NEUTRALIZING HUMAN MONOCLONAL ANTIBODY 8D6 AGAINST HCV INFECTION

20190298830 ยท 2019-10-03

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided herein is a human monoclonal antibody 8D6 against hepatitis C virus (HCV) infection. The antibody binds to the E2 subunit of HCV capsid protein, and can prevent HCV from infecting susceptible host cells. By using the antibody variable region gene or the complementary determining region (CDR) gene, different forms of genetic engineering antibodies have been transformed and produced in any expression system of the prokaryotic and eukaryotic cells as therapeutics to prevent or treat HCV infection.

Claims

1. An isolated binding molecule, wherein the binding molecule comprises CDR1 heavy chain set forth in SEQ ID NO: 8, CDR2 heavy chain set forth in SEQ ID NO: 9, and CDR3 heavy chain set forth in SEQ ID NO: 10.

2. An isolated binding molecule, wherein the binding molecule comprises CDR1 light chain set forth in SEQ ID NO: 14, CDR2 light chain set forth in SEQ ID NO: 15, and CDR3 light chain set forth in SEQ ID NO: 16.

3. An isolated binding molecule, wherein the binding molecule comprises the amino acids as follows: CDR1 heavy chain set forth in SEQ ID NO: 8, CDR2 heavy chain set forth in SEQ ID NO: 9, and CDR3 heavy chain set forth in SEQ ID NO: 10, CDR1 light chain set forth in SEQ ID NO: 14, CDR2 light chain set forth in SEQ ID NO: 15, and CDR3 light chain set forth in SEQ ID NO: 16.

4. The binding molecule according to claim 1, wherein the binding molecule is capable of specifically binding to hepatitis C virus E2 protein.

5. The binding molecule according to claim 1, wherein the binding molecule comprises heavy chain variable region which contains amino acid sequence set forth in SEQ ID NO: 2.

6. The binding molecule according to claim 1, wherein the binding molecule comprises light chain variable region which contains amino acid sequence set forth in SEQ ID NO: 4.

7. The binding molecule according to claim 1, wherein the binding molecule comprises heavy chain variable region and light chain variable region, which contain amino acid sequences set forth in SEQ ID NO: 2 and SEQ ID NO: 4 respectively.

8. The binding molecule according to claim 1, wherein the binding molecule is a whole immunoglobulin molecule, a monoclonal antibody, single chain antibody (scFv), bivalent single-chain antibody, single strand phage antibody, double specific double-chain antibody, three-chain antibodies, four-chain antibody, chimeric antibody, or Fab, F(ab), F(ab).sub.2, Fv, dAb, Fd fragment.

9. The binding molecule according to claim 1, wherein the binding molecule comprises IgH sequence and Ig sequence.

10. A nucleic acid molecule coding the binding molecule according to claim 1.

11. Use of the binding molecule according to claim 1, in the manufacturing of a medicament for detection, treatment and/or prevention of hepatitis C virus infection.

12. An expression vector, comprising a DNA coding the binding molecule according to claim 1.

13. A host cell, wherein the host cell comprises the expression vector of claim 12.

14. A composition, comprising the binding molecule according to claim 1, and pharmaceutical acceptable carrier.

15. A kit for detecting HCV, comprising the binding molecule according to claim 1.

16. A method for inhibiting HCV, comprising the step of using the binding molecule according to claim 1 to inhibit HCV.

17. A method for detecting HCV, comprising the steps of contacting the binding molecule according to claim 1 with a sample, and, confirming the existence of HCV and detecting the existing amount of HCV by testing the binding status of the binding molecule and the sample.

18. The kit of claim 15, wherein the HCV is 1a subtype, 1b subtype, 2a subtype, 2b subtype, 3a subtype, 4a subtype, 5a subtype, 6a subtype or 7a subtype virus.

19. The kit of claim 18, wherein the HCV 1a subtype comprises H77 strain; or the HCV 1b subtype comprises PR52B6M strain, PR79 strain, PR26C3M strain, Con1 strain, HCR6 strain, PR52 strain, PR26 strain, PR79 strain; or the HCV 2a subtype comprises D183 strain, JFH1 strain, PR63 strain; or the HCV 2b subtype comprises J8 strain; or the HCV 3a subtype comprises Patient 288 strain, S52 strain; or the HCV 4a subtype comprises ED43 strain; or the HCV 5a subtype comprises SA13 strain; or the HCV 6a subtype comprises HK6a strain, 74 strain; or the HCV 7a subtype comprises QC69 strain.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0044] The invention can be better understood by referring to the drawings in the embodiments of the present invention, in the attached drawing:

[0045] FIG. 1 Sorting of specific B cells by FACS

[0046] FIG. 2 Electrophoresis results of PCR amplification product in which -actin is used as the internal standard

[0047] FIG. 3 Electrophoresis results of PCR amplification products of heavy chain gene

[0048] FIG. 4 Electrophoresis results of PCR amplification products of light chain gene

[0049] FIG. 5. Specific antigen detection for human monoclonal antibodies (including 8D6).

[0050] FIG. 6. The neutralizing activity of the human monoclonal antibody (8D6) for the HCV euvirus (1b subtype PR26C3M, PR52B6M, PR79 three strains; 2A subtype PR79, JFH1 strain)

[0051] FIG. 7. The detection of neutralizing activity for anti-HCV E2 1F2 against HCV euvirus.

[0052] FIG. 8. The binding activity of 8D6 on the surface glycoprotein E2 of HCV strains with different genotypes was verified by ELISA.

DETAILED DESCRIPTION OF THE INVENTION

[0053] After widely and in-depth research, the present inventors achieve an anti-HCV neutralizing antibody containing a unique complementarity-determining region (CDR), preferably human monoclonal antibody (8D6), and this binding molecule has significant neutralization effect for hepatitis C virus. The invention is completed on this basis.

[0054] Binding Molecules

[0055] The present invention provides a binding molecule that can specifically binds to hepatitis C virus. The binding molecule of the present invention presents a neutralizing activity for hepatitis C virus

[0056] The binding molecule of the invention can be a whole immunoglobulin molecule, an antigen binding fragment, including but not limited to Fab and F(ab), F(ab) 2, Fv, dAB, Fd, complementarity-determining region (CDR) fragment, single chain antibody (scFv), bivalent single chain antibody, single strand phage antibody, double specific double-chain antibody, three-chain antibodies, antibody with four chains and (multi) peptide or its fragments contains at least sufficient to confer with hepatitis C virus specific antigen binding.

[0057] The binding molecule of the present invention may also bind specifically to one or more fragments of hepatitis C virus. For the treatment and/or prevention of HCV, the binding molecule can be specifically binds to the surface of the HCV and the protein. In a specific embodiment, the binding molecule of the present invention can bind specifically to HCV E2 molecules.

[0058] The invention also provides the medical application of the binding molecule in diagnosis, prevention and/or treatment of hepatitis C virus infection. The present invention provides a binding molecule that can neutralize HCV caused by HCV infection.

[0059] CDR region is a protein sequence of interest in immunology. In the embodiment of the invention, the binding molecules may include two or three, four or five or all six CDR regions revealed in this article. Preferably, the combination molecule of the present invention comprises at least two CDR that are disclosed herein.

[0060] On the other hand, the present invention comprises a functional variant of the binding molecule. If variants can competitively bind to HCV or protein fragments with the parental combining molecule, and then it is assumed that the molecular variant is a functional variant of the combination molecule. In other words, the functional variants are still capable of binding to hepatitis C virus E2 protein or fragments thereof. Functional variants, including but not limited to those with similar primary structure sequence, but contain in vitro or in vivo chemical and/or biological chemical modified derivatives found in the parental binding molecules. Such modifications include acetylation, acylation, nucleotides or nucleotide derivatives covalently attachment, lipid or lipid derivatives of covalent attachment, crosslinking, disulfide bond formation, glycosylation, hydroxylation, methylation, oxidation, pegylation, enzymatic hydrolysis process, phosphorylation, etc. In other words, modification in amino acids and/or nucleotide sequence of the parental binding molecules does not significantly affect or change the binding properties of the binding molecules encoding by the nucleotide sequence or containing the amino acid sequence, that is, the binding molecules can still recognize and bind to its target.

[0061] The functional variants may have conserved sequence modifications, including substitutions, additions and deletions of nucleotide and amino acid. These modifications can be imported by standard techniques known in the field, such as directed mutagenesis and random PCR mediated mutagenesis, and can include natural and non-natural nucleotides and amino acids.

[0062] Conservative substitution of amino acid, amino acid residues are replaced by another amino acid residue with similar structure or chemical properties. The family of amino acid residues with similar side chain has been defined in this field. The family includes amino acids with basic side chains (such as lysine, arginine and histidine), amino acids with acidic side chains (such as aspartic acid, glutamic acid), amino acids with no-charge polar side chains (for instance, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan acid), amino acids with non-polar side chains (such as glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), amino acids with side branch chains (for example threonine, valine, isoleucine) and amino acids with aromatic side chains (e.g. tyrosine, phenylalanine, tryptophan). Other classification methods of amino acid residues are known to those of skill in the art. In addition, variants may be substituted with non-conservative amino acids, such as amino acids, which have different structure or chemical properties. Similar small variations may also include deletion or insertions of amino acids, or both. A computer program known in this field can be used to determine which amino acid residues can be replaced, inserted, or deleted without eliminating the immune activity.

[0063] In addition, the functional variants may include an amino acid group or a carboxyl terminal or the truncation at both ends. Compare to parental binding molecules of the invention, the functional variants have the same or different, higher or lower affinity, but still can bind to HCV or a fragment thereof. Preferably, the variable region includes, but not limited to, the amino acid sequence of the frame area, the high variable region or the CDR region. Usually, the light chain and heavy chain variable regions contain three high variable regions, including three CDR, and a more conserved region, the so-called framework region (FR). The hypervariable region contains amino acid residues from the CDR and from hypervariable amino acid residues. In the scope of the present invention, functional variants and the parental binding molecules with at least about 50% to about 99%, preferably at least about 60% to about 99%, more preferably at least about 70% to about 99%, even more preferably at least about 80% to about 99%, and most preferably at least about 90% to about 99%, especially at least approximately 95% to about 99%, and especially at least about 97% to about 99% homology in amino acid sequence. The computer algorithms known as Gap or Bestfit can be used for the best arrangement of amino acid sequences to compare with similarity or identify amino acid residues. Functional variants can be obtained by a known common molecular biological method to change the parental molecules or a part of it, and the method includes but not limits to, error prone PCR and oligonucleotide-directed mutagenesis, site-directed mutagenesis and heavy chain and/or light chain reorganization method. In one embodiment, the functional variants of the present invention have neutralizing activity to hepatitis C virus. The neutralizing activity compared with the parental binding molecules can be the same or higher or lower. Thereafter, when using the term (human) binding molecules, it also covers the functional variants of the (human) binding molecules.

[0064] As a preferred method of the present invention, the binding molecule is a monoclonal antibody that preferably comprises a human constant region (e.g., a humanized constant region IgH sequence and Ig sequence). In this anti-HCV monoclonal antibody, the heavy chain variable region, light chain variable region, and complementarity determining regions (CDRs) in the variable region of heavy chain and light chain variable region, has a unique structure which is different from the existing technology.

[0065] The invention includes: a monoclonal antibody with corresponding amino acid sequence of the monoclonal antibody, and a monoclonal antibody with the variable region chain of the monoclonal antibody. The invention also includes is containing the light chain of the complementarity determining regions (CDRs) and any antibody of heavy chain, and any monoclonal antibody has more than 90% (preferably more than 95%) homology CDR regions to those of the monoclonal antibody in this invention.

[0066] Antigen binding characteristics of the antibody can be described by three specific regions located in the heavy chain and light chain variable region, known as complementarity determining regions (CDRs), which divides the variable region into 4 framework region (FR) which are relatively conservative, and not directly involved in binding reactions. These CDRs form a ring structure, through FR forming a folding on the spatial structure to be closed to each other, CDR on the heavy chain and the corresponding CDR on the light chain constitute the antibody antigen binding site. Amino acid sequences of the same type of antibody can be compared to determine which amino acid constitutes the FR or CDR region.

[0067] The heavy chain and light chain sequences of the monoclonal antibody in the present invention can be determined by common methods.

[0068] It is verified that, the CDR regions of the anti-HCV monoclonal antibody 8D6 in the invention is new, and it is against a unique HCV E2 protein epitopes, and the technical conception is different from the existing anti-HCV antibody.

[0069] The monoclonal antibody of the invention is fully human, and the heavy chain, the light chain variable region and the constant region are all derived from human antibody. Therefore, it recognizes and neutralizes HCV with low immunogenicity and high safety as a therapeutic antibody.

[0070] In embodiments of the present invention, peripheral blood mononuclear cells (PBMC) are extracted from volunteers who are infected HCV recently, using CD19+/IgG+/HCV-E2 as specific markers, to obtain specific B cells recognizing HCV E2 protein by fluorescence activated cell sorting (FACS). Using single cell RT-PCR technique (Journal of Immunological Methods 329 (2008) 112-124), the antibody genes were obtained and humanized monoclonal antibody 8D6 is expressed in 293T cells. Neutralization experiment of envirus (HCVcc) showed that the 8D6 antibody has more than 90% inhibition rate at lower concentration (0.4 g/ml below) for some HCV envirus. Thus, 8D6 antibody has a strong affinity and neutralizing activity, which has the possibility for clinical prevention and treatment of HCV infection.

[0071] On the other hand, the present invention includes immune conjugates, which includes the at least a binding molecule and also contains at least a marker such as molecule of a detectable part/a substance. The invention also relates to a mixture of immune conjugates in the invention or at least a mixture of the immune conjugates in present invention and another molecule such as treatment agent or another binding molecule or immune conjugates. Immune conjugates of the invention can include more than one marker. These markers can be the same or different from each other, and can non-covalently bind/conjugate to binding molecules. These markers may also covalently bind/conjugate to binding molecules directly. Or, the markers can bind/conjugate to binding molecules with one or more binding molecules. The conjugation technology of the markers and binding molecules are known to those skilled in the art.

[0072] The marker of immune conjugates in the invention can be a therapeutic agent, but they also can be a detectable part/substance. Markers suitable for treatment and/or prevention may be toxins or its functional part, antibiotics, enzymes, other binding molecule with enhanced phagocytosis or immune stimulating effect. Immune conjugates containing detectable substance can be diagnostic used for such as evaluation if subject is already infected with hepatitis C virus or as a part of clinical trials program to monitor the incidence or development of hepatitis C virus, for example, to determine the efficacy of a specified treatment. However, they can also be used for other detection and/or analysis and/or diagnostic purposes. Detectable part/substance includes but not limits to the enzyme, prothetic group, fluorescent materials, luminous materials, bioluminescence materials, radioactive materials, positron emission metal and non-radioactive paramagnetic metal ion. Markers used for labeling binding molecules, which is for detect and/or analysis and/or diagnostic purposes, is dependent on the use of a particular detection/analysis/diagnosis technology and/or methods, such as immunohistochemistry staining (tissue) samples, flow cytometry measurement technique, laser scanning cell measurement detection, immunofluorescence assay, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), bioassay (such as phagocytosis assay), western blotting, etc. detection/analysis/diagnostic techniques and/or methods as a suitable marker known in this area are familiar to those skilled in the art.

[0073] In addition, the human binding molecules or immune conjugates in the invention can also be attached to a solid phase, especially for in vitro immunoassay or purification of HCV E2 protein or a fragment thereof. The solid phase may be porous or non-porous, planar or non-planar. The binding molecules of the invention can be fused with a sequence of markers to facilitate purification. The sequence of marker includes but is not limits to six histidine marker, myc marker, or flag markers. Or, an antibody can conjugate with another antibody to form heterologous antibody conjugates (hetero-conjugates).

[0074] On the other hand, binding molecules of the invention can conjugate/attach with one or more antigen. Preferably, these antigens are recognized by the immune system with an object of binding molecule-immune conjugates. The antigens may be the same or different to each other. The method of attaching binding molecule to the antigen is known in this field, including but not limiting to the use of crosslinking agent. The binding molecules of the invention bind to HCV and attach an antigen, will trigger an attack for the T cells which is powerful to the conjugates, which eventually lead to the destruction of the HCV.

[0075] In addition to direct or indirect (e.g. through joint) conjugation to produce immune conjugates, the immune conjugates can be produced as a fusion protein containing binding molecules and suitable markers of the invention. Fusion protein can be produced by the methods known in the art, for example, expressing nucleic acid after construction to recombine and produce, and the nucleic acid molecule contains nucleotide sequence conforming to the reading frame coding and encoding suitable markers.

[0076] In another aspect of the invention provides nucleic acid molecules encode at least one binding molecules, the functional variant or immune conjugates. This nucleic acid molecule can be used as an intermediate for cloning, for example, used in affinity maturation as described above. In a preferred embodiment, the nucleic acid molecules are isolated or purified. The sequence of DNA molecules can be obtained by conventional techniques, or hybrid techniques.

[0077] Technical personnel in this field will be aware of the functional variants of these nucleic acid molecules is part of the invention. A functional variant is the nucleic acid sequence, which can direct translate with the standard genetic code to provide same amino acid sequence from parental DNA molecule translation.

[0078] Once the relevant sequences are obtained, we can use the method to get the relevant sequences in large quantities. This is usually cloned into the vector, and then transferred to the cell, then separate the relevant sequence from the proliferated host cell through the conventional method.

[0079] In addition, synthetic methods can be used to synthesize relevant sequences, especially when the fragment length is short. Usually, a number of small fragments are synthesized firstly, and then connect to get a long sequence of fragments.

[0080] At present, the DNA sequences of the binding molecules (or fragments thereof, or derivatives thereof, or derivatives thereof) can be obtained completely by chemical synthesis. The DNA sequence can then be introduced into the existing 10 kinds of DNA molecules (or the vectors) and the cells which are known in the field. In addition, the mutation is introduced into the sequence of the binding molecules in the present invention through chemical synthesis.

[0081] The invention also includes the appropriate DNA sequences set forth above and an appropriate promoters or vectors controlling sequences. These vectors can be used to transform the appropriate host cells to express proteins. Preferably, the vectors of the invention is for example plasmid expression vector containing virus promoter, and the expression vector insert into the anti-HCV monoclonal antibody heavy chain variable region (VH) and n IgH fusion sequence of constant region (from constant region of humanized IgH) and light chain variable region VL and human Ig fusion sequence.

[0082] The host cell may be prokaryotic cells, such as a bacterial cell; or lower eukaryotic cells, such as yeast cells; or higher eukaryotic cells, such as mammalian cells. Representative examples are: bacterial cells such as Escherichia coli, Aphanomyces spp; Salmonella typhimurium; fungal cells such as yeast; plant cells; insect cells such as Drosophila melanogaster S2 or Sf9; animal cells such as CHO, COS7, NSO or Bowes melanoma cells. In particular, the host cell of the present invention is a eukaryotic host cell, especially mammalian cells, such as 293 cells.

[0083] Transforming host cells through recombinant DNA can be done by a conventional technology known in the field. When the host is prokaryotic cells such as Escherichia coli, absorption of DNA competent cells can be obtained in the exponential growth phase, the steps of CaCl.sub.2) treatment methods are known in this field. Another method is to use MgCl.sub.2. If necessary, electroporation can be used for transformation. When the host is eukaryotic cells, the following methods can be used for DNA transfection: calcium phosphate co-precipitation method, or conventional mechanical method such as microinjection, electroporation, liposome packaging etc.

[0084] The obtained converter can be cultured by the conventional method, and express the binding molecule of the invention. According to the host cells, culture medium can be selected from a variety of conventional culture. Host cells are cultured under the conditions which is suitable for the growth. When the host cell is grown to the appropriate cell density, the promoter is induced by suitable methods (e.g., temperature conversion or chemical induction), and then the cells will be cultured for a period.

[0085] The binding molecules of the present invention are preferably produced by mammalian cells, and the mammalian cells usually need to be incubated in a medium containing serum. The cells can be incubated in the serum-free medium after adapt to the serum-free culture.

[0086] If required, the recombinant protein can be isolated and purified by various methods based on its physical, chemical and other properties. These methods are well known to the technical staff in this field. Examples of these methods include, but not limited to: conventional renaturation, protein precipitation (salting out method), centrifugal, penetrate bacteria, ultrasonic treatment, ultracentrifugation, molecular sieve chromatography (gel filtration), adsorption chromatography, ion exchange chromatography, high performance liquid chromatography (HPLC) and other kinds of liquid phase chromatography and the combination of these method.

[0087] The binding molecules of the invention also can be produced in transgenic non-human mammals such as rabbits, goats, or cows, and are secreted, such as in the milk.

[0088] Pharmaceutical Composition

[0089] The binding molecules of the invention can be used to prepare an anti-HCV composition.

[0090] Based on the new discoveries of the invention, also a composition of anti-HCV or HCV infected disease is provided, including: an effective amount of the binding molecules in the invention; and a pharmaceutically acceptable carrier.

[0091] In this invention, the term pharmaceutical acceptable means that when the molecular body and composition are properly administered to animals or human, they will not produce adverse, allergic or other adverse reactions. The pharmaceutical acceptable carrier used in this invention shall be compatible with the binding molecule of the present invention, that is, to be able to mix rather than reducing the effect of the composition in the ordinary circumstances.

[0092] Some particular examples of pharmaceutical acceptable carrier and its composition are saccharides, such as lactose, glucose and sucrose; starch, such as corn starch and potato starch; cellulose and its derivatives, such as carboxymethyl cellulose fiber, ethyl cellulose and sodium carboxymethyl cellulose; tragacanth powder; malt; gelatin; talc; solid lubricants, such as stearic acid and magnesium stearate; calcium sulfate; vegetable oils, such as peanut oil, cottonseed oil, sesame oil, olive oil, corn oil and cocoa oil; polyols, such as propylene glycol, glycerol, sorbitol, mannitol and polyethylene glycol; alginic acid; emulsifier, such as Tween; wetting agent, such as sodium lauryl sulfate; colorant; flavoring agent; compression agent, stabilizer; antioxidant; preservatives; pyrogen-free water; isotonic salt solution and phosphate buffer solution.

[0093] The composition of the invention can be made into various dosage forms based on the requirements, and physician can determine the beneficial dosage for the patient according to the factors such as the type of the patient, the age, the body weight and the general condition of the disease, and the administration routes. The administration routes include injection or other treatment methods.

[0094] The binding molecules of the present invention can be separated or to be used in the form of separation. In addition, the invention can be used alone or in a combination containing at least one of the binding molecules (or a variant or fragment thereof) in the present invention. In other words, the binding molecule may be used in the combination, such as a pharmaceutical composition comprising binding molecules with two or more of the present invention, a variant or fragment thereof. For example, binding molecules with different but complementary activity can be combined in a treatment plan to achieve the prevention, treatment or diagnosis, but is or can combined the binding molecules with the same activity with a treatment plan in order to achieve prevention, therapeutic or diagnostic role. Optionally, the mixture comprises at least one other therapeutic agent. Preferably, the therapeutic agent, such as ribavirin, can be used for the prevention and/or treatment of HCV infection.

[0095] The pharmaceutical composition may comprise two or more binding molecules with neutralizing activity for hepatitis C virus. In one embodiment, when the combination is applied, the binding molecules present a synergistic neutralization activity. In other words, the composition comprises at least two binding molecules with neutralizing activity, and binding molecules play a synergistic role in neutralizing the hepatitis C virus. In this invention, the term synergistic means that the combination effect of the binding molecules in combination application is higher than that of the adduction effect in single application. The synergistic effect of the binding molecules can be combined with different structures on the same or different fragments of the hepatitis C virus. The calculation of synergistic effect is based on the combination of exponential calculation. The concept of composite index (CI) has been described by Chou and Talalay (Ting-Chao Chou. Quantitative analysis of dose-effect relationships: the combined effects of multiple drugs or enzyme. Advances in Enzyme Regulation (1984); Volume 22: Pages 27-55).

[0096] The binding molecules of the present invention or pharmaceutical composition can be detected in a suitable animal model system before applied in human. This kind of animal model includes but not limited to, mouse, ferret and monkeys. Anti-HCV small molecule compounds also can be synergistic.

[0097] The dosage regimen can be adjusted to provide the best response (such as therapeutic response). The appropriate dose range can be, for example, 0.01-100 mg/kg body weight, preferably 0.1-15 mg/kg body weight. In addition, for example, a bolus can be given, a number of separated doses can be given with the time goes, or increase or reduce dose according to the urgency of the treatment situation.

[0098] The molecules and compositions of the present invention are preferably sterile. The sterilization methods for these molecules and compositions are well known in the field. Other molecules for the diagnosis, prevention and/or treatment can be administered in a similar route as that of the binding molecules in the present invention. If other molecules are given separately, it can be considered to be given before, at the same time, or after one or more human binding molecules or combination of the invention. The precise dosing regimen for human patients is usually selected during clinical trials.

[0099] Detection Reagent and Kit

[0100] The binding molecules of the present invention can be used to prepare reagent and kit for detecting HCV.

[0101] As used herein, the term sample to be measured covers a wide range of sample types, including blood and other body fluid samples from biological source, and solid tissue samples such as biopsy samples or tissue cultures, or cells or its offspring derived from them. The term also includes samples treated with other methods after obtaining, such as treatment with reagents, dissolution, or enrichment of some components such as proteins or polynucleotides. The term covers various clinical samples of any species, including the cultivation of cells and cell culture supernatants and cell lysis products

[0102] On the basis of the binding molecule, a convenient, quick and accurate kit can be prepared to detect HCV. Therefore, the present invention provides a detection kit for detecting the presence of HCV in a sample, comprising a binding molecule of anti-HCV in the present invention. After obtaining the binding molecule provided by the present invention, the detection kit can be conveniently prepared for specific detection of HCV. As a detection method of the present invention, the binding molecules of the present invention can detect the antigen coated on a solid phase by an indirect ELISA method. As a preferred method of the invention, the binding molecule is an antibody, which can be detected by the double antibody sandwich method. The steps of double antibody sandwich method are fix the primary antibody (such as the monoclonal antibody of the present invention) on a carrier, which reacts with the antigen, and then reacts with the secondary antibody (the secondary antibody contains a detectable signal, or can combine to the substance carrying detectable signal) after washing, finally the signal can be detected by chemiluminescence or enzyme linked coloring reaction. The double antibody sandwich method is especially suitable for the detection of antigen with two or more epitopes.

[0103] In order to be more convenient in the detection, the kit contains other detection reagents and auxiliary reagents rather than the binding molecules of the invention, such as some reagents commonly used in ELISA kits, and the characteristics and preparation methods of these reagents are known to the person skilled in the art, such as chromogenic agent, markers, secondary antibody, antibody and sensitizer. The skilled person should understand that a variety of forms of a test kit is included in the invention, as long as the binding molecule of the present invention is used for recognizing HCV.

[0104] In addition, an instruction is contained in the kit to describe the use of the reagents.

[0105] After obtained the binding molecules and/or kit of the present invention, a variety of immunological methods can be used to detect E2 protein or its content of the sample, so that the tested sample can be ensured if it is infected with HCV, and these methods are included in the present invention. Preferably, the method is for the purpose of non-disease diagnosis

[0106] As a preferred method, the present invention provides an in-vitro method (non-diagnostic or therapeutic) for the detection of hepatitis C virus, including the following steps:

(a1) the tested samples are coated on the solid phase;
(a2) adding the binding molecules of the present invention into the solid phase described in (a1), so that the HCV of the tested samples can bind to the binding molecules, which forming a solid phase of binary complex with HCV-binding molecules;
(a3) adding the tested samples of binding molecules in the present invention into the solid phase described in (a2), so that forming a solid phase of ternary complex with HCV-binding molecules; the tested samples contains a marker;
(a4) the marker of the ternary complex is detected, to ensure the existence or the existing amount of HCV in the tested samples.

[0107] Based on the method above, as long as set an antigen reference with the known concentration, a standard curve of the concentration is produced and the content of HCV in the tested sample can be measured by comparing the concentration in the standard curve.

[0108] The advantages of the invention are:

1) A new binding molecule is provides, which is fully human, and with induced immunogenicity and better affinity comparing to animal derived (such as murine) anti-HCV molecules. It has a better therapeutic effect and less side effect.
2) The binding molecules of the present invention can bind to the HCV E2 subunit with a native conformation, and prevent HCV from infecting susceptible host cells.

[0109] The present invention is explained with the specific examples below. These embodiments are to be understood only to illustrate the present invention and not to limit the scope of the present invention. The following examples are indicated the experimental methods of the specific conditions, usually in accordance with the conventional conditions such as the conditions set forth in J. Sam brook, eds., molecular cloning: a laboratory manual, Third Edition, Science Press, 2002, or the conditions recommended by manufacturer.

I. MATERIALS AND METHODS

[0110] The present invention is a human monoclonal antibody which neutralize HCV infection. The results can be divided into two parts:

(1) Single cell RT-PCR method to obtain the antibody gene and antibody expression;
(2) Analyze antibody characteristics.

[0111] The steps are as follow:

[0112] 1. Acquisition of Peripheral Blood Mononuclear Cells (PBMC).

[0113] Peripheral blood was collected from the volunteers who have already infected with HCV, and the routine Ficoll-Paque (manufactured by Lympholyte-H CEDARLANE) density gradient centrifugation is used to obtain more than 10.sup.7 of peripheral blood mononuclear cells (PBMC).

[0114] Ficoll separation method:

(1) Collecting blood in a 50 ml centrifuge tube (containing 1 ml of 4% sodium citrate), totally 10 ml of whole blood, and reversely mixed for 8-10 times. (The final concentration of sodium citrate is 0.4%);
(2) Adding some volume of RPMI1640 (containing sodium citrate), mix well;
(3) Spreading 3 ml of lymphocyte separation liquid in 15 ml transparent centrifuge tube, and carefully adding 6 ml of blood sample above it, which form a separate interface (or adding 4 ml of separation liquid with 8 ml of blood sample);
(4) Centrifuging at room temperature at 800 g for 20 min (2000 rpm, 20 min);
(5) Carefully absorbing the interface layer cells, and transfer to the new tube;
(6) Adding RPMI1640 (containing sodium citrate) to dilute for reducing liquid density. Centrifuge at 800 g/2000 rpm, for 10 min, and remove the supernatant.
(7) Washing cells with RPMI1640 for 2-3 times, for backup.

[0115] 2. Sorting E2 Protein Specific Memory B Cells

[0116] FITC-CD19/APC-IgG/Cy3-HCV-E2 were used as a marker, the specific B cells were obtained into 96-well plate by FACS, and one cell per well, which obtaining E2 protein specific memory B cells.

[0117] 1) Hepatitis C virus envelope protein E2 (HCV-E2) were expressed from the mammalian cell CHO expression system based on TM MAX CHO Expression System manual;

[0118] 2) E2 protein was labeled by biotin: No-Weigh Sulfo-NHS-LC-Biotin (purchased from PIERCE, refers to PIERCE EZ-link Sulfo-NHS-LC-Biotin biotin labeling protocol) 10 mm reagent; the other two markers FITC-CD19 and APC-IgG were from BD bioscience

[0119] 3) Labeling of sorted cells: PBMCs were divided into experiment group and control group. Markers were added according to the cell number to label the cells and staining at photophobic condition, and then the cells were filtered with 40 m BD falcon after re-suspension with PBS.

[0120] 4) Specific B cell sorting: screening with BD FACS ARIA II to get lymphocytes from PBMC based on forward and lateral angles, then obtained specific memory B cell of HCV E2 protein by compensation regulation of different control groups, which sorting into 96-well plate to carry out RT-PCR (reverse transcription PCR), one cell pre well, and placed on dry ice.

[0121] 3. Antibody Gene Cloning

[0122] According to the method of Journal of Immunological Methods 329 (2008) 112-124, the antibody gene was obtained.

[0123] Obtained antibody gene was connected to pGEMT vector (purchased from Invitrogen), sequencing (BGI company), and verified antibody gene by conventional method. Heavy chain and light chain were connected to the expressing vector AbVec-hIgG and AbVec-hIgKappa respectively (Kenneth Smith et al. Rapid generation of fully human monoclonal antibodies specific to a vaccinating antigen. Nat Protoc. 2009; 4(3): 372-384).

[0124] 4. Antibody Expression

[0125] The expression vector inserted with heavy chain and light chain was transient transfection with 293T cells by liposome method, and expressed humanized antibody (refers to Lipofectamine 2000 inversion manual).

[0126] (1) 1.010.sup.6 cells were inoculated into 6-well plate one day before transfection.

[0127] (2) Tube A: 500 l Opti-MEM+4 g IgGH+4 g IgGL

[0128] (3) Tube B: 500 l Opti-MEM+20 l Lipofectamine Reagent;

[0129] (4) Mix tube A and tube B after 5 min, and keep at room temperature for 20 min;

[0130] (5) Mixture of tube A and tube B was added into cell culture plate, incubated at 37 C. for 6 h;

[0131] (6) Adsorbing culture medium containing Lipofectamine Reagent DNA after 6 h, 2 ml FreeStyle 293 Expression Medium was added into each well;

[0132] (7) Collecting cell supernatant after 72 h, at 4 C., 3000 rpm, 5 min.

[0133] 5. Antigen Specificity Assay

[0134] Detecting the expression of the humanized antibody if the antibody can recognize HCV-E2 (expressed by mammalian cell CHO system; refers to FreeStyle MAX CHO Expression System manual), and detect the binding ability to antigen.

[0135] (1) Coating HCV-E2 on the ELISA plate (purchased from NUNC), 10 m/ml, two replicates per sample, 100 l per well, overnight at 4 C.

[0136] (2) Washing plate with PBST for three times;

[0137] (3) Blocking: 1% BSA, 200 l per well, at 37 C., for 2 h;

[0138] (4) Washing plate with PBST for three times;

[0139] (5) According to the determination of concentration, adjust the humanized antibody cell supernatant to the same concentration, 100 l per well, HCV patients' plasma was set as positive control, at 37 C., for 2 h;

[0140] (6) Washing plate with PBST for three times;

[0141] (7) Goat Anti-Human IgG (Fc specific)Peroxidase antibody, 1:10000 dilution, 100 l per well, added into sample and positive control ELISA plate, at 37 C., for 1 h;

[0142] (8) Washing plate with PBST for three times;

[0143] (9) Substrate A:B=1:1, substrate is TMB, 3, 3, 5, 5-tetramethyl benzidine (purchased from Sigma, use as manual). 100 l per well, at 37 C., for 15 min, react at photophobic condition;

[0144] (10) 50 l of 2M H.sub.2SO.sub.4 was added;

[0145] (11) The absorbance (OD450) at the wavelength of 450 nm was determined by spectrophotometer, and the data were processed.

[0146] 6. Neutralizing Activity Test of AntibodyEuvirus Neutralizing Experiment

[0147] 1) Digesting huh7.5.1 cells, re-suspension with DMEM containing 10% serum, spread on the 96-well plate at the density of 10.sup.5/ml, culture for 12-24 h

[0148] 2) Diluting virus to 1-210.sup.3 ffu/ml (focus-forming units per milliliter of supernatant) with DMEM containing 10% serum, and adding appropriate amount of antibody, incubating at 37 C., for 1 h,

[0149] 3) Aspirating huh7.5.1 culture fluid from 96-well plate, and add 100 ul of incubated virus. Replacing fresh DMEM containing 10% serum after 24 h, and incubate for 48 h,

[0150] 4) Fixing cells with 100 ul of PFA, keep for 30 min at room temperature,

[0151] 5) Adding PBS containing 0.3% TritonX-100, 3% BSA, 10% FBS, incubate for 1 h at room temperature,

[0152] 6) Adding anti-NS3 (or NS5A, or core) primary antibody, incubate for 1.5 h at room temperature,

[0153] 7) Washing with PBS for 3 times, 5 min for each,

[0154] 8) Adding anti-mouse secondary antibody containing fluorescence, incubate for 1 h at room temperature,

[0155] 9) Washing with PBS for 3 times, 5 min for each,

[0156] 10) Recording the number of virus infected cell in each well with fluorescence microscope.

II. EXAMPLES

Example 1. HCV-E2 Protein Specific Memory B Cells

[0157] Specific B cells were isolated by using FITC-CD19/APC-IgG/Cy3-HCV-E2 as a specific marker, as shown in FIG. 1.

Example 2. Antibody Gene

[0158] Antibody heavy and light chain variable region gene was obtained by RT-PCR and Nested-PCR, molecular weight was about 400 bp, and -actin was the internal control (343 bp), electrophoresis is shown in FIG. 2, FIG. 3, and FIG. 4. Heavy chain and light chain variable region gene derived from the same B cells were connected with T vector, sequenced and constructed the expression vector.

[0159] 8D6 heavy chain variable region gene sequences are as follows (SEQ ID NO: 1):

TABLE-US-00001 GAGGTGCAGCTGGTGCAGTCTGGGTCTGAGTTGAAGAAGCCTGGGGCCTC ACTGAAGCTCTCCTGCAAGGCTTCTGGATACACCTACATTACCCCTGCCA TGAAC(CDR1)TGGGTGCGACAGGCCCCTGGACATGGGCTTGAGTGGATG GGAGGAATCAACACCAACACTGGGAACCCAACCTATGCCCAGGGCTTCGC AGGA(CDR2)CGGTTTGTCTTCTCCTGGGACACCTCTGTCAGCACGGCAT ATCTGCATATCAGCAGCCTAAAGACTGAGGACACTGCCGTCTATTACTGT GCGGACACCCGAATCTTTTCTTGTCGGCGTGGAACGTGCTATGGTGGTTT CGATGTC(CDR3)TGGGGCCAAGGGACAATGGTCACCGTCTCTTCAG Note: the underlined parts are the high variable regions in the heavy chain gene variable region, which are CDR1 (SEQ ID NO: 5), CDR2 (SEQ lD NO: 6), CDR3 (SEQ ID NO: 7).

[0160] 8D6 heavy chain variable region amino acid sequences are as follows (SEQ ID NO: 2):

TABLE-US-00002 EVQLVQSGSELKKPGASLKLSCKASGYTYITPAMN(CDR1)WVRQAPGHG LEWMGGINTNTGNPTYAQGFAG(CDR2)RFVFSWDTSVSTAYLHISSLKT EDTAVYYCADTRIFSCRRGTCYGGFDV(CDR3)WGQGTMVTVSS Note: the underlined parts are heavy chain amino acid sequence CDR1 (SEQ ID NO: 8), CDR2 (SEQ ID NO: 9), CDR3 (SEQ ID NO: 10).

[0161] 8D6 light chain variable region gene sequences are as follows (SEQ ID NO: 3):

TABLE-US-00003 GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAG ACAGAATCACCATCACTTGCCGGGCAAGTCAGAGCATTAGCAACTTTTTA AAT(CDR1)TGGTTTCAGCATAGACCGGGGAAAGCCCCTAAACTCCTGAT CTATGGTGCAACCATTTTGCAAAGT(CDR2)GGGGTCCCATCAAGGTTCA GTGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGTCTGCAA CCTGAAGATTTTGCAACTTACTACTGTCAACAGAGTGACAGTAGTACCTA CATC(CDR3)TTTGGCCAGGGGACCAAGGTGGAAATCAAAC Note: the underlined parts are the high variable regions in the light chain gene variable region, which are CDR1 (SEQ ID NO: 11), CDR2 (SEQ ID NO: 12), CDR3 (SEQ ID NO: 13).

[0162] 8D6 light chain variable region amino acid sequences are as follows (SEQ ID NO: 4):

TABLE-US-00004 DIQMTQSPSSLSASVGDRITITCRASQSISNFLN(CDR1)WFQHRPGKAP KLLIYGATILQS(CDR2)GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQSDSSTYI(CDR3)FGQGTKVEIK Note: the underlined parts are light chain amino acid sequences CDR1 (SEQ ID NO: 14), CDR2 (SEQ ID NO: 15), CDR3 (SEQ lD NO: 16).

Example 3. Antigen Specificity of Antibody

[0163] ELISA results showed that 8D6 humanized antibody has specific binding capacity for CHO expressed HCV-E2.

[0164] As shown in FIG. 5, this experiment, using HCV infected patients' plasma as a positive control, and using a cell culture and an influenza virus antibody 1F2 (refers to Fully human broadly neutralizing monoclonal antibodies against influenza A viruses generated from the memory B cells of a 2009 pandemic H1N1 influenza vaccine recipient. Hu W, Chen A, Miao Y, Xia S, Ling Z, Xu K, et al. Virology. 2013 Jan. 20; 435(2): 320-8. doi: 10.1016/j.virol.2012.09.034.) as a negative control.

Example 4. Neutralizing Activity of Antibody

[0165] Humanized monoclonal antibody (8D6) is expressed with 293T, adjust the concentration to 50 g/ml, 10 g/ml, 2 g/ml, 0.4 g/ml and 0.08 g/ml after purification for euvirus neutralizing experiment which determine the neutralizing activity, which is the inhibit rate of HCV euvirus. The euvirus used for experiment contain PR52B6M, PR79, JFH1 (international standard strain), PR26C3M, D183(2a) (international standard strain), and all the strains set forth above was from Chinese Academy of Science, Institute Pasteur of Shanghai.

[0166] As shown in FIG. 6-7, compared to negative control (human mAbs 1F2 of a strain of influenza virus HA protein), experimental group (humanized monoclonal antibody 8D6 for anti-HCV E2 protein) has more than 90% of inhibition rate for 1b subtype in PR52B6M, PR79 two strains and 2a subtype D183, JFH1 two strains of HCV euvirus, when the concentration is higher than 0.4 g/ml, and it has more than 90% inhibition rate for another strain 1b subtype PR26C3M when the concentration is 10 g/ml.

Example 5. The Binding Activity of 8D6 to the Surface Glycoprotein E2 of HCV Strains with Different Genotypes was Verified by ELISA

[0167] Glycoprotein E2 of different HCV genotypes was expressed in 293T cells (Table 1, and C-terminal with 6HIS tag), and collect cell supernatant, then added the prepackaged 8D6 antibody to 96-microwell plates, incubate at 37 C. for 2 hours, after washing away impure proteins, detect with a monoclonal antibody of mouse-anti HIS tag. The absorbance (0D450) at the wavelength of 450 nm was determined by spectrophotometer, and the data were processed.

TABLE-US-00005 TABLE 1 GenBank No. of glycoprotein E2 of different HCV genotypes Virus strain (genotype) Glycoprotein E2 GenBank No. H77(1a) JF343780.2 Con1(1b) AJ238799.1 HCR6(1b) AY045702.1 PR52(1b) HQ912958.1 PR26(1b) HQ912956.1 PR79(1b) HQ912959.1 JFH1(2a) AB047639.1 J8(2b) JF343783.1 Patient 28(3a) GQ356213.1 ED43(4a) JF343785.1 SA13(5a) JF343786.1 HK6a(6a) JF343787.1 74(6a) DQ480524.1 QC69(7a) FJ230884.1

[0168] Results as shown in FIG. 8, the 8D6 antibody showed a broad spectrum of binding activity for different genotypes of HCV.

Example 6. Determination of Neutralizing Activity of Antibody Against Euvirus

[0169] Different subtypes of HCV (Table 2) particles and gradient diluted 8D6 antibody were incubated at room temperature for 1 hour, then added into Huh-7.5 cells for incubation, after three hours of incubation, sucked cell supernatant, and adding fresh cell culture medium, additional incubate for 72 hours. The expression level of NS5A was detected by determining the number of cell colonies with fluorescence after HCV infected cells was fixed by 4% paraformaldehyde, and then the cells were infected by HCV. The IC50 of the antibody is the concentration of the antibody which is inhibited by 50% when the virus is infected, which was analyzed by statistical software.

TABLE-US-00006 TABLE 2 Information on different HCV strains Subtype Virus GenBank No. 1a H77 JF343780.2 1b Con1 AJ238799.1 1b PR26 HQ912956.1 1b PR52 HQ912958.1 1b PR79 HQ912959.1 2a JFH7 AB047639.1 2a PR63 KF676351 2b J8 JF343783.1 3a S52 JF343784.2 4a ED43 JF343785.2 5a SA13 JF343786.2 6a HK6a JF343787.2 7a QC69 FJ230884.1

[0170] IC50 of 8D6 antibody was shown in Table 3.

TABLE-US-00007 TABLE 3 The micro neutralization activity of 8D6 was verified by the HCV euvirus system of cell culture. 8D6 Virus strain Subtype IC50 (g/ml) PR52 1b <0.08 PR26 1b 0.412 Con1 1b 2.426 PR79 1b <0.08 JFH1 2a 0.003 PR63 2a <0.016 D183 2a <0.08 J8 2b 10 S52 3a 0.01 SA13 5a 0.087 HK6a 6a 0.0015

[0171] As shown in Table 3, 8D6 has a good micro neutralizing activity at a lower concentration, and the neutralizing activity is broad spectrum.

[0172] All the literatures referred in this invention are as the reference, as each literature is cited as a reference. In addition to be understood, after reading all the content of the invention, the technicians in this field can make a variety of changes or modifications to the invention, and these equivalent forms also contains in the rights attached to claim defined scope.