP beads, Beckman Coulter). The resulting cDNA (0,5-1 ng) was tagmented at 55 C. for 30 minutes and final RNA-Seq libraries generated using reagents from the Nextera XT DNA Library Prep Kit (Illumine). Sequencing was performed on a NextSeq 500 machine (Illumina, San Diego, Calif.) using the NextSeq 500/550 High Output v2 kit (75 cycles).
[0575] Single-Cell RNA-Sequencing
[0576] Droplet-based digital 3 end scRNA-Seq was performed on a Chromium Single-Cell Controller (10 Genomics, Pleasanton, Calif.) using the Chromium Single Cell 3 Reagent Kit v2 according to the manufacturer's instructions. Briefly, suspended single cells were partitioned in Gel Beads in Emulsion (GEMs) and lysed, followed by RNA barcoding, reverse transcription and PCR amplification (12-14 cycles). Sequencing-ready scRNA-Seq were prepared according to the manufacturer's instructions, checked and quantified on 2100 Bioanalyzer (Agilent Genomics, Santa Clara, Calif.) and Qubit 3.0 (Invitrogen, Carlsbad, Calif.) instruments. Sequencing was performed on a NextSeq 500 machine (Illumina, San Diego, Calif.) using the NextSeq 500/550 High Output v2 kit (75 cycles).
[0577] Computational Methods
[0578] Raw reads were processed and aligned to the ENSEMBL mm10 transcriptome using CellRanger version 1.3 (https://support.10xgenomics.com/single-cell-gene-expression/software/pipelines/latest/what-is-cell-ranger) with default parameters. Only confidently mapped reads, non-PCR duplicates, with valid barcodes and UMIs (Unique Molecular Identifiers) were retained. We filtered out low quality cells. A minimum of 300 unique genes detected for cell was required, additionally cells with a ratio of mitochondrial versus endogenous gene expression exceeding 0.1 were discarded. Resulting 10,821 cells were retained for further analysis. Gene expression values were quantified in log transformed transcript per million [log(TPM+1)]. Downstream analyses were performed using the R software package Seurat version 2.1 (https://github.com/satijalab/seurat/). Cell clustering and tSNE analysis were performed on 1,031 most variable genes, selected with mean expression higher than 0.01 and log transformed variance to mean ratio higher than 0.5.
[0579] Nanostring Data Analysis
[0580] RNA expression was evaluated on an nCounter SPRINT instrument using the nCounter PanCancer Immune Profiler for Mouse panel (Nanostring Technologies) following manufacturer's instructions. Transcript counts obtained with NanoString were processed as follows. Raw counts in RCC files were normalized using R/Bioconductor library NanoStringNorm (v 1.1.21).sup.40; technical assay variation was normalized using geometric mean of internal controls, background was estimated calculating the mean of negative controls, RNA counts were normalized using the geometric mean of housekeeping genes expression, additional variance stabilization was applied. Differential expression of normalized data was evaluated by means of linear models implemented in the R/Bioconductor limma library.sup.41 . Transcripts were considered differentially expressed with a threshold of adjusted p-value <0.05 (Benjamini-Hochberg correction).
[0581] Statistical Analysis
[0582] Values are expressed as meanstandard error of the mean (SEM) as indicated. Statistical analyses were performed by Mann-Whitney test or Kruskall-Wallis test followed by Dunn post-test correction, unless otherwise indicated. Differences were considered statistically significant at p<0.05. Analyses were performed with R 3.2.2.sup.42, NPC Test R10.sup.43 and Prism (GraphPad Prism version 7.0). Analysis of cell populations in
Example 7
[0583] We developed a novel lentiviral vector construct for tumour-specific expression of interferon-gamma (IFN), a type-II interferon. Tumour-specificity is provided by transcriptional control through enhancer/promoter sequences from the Tie2 (Tek) locus driving transgene expression selectively in a subset of tumour-infiltrating myeloid cells, while preventing expression in hematopoietic stem and progenitor cells with the help of microRNA target sequences recognized by miR-126-3p and miR-130a, as described previously (Escobar, G. et al. (2014) Sci Transl Med 6: 217ra3). This construct was termed Tig126/130a.
[0584] An analogous construct for expression of interferon-alpha under the control of Tie2 and a miR-126 target sequence (i.e. Tie2.Ifna.126T) was termed Tia126.
[0585] In addition to the Tig126/130a and Tia126 vectors, we developed a lentiviral vector carrying the cDNA of the tumor necrosis factor alpha (Tnfa) gene, which was termed Tta126/130a. The structure of the constructs (e.g. Tig126/130a and Tta126/130a) is shown in
[0586] The therapy is delivered by transducing ex vivo hematopoietic stem and progenitor cells (HSPCs) with Tig126/130a, followed by transplantation of the engineered cells into a conditioned recipient. After engraftment, the HSPC progeny will expand and differentiate, and some of them will be recruited into the tumour microenvironment. Promoter activity is specifically upregulated in a subset of tumour-infiltrating monocytes/macrophages, in particular in Tie2-expressing monocytes/macrophages (TEMs) that localise to perivascular areas and have proangiogenic and immunosuppressive functions (De Palma, M. et al. (2005) Cancer Cell 8: 211-226; De Palma, M. et al. (2008) Cancer Cell 14: 299-311), delivering the cargo (e.g. IFN) in this strategic position.
[0587] We employed a transplantable model of B-acute lymphoblastic leukaemia (B-ALL) closely mimicking human Philadelphia-like B-ALL (Nucera, S. et al. (2016) Cancer Cell 29: 905-921), which readily induces a protumoral, immunosuppressive microenvironment characterised, for example, by the appearance of myeloid-derived suppressor cells, downregulation of MHC class II genes and upregulation of IL10 and PD1.
[0588] We first assessed the consequences of Tig126/130a-based IFN delivery on leukaemia growth and the protumoral microenvironment induced by the leukaemia (
[0589] 6- to 8-week old C57/BL6 mice were reconstituted with Lineage-negative HSPCs transduced with either Tig126/130a, Tta126/130a or a control lentiviral vector expressing the biologically inactive, truncated nerve growth factor receptor (NGFR) gene. Tig126/130a and Tta126/130a dosage was quantified as a vector copy number of 1,39 and 2,01, respectively in vitro, and 0,44 and 0,83, respectively in vivo. Eight weeks post transplant, upon reconstitution of the peripheral blood, animals received the B-ALL that is then followed by frequent blood collection. Compared to control animals, mice engineered to express IFNy showed significantly slower disease progression (
[0590] We then combined the contemporaneous delivery of several immunostimulatory cytokines into the leukaemia microenvironment using the Tie2 vector backbone equipped with different transgene cargo. We co-transduced lineage-negative HSPCs with doublet combinations of the Tia126, Tig126/130a and Tta126/130a vectors as compared to Tia126 monotherapy or a control group transduced with the biologically inactive Tie2.NGFR vector, and transplanted the cells into lethally irradiated recipient mice. Mice reconstituted as expected, with no additive toxicity due to combined cytokine expression. Vector copy number of the single vectors measured by specific quantitative PCR assays was rather low ranging from 0.1 to 0.3 in the reconstituted mice. Mice were challenged with B-ALL, as described above. Tia126 alone showed a reduction in leukaemia growth compared to control, similarly to combinations with either Tig126/130a or Tta126/130a (
[0591] Unexpectedly, the combination of Tig126/130a and Tta126/130a resulted in a dramatic reduction in leukaemia progression, associated with a significant increase in MHC class II expression on splenic macrophages (
[0592] Furthermore, we evaluated the potential synergy of our gene therapy-based delivery of IFNy with other immunotherapeutic strategies including checkpoint inhibitors anti-CTLA-4 and anti-LAG-3 and the inhibitor of the IDO enzyme, 1-Methyl-Tryptophan (1-MT). We transduced lineage-negative HSPCs with Tig126/130a or a control biologically inactive Tie2.NGFR vector, and transplanted the cells into lethally irradiated recipient mice. Mice reconstituted as expected, with no additive toxicity due to combined cytokine expression. Vector copy number of the single vectors measured by specific quantitative PCR assays was 0,72 for the Tig126/130a and 0,84 for the controls in the reconstituted mice. Mice were challenged with B-ALL, as described above.
[0593] We observed that while anti-CTLA-4 (aCTLA4) and anti-LAG-3 (aLAG3) showed some efficacy already in monotherapy in reducing the B-ALL progression, the 1-MT treatment had no beneficial effect (
REFERENCES
[0594] 1. Khalil, D. N., Smith, E. L., Brentjens, R. J. & Wolchok, J. D. The future of cancer treatment: immunomodulation, CARs and combination immunotherapy. Nat. Rev. Clin. Oncol. 13, 273-290 (2016).
[0595] 2. Topalian, S. L., Drake, C. G. & Pardoll, D. M. Immune Checkpoint Blockade : A Common Denominator Approach to Cancer Therapy. Cancer Cell 27, 450-461 (2015).
[0596] 3. Schadendorf, D. et al. Pooled Analysis of Long-Term Survival Data From Phase II and Phase III Trials of Ipilimumab in Unresectable or Metastatic Melanoma. J. Clin. Oncol. 33, 1889-94 (2015).
[0597] 4. Pitt, J. M. et al. Resistance Mechanisms to Immune-Checkpoint Blockade in Cancer: Tumor-Intrinsic and -Extrinsic Factors. Immunity 44, 1255-1269 (2016).
[0598] 5. Parker, B. S., Rautela, J. & Hertzog, P. J. Antitumour actions of interferons: implications for cancer therapy. Nat. Rev. Cancer 16, 131-44 (2016).
[0599] 6. Hervas-Stubbs, S. et al. Direct effects of type I interferons on cells of the immune system. Clin. Cancer Res. 17, 2619-27 (2011).
[0600] 7. Fuertes, M. B., Woo, S. R., Burnett, B., Fu, Y. X. & Gajewski, T. F. Type I interferon response and innate immune sensing of cancer. Trends Immunol. 34, 67-73 (2013).
[0601] 8. De Palma, M. et al. Tumor-Targeted Interferon-Alpha Delivery by Tie2-Expressing Monocytes Inhibits Tumor Growth and Metastasis. Cancer Cell 14, 299-311 (2008).
[0602] 9. Escobar, G. et al. Genetic engineering of hematopoiesis for targeted IFN- delivery inhibits breast cancer progression. Sci. Transl. Med. 6, 217ra3 (2014).
[0603] 10. Catarinella, M. et al. IFN gene/cell therapy curbs colorectal cancer colonization of the liver by acting on the hepatic microenvironment. EMBO Mol. Med. 8, 155-70 (2016).
[0604] 11. Fesnak, A. D., June, C. H. & Levine, B. L. Engineered T cells: the promise and challenges of cancer immunotherapy. Nat. Rev. Cancer 16, 566-81 (2016).
[0605] 12. Rosenberg, S. A. & Restifo, N. P. Adoptive cell transfer as personalized immunotherapy for human cancer. Science (80-.). 348, 62-68 (2015).
[0606] 13. Sotillo, E. et al. Convergence of acquired mutations and alternative splicing of CD19 enables resistance to CART-19 immunotherapy. Cancer Discov. 5, 1282-1295 (2015).
[0607] 14. Nucera, S. et al. miRNA-126 Orchestrates an Oncogenic Program in B Cell Precursor Acute Lymphoblastic Leukemia. Cancer Cell 29, 905-921 (2016).
[0608] 15. De Palma, M., Venneri, M. A., Roca, C. & Naldini, L. Targeting exogenous genes to tumor angiogenesis by transplantation of genetically modified hematopoietic stem cells. Nat. Med. 9, 789-95 (2003).
[0609] 16. De Palma, M. et al. Tie2 identifies a hematopoietic lineage of proangiogenic monocytes required for tumor vessel formation and a mesenchymal population of pericyte progenitors. Cancer Cell 8, 211-26 (2005).
[0610] 17. Mellman, I., Coukos, G. & Dranoff, G. Cancer immunotherapy comes of age. Nature 480, 480-9 (2011).
[0611] 18. Kumar, V., Patel, S., Tcyganov, E. & Gabrilovich, D. I. The Nature of Myeloid-Derived Suppressor Cells in the Tumor Microenvironment. Trends Immunol. 37, 208-220 (2016).
[0612] 19. Ruffell, B. & Coussens, L. M. Macrophages and therapeutic resistance in cancer. Cancer Cell 27, 462-472 (2015).
[0613] 20. Joyce Johanna A. and Fearon Douglas T. T cell exclusion, immune privilege, and the tumor microenvironment. Science (80-.). 348, (2015).
[0614] 21. Verdegaal, E. M. E. et al. Neoantigen landscape dynamics during human melanoma-T cell interactions. Nature 536, 91-5 (2016).
[0615] 22. Matsushita, H. et al. Cancer exome analysis reveals a T-cell-dependent mechanism of cancer immunoediting. Nature 482, 400-4 (2012).
[0616] 23. Linnemann, C. et al. High-throughput epitope discovery reveals frequent recognition of neo-antigens by CD4+ T cells in human melanoma. Nat Med 21, 81-85 (2015).
[0617] 24. Lu, Y. C. et aL Efficient identification of mutated cancer antigens recognized by T cells associated with durable tumor regressions. Clin. Cancer Res. 20, 3401-3410 (2014).
[0618] 25. McGranahan, N. et aL Clonal neoantigens elicit T cell immunoreactivity and sensitivity to immune checkpoint blockade. Science (80-.). 351, 1463-1469 (2016).
[0619] 26. Schumacher, T. N. & Schreiber, R. D. Neoantigens in cancer immunotherapy. Science (80-.). 348, 69-74 (2015).
[0620] 27. Sharma, P. & Allison, J. P. Immune Checkpoint Targeting in Cancer Therapy : Toward Combination Strategies with Curative Potential. Cell 161, 205-214 (2015).
[0621] 28. Schildberg, F. A., Klein, S. R., Freeman, G. J. & Sharpe, A. H. Coinhibitory Pathways in the B7-CD28 Ligand-Receptor Family. Immunity 44, 955-972 (2016).
[0622] 29. Yang, X. et al. Targeting the Tumor Microenvironment with Interferon- Bridges Innate and Adaptive Immune Responses. Cancer Cell25, 37-48 (2014).
[0623] 30. Huang, T.-H., Chintalacharuvu, K. R. & Morrison, S. L. Targeting IFN-alpha to B Cell Lymphoma by a Tumor-Specific Antibody Elicits Potent Antitumor Activities. J. Immunol. 179, 6881-6888 (2007).
[0624] 31. Wilson, E. B. et al. Blockade of chronic type I interferon signaling to control persistent LCMV infection. Science 340, 202-7 (2013).
[0625] 32. Sandler, N. G. et al. Type I interferon responses in rhesus macaques prevent SIV infection and slow disease progression. Nature 511, 601-605 (2014).
[0626] 33. Joseph Benci, A. L. et al. Tumor Interferon Signaling Regulates a Multigenic Resistance Program to Immune Checkpoint Blockade. Cell 167, 1540-1554 (2016).
[0627] 34. Gentles, A. J. et al. The prognostic landscape of genes and infiltrating immune cells across human cancers. Nat. Med. 21, 938-945 (2015).
[0628] 35. Mlecnik, B. et al. Integrative Analyses of Colorectal Cancer Show Immunoscore Is a Stronger Predictor of Patient Survival Than Microsatellite Instability. Immunity 44, 698-711 (2016).
[0629] 36. Bachireddy, P., Burkhardt, U. E., Rajasagi, M. & Wu, C. J. Haematological malignancies: at the forefront of immunotherapeutic innovation. Nat. Rev. Cancer 15, 201-215 (2015).
[0630] 37. Mtrai, J. et al. Hepatocyte-targeted expression by integrase-defective lentiviral vectors induces antigen-specific tolerance in mice with low genotoxic risk. Hepatology 53, 1696-1707 (2011).
[0631] 38. Amendola, M., Venneri, M. A., Biffi, A., Vigna, E. & Naldini, L. Coordinate dual-gene transgenesis by lentiviral vectors carrying synthetic bidirectional promoters. Nat. Biotechnol. 23, 108-116 (2005).
[0632] 39. Tumeh, P., Harview, C., Yearley, J. & Al, E. PD-1 blockade induces responses by inhibiting adaptive immune resistance. Nature 515, 568-571 (2014).
[0633] 40. Waggott, D. et al. NanoStringNorm: An extensible R package for the pre-processing of nanostring mRNA and miRNA data. Bioinformatics 28, 1546-1548 (2012).
[0634] 41. Ritchie, M. E. et al. limma powers differential expression analyses for RNA742 sequencing and microarray studies. Nucleic Acids Res. 43, e47 (2015).
[0635] 42. R Development Core Team. R: A Language and Environment for Statistical Computing. R Foundation for Statistical Computing Vienna Austria 0, {ISBN} 3-900051-07-0 (2016).
[0636] 43. Pesarin, F. & Salmaso, L. Permutation Tests for Complex Data. Permutation Tests for Complex Data: Theory, Applications and Software (2010). doi:10.1002/9780470689516
[0637] 44. Brunner, E. & Puri, M. L. Nonparametric methods in factorial designs. Stat. Pap. 42, 1-52 (2001).
[0638] 45. Brunner, E., Domhof, S. & Langer, F. Nonparametric analysis of longitudinal data in factorial experiments. Wiley Ser. Probab. Stat. xvii, 261 (2002).
[0639] 46. Noguchi, K., Gel, Y. R., Brunner, E. & Konietschke, F. nparLD: An R software package for the nonparametric analysis of longitudinal data in factorial experiments. J. Stat. Softw. 50, 1-23 (2012).
[0640] 47. Feys, J. New Nonparametric Rank Tests for Interactions in Factorial Designs with Repeated Measures New Nonparametric Rank Tests for. 15, (2016).
[0641] 48. Therneau, T. M. A Package for Survival Analysis in S. Survival (2015).