CD70 ANTI-IDIOTYPE ANTIBODIES

20240228639 ยท 2024-07-11

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided herein are anti-idiotype antibodies that specifically recognize anti-CD70 antibody moieties, in particular, anti-CD70 antibody moieties present in recombinant receptors, including chimeric antigen receptors (CARs). The disclosure further relates to uses of anti-idiotype antibodies for specifically identifying and/or selecting cells expressing such recombinant receptors, such as anti-CD70 CAR T cells. The disclosure further relates to uses of anti-idiotype antibodies for specifically activating such cells.

    Claims

    1. An isolated antibody that specifically binds a molecule comprising an anti-CD70 antibody or an antigen-binding fragment thereof, said anti-CD70 antibody comprising the amino acid sequence of SEQ ID NO: 35, or said molecule comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 34, wherein the isolated antibody comprises (a) a heavy chain variable (VH) region comprising an amino acid sequence of SEQ ID NO: 2, and a light chain variable (VL) region comprising an amino acid sequence of SEQ ID NO: 4; or (b) a VH region comprising an amino acid sequence of SEQ ID NO: 21, and a VL region comprising an amino acid sequence of SEQ ID NO: 23.

    2. (canceled)

    3. The isolated antibody of claim 1, wherein the isolated antibody comprises (a) a heavy chain CDR1 comprising an amino acid sequence of SEQ ID NO: 6, 7 or 8, a heavy chain CDR2 comprising an amino acid sequence of SEQ ID NO: 9 or 10, a heavy chain CDR3 comprising an amino acid sequence of SEQ ID NO: 11, a light chain CDR1 comprising an amino acid sequence of SEQ ID NO: 12, a light chain CDR2 comprising an amino acid sequence of SEQ ID NO: 13, and a light chain CDR3 comprising an amino acid sequence of SEQ ID NO: 14; or (b) a heavy chain CDR1 comprising an amino acid sequence of SEQ ID NO: 25, 26 or 27, a heavy chain CDR2 comprising an amino acid sequence of SEQ ID NO: 28 or 29, a heavy chain CDR3 comprising an amino acid sequence of SEQ ID NO: 30, a light chain CDR1 comprising an amino acid sequence of SEQ ID NO: 31, a light chain CDR2 comprising an amino acid sequence of SEQ ID NO: 32, and a light chain CDR3 comprising an amino acid sequence of SEQ ID NO: 33.

    4. An isolated antibody that specifically binds a molecule comprising an anti-CD70 antibody or an antigen-binding fragment thereof, said anti-CD70 antibody comprising the amino acid sequence of SEQ ID NO: 35, or said molecule comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 34, wherein the isolated antibody comprises (a) a heavy chain CDR1 comprising an amino acid sequence of SEQ ID NO: 6, 7 or 8, a heavy chain CDR2 comprising an amino acid sequence of SEQ ID NO: 9 or 10, a heavy chain CDR3 comprising an amino acid sequence of SEQ ID NO: 11, a light chain CDR1 comprising an amino acid sequence of SEQ ID NO: 12, a light chain CDR2 comprising an amino acid sequence of SEQ ID NO: 13, and a light chain CDR3 comprising an amino acid sequence of SEQ ID NO: 14; or (b) a heavy chain CDR1 comprising an amino acid sequence of SEQ ID NO: 25, 26 or 27, a heavy chain CDR2 comprising an amino acid sequence of SEQ ID NO: 28 or 29, a heavy chain CDR3 comprising an amino acid sequence of SEQ ID NO: 30, a light chain CDR1 comprising an amino acid sequence of SEQ ID NO: 31, a light chain CDR2 comprising an amino acid sequence of SEQ ID NO: 32, and a light chain CDR3 comprising an amino acid sequence of SEQ ID NO: 33.

    5. The isolated antibody of claim 4, wherein (a) the heavy chain variable (VH) region comprises an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 2, and the light chain variable (VL) region comprises an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 4; or (b) the VH region comprises an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 21, and the VL region comprises an amino acid sequence that is at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical to SEQ ID NO: 23.

    6. The isolated antibody of claim 5, wherein (a) the VH region comprises the amino acid sequence of SEQ ID NO: 2, and the VL region comprises the amino acid sequence of SEQ ID NO: 4; or (b) the VH region comprises the amino acid sequence of SEQ ID NO: 21, and the VL region comprises the amino acid sequence of SEQ ID NO: 23.

    7. (canceled)

    8. (canceled)

    9. (canceled)

    10. (canceled)

    11. The isolated antibody of claim 4, wherein the isolated antibody further comprises a detectable label.

    12. The isolated antibody of claim 11, wherein the detectable label is selected from the group consisting of a fluorescent label, a photochromic compound, a magnetic label, a radiolabel, and a hapten.

    13. (canceled)

    14. A polynucleotide encoding the isolated antibody of claim 4.

    15. A vector comprising the polynucleotide of claim 14.

    16. A cell comprising the polynucleotide of claim 14.

    17. A method of making an isolated antibody that specifically binds a molecule comprising: (a) an anti-CD70 scFv comprising a VH comprising the amino acid sequence of SEQ ID NO: 15 and a VL comprising the amino acid sequence of SEQ ID NO: 16, (b) an anti-CD70 scFv comprising the amino acid sequence of SEQ ID NO: 35, or (c) an anti-CD70 chimeric antigen receptor (CAR) comprising the amino acid sequence of SEQ ID NO: 1 or the amino acid sequence of SEQ ID NO: 34, the method comprising growing or culturing the cell of claim 16 under suitable conditions.

    18. A method of determining the presence or absence of cells expressing a molecule comprising an anti-CD70 antibody or an antigen-binding fragment thereof, the molecule comprising the amino acid sequence of SEQ ID NO:1, 34 or 35, comprising contacting the cells with the isolated antibody of claim 4 and determining the presence or absence of cells expressing the molecule comprising the anti-CD70 antibody.

    19. The method of claim 18, further comprising determining a number of cells expressing the anti-CD70 antibody or an antigen-binding fragment thereof, comprising contacting the cells with the isolated antibody of claim 4 and determining the number of cells expressing the molecule comprising the anti-CD70 antibody.

    20. The method of claim 18, wherein the anti-CD70 antibody is an scFv comprising the amino acid sequence of SEQ ID NO: 35.

    21. The method of claim 18, wherein the cells express an anti-CD70 chimeric antigen receptor (CAR) comprising the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 34, with or without a signal peptide.

    22. The method of claim 21, wherein the cells are CAR T cells.

    23. A method of selecting cells that express an anti-CD70 CAR comprising an amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 34, comprising (a) contacting the cells with the isolated antibody of claim 4; and (b) selecting the cells bound with the antibody, optionally wherein the isolated antibody further comprises a detectable label.

    24. The method of claim 23, wherein the cells bound with the isolated antibody are selected by affinity-based separation or by flow cytometry.

    25. (canceled)

    26. A method of purifying an anti-CD70 antibody, or antigen-binding fragment thereof, wherein the anti-CD70 antibody comprises the amino acid sequence of SEQ ID NO: 35, the method comprising the steps of: (a) contacting a sample comprising the anti-CD70 antibody with the isolated antibody of claim 4 to form a complex; and (b) purifying the complex comprising the anti-CD70 antibody and the isolated antibody from the sample.

    27. A method of stimulating cells that express an anti-CD70 chimeric antigen receptor (anti-CD70 CAR T cells), the method comprising incubating the anti-CD70 CAR T-cells with the isolated antibody of claim 4, wherein the anti-CD70 CAR T cells express an anti-CD70 antibody comprising amino acid sequences of SEQ ID NOs:15 and 16 or wherein the anti-CD70 CAR T cells express an anti-CD70 antibody comprising the amino acid sequence of SEQ ID NO: 35.

    28. The method of claim 19, wherein the anti-CD70 antibody is an scFv comprising the amino acid sequence of SEQ ID NO: 35.

    29. The method of claim 19, wherein the cells express an anti-CD70 CAR comprising an amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 34, with or without a signal peptide.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0060] FIGS. 1A and 1B. Flow cytometry determination of specificity of anti-idiotype antibodies clone 37 (FIG. 1A, the first and second rows of panels from top) and clone 60 (FIG. 1A, the third and fourth rows of panels from top, and FIG. 1).

    [0061] FIGS. 2A and 2B. Flow cytometry comparison of the anti-idiotype antibody clone 60 either conjugated with PE (phycoerythrin, FIG. 2A) or unconjugated (FIG. 2B), either produced recombinantly or purified from hybridoma culture.

    [0062] FIG. 3. Flow cytometry demonstration of simultaneous binding of the anti-id antibody to the CD70 CAR or blocking of the anti-id antibody binding to the CD70 CAR, in the presence (top panels) or absence (bottom panels) of the target antigen CD70 protein.

    [0063] FIGS. 4A-4B. Flow cytometry demonstration of simultaneous binding with target antigen or blocking. NTD, non-transduced.

    [0064] FIG. 5. Surface plasmon resonance determination of affinity.

    [0065] FIGS. 6A-6B. Surface plasmon resonance determination of simultaneous binding with target antigen hCD70.

    DETAILED DESCRIPTION

    [0066] Provided herein are agents such as anti-idiotype (anti-id) antibodies and antigen-binding fragments (such as Fv, Fab, F(ab)2, single domain Ab, VHH or single chain fragments, including scFvs) that specifically recognize anti-CD70 antibody moieties (such as anti-CD70 antibody moieties present in recombinant receptors, including chimeric antigen receptors). Also provided are uses and methods of use thereof, and compositions and articles of manufacture including such agents, including for specifically identifying, quantifying, selecting, isolating, purifying and/or stimulating and/or activating cells expressing or including the target antibodies or fragments such as anti-CD70 CAR T cells. In some embodiments, the provided antibodies can be used for specific identification, quantification and/or selection of various anti-CD70 CARs, such as CARs bound to or expressed on a cell surface, and can also be used to specifically activate cells expressing target CARs, such as CAR T cells. In some embodiments, provided are antibodies that are specific to the anti-CD70 antibody designated 4F11, or an antibody fragment derived therefrom, including antibodies and CARs containing variable regions derived from such antibodies, and/or an antibody containing an idiotope contained therein.

    [0067] In some aspects, the provided anti-idiotype antibodies offer advantages compared to conventional reagents for detecting, identifying, manipulating and/or affecting and/or engineering cells that express a CAR, and in particular a CAR containing an anti-CD70 antibody scFv extracellular domain or one containing the recognized idiotype. In certain available methods, detection of the presence or absence or amount of CAR or CAR-expressing cells (and/or stimulation or manipulation of the CAR or CAR-expressing cells), in a sample, is carried out by assessing the presence or absence or amount of a surrogate molecule, such as one included in the construct encoding the CAR and thus serving as an indirect or surrogate marker for its expression.

    [0068] The provided anti-idiotype antibodies and antigen-binding fragments in some embodiments overcome challenges of low binding affinity associated with target antibody ligands and non-specific binding associated with antibody reagents directed to target antibody constant regions, providing a reagent with both high affinity and specificity for its target antibody or antigen binding fragment thereof. In some embodiments, the provided antibodies exhibit greater specificity and binding affinity for their target antibodies or antigen-binding fragments, such as the anti-CD70 antibody designated 4F11, compared to CD70-Fc and other reagents currently available for detecting or identifying the CAR comprising the anti-CD70 antibody.

    [0069] An antibody is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule. As used herein, the term encompasses not only intact polyclonal or monoclonal antibodies, but also antigen-binding fragments thereof (such as Fab, Fab, F(ab)2, and Fv), and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site including, for example without limitation, single chain (scFv) and domain antibodies (including, for example, shark and camelid antibodies), and fusion proteins comprising an antibody. An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class. Depending on the antibody amino acid sequence of the constant region of its heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g., 1gG1, 1gG2, 1gG3, 1gG4, lgA1 and lgA2. The heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.

    [0070] The term antigen-binding fragment or antigen binding portion of an antibody, as used herein, refers to one or more fragments of an intact antibody that retain the ability to specifically bind to a given antigen. Antigen binding functions of an antibody can be performed by fragments of an intact antibody. Examples of binding fragments encompassed within the term antigen binding fragment of an antibody include Fab; Fab; F(ab)2; an Fd fragment consisting of the VH and CH1 domains; an Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a single domain antibody (dAb) fragment (see, e.g., Ward et al., Nature 341:544-546, 1989), and an isolated complementarity determining region (CDR).

    [0071] An antibody, an antibody conjugate, or a polypeptide that specifically binds to a target is a term well understood in the art, and methods to determine such specific binding are also well known in the art. A molecule is said to exhibit specific binding if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances. An antibody specifically binds to a target if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances. It is also understood that by reading this definition, for example, an antibody (or moiety or epitope) that specifically binds to a first target may or may not specifically bind to a second target. As such, specific binding does not necessarily require (although it can include) exclusive binding.

    [0072] Chimeric antigen receptors (CARs) can refer to proteins that specifically recognize target antigens (e.g., target antigens on cancer cells). When bound to the target antigen, the CAR expressed on the surface of an immune cell may activate the immune cell to attack and destroy the cell bearing that antigen (e.g., the cancer cell). CARs may also incorporate costimulatory or signaling domains to increase their potency. See Krause et al., J. Exp. Med., Volume 188, No. 4, 1998 (619-626); Finney et al., Journal of Immunology, 1998, 161: 2791-2797, Song et al., Blood 119:696-706 (2012); Kalos et al., Sci. Transl. Med. 3:95 (2011); Porter et al., N. Engl. J. Med. 365:725-33 (2011), and Gross et al., Annu. Rev. Pharmacol. Toxicol. 56:59-83 (2016); U.S. Pat. Nos. 7,741,465, and 6,319,494.

    [0073] CARs can be expressed on the surface membrane of the cell. Thus, the CAR can comprise a transmembrane domain. Suitable transmembrane domains for a CAR disclosed herein have the ability to (a) be expressed at the surface of a cell, for example an immune cell such as, for example without limitation, lymphocyte cells (e.g. T cells) or Natural killer (NK) cells, and (b) interact with the ligand-binding domain and intracellular signaling domain for directing a cellular response of an immune cell against a predefined target cell. The transmembrane domain can be derived either from a natural or from a synthetic source. The transmembrane domain can be derived from any membrane-bound or transmembrane protein. As non-limiting examples, the transmembrane polypeptide can be a domain of the T cell receptor such as a, 3, 7 or 6, polypeptide constituting CD3 complex, IL-2 receptor e.g. p55 (?chain), p75 ((3 chain or 7 chain), subunit chain of Fc receptors, in particular Fc? receptor III or CD proteins. Alternatively, the transmembrane domain can be synthetic and can comprise predominantly hydrophobic residues such as leucine and valine. In some embodiments said transmembrane domain is derived from the human CD8?chain (e.g., NP_001139345.1). The transmembrane domain can further comprise a stalk domain between the extracellular ligand-binding domain and said transmembrane domain. A stalk domain can comprise up to 300 amino acids, for example, from 10 to 100 amino acids or 25 to 50 amino acids. The stalk region can be derived from all or part of naturally occurring molecules, such as from all or part of the extracellular region of CD8, CD4, or CD28, or from all or part of an antibody constant region. Alternatively, the stalk domain can be a synthetic sequence that corresponds to a naturally occurring stalk sequence or can be an entirely synthetic stalk sequence. In some embodiments said stalk domain is a part of human CD8?chain (e.g., NP_001139345 and isoforms thereof). In another particular embodiment, the transmembrane domain comprises a part of the human CD8?chain. In some embodiments, a CAR can be introduced into an immune cell as a transgene via a vector e.g. a plasmid vector. In some embodiments, the vector e.g. plasmid vector can also contain, for example, a selection marker which provides for identification and/or selection of cells which received the vector.

    [0074] The intracellular (cytoplasmic) domain of the CARs of the disclosure can provide activation of at least one of the normal effector functions of the immune cell comprising the CAR, e.g., Signal 1/activation and/or Signal 2/costimulation. Effector function of a T cell, for example, may refer to cytolytic activity or helper activity, including the secretion of cytokines.

    [0075] In some embodiments, an activating intracellular signaling domain for use in a CAR can be the cytoplasmic sequences of, for example without limitation, the T cell receptor and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.

    [0076] It will be appreciated that suitable (e.g., activating) intracellular domains include, but are not limited to signaling domains derived from (or corresponding to) CD3 zeta, CD28, OX-40, 4-1BB/CD137, CD2, CD7, CD27, CD30, CD40, programmed death-1 (PD-1), inducible T cell costimulator (ICOS), lymphocyte function-associated antigen-1 (LFA-1, CD1-1a/CD18), CD3 gamma, CD3 delta, CD3 epsilon, CD247, CD276 (B7-H3), LIGHT, (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class 1 molecule, TNF receptor proteins, an Immunoglobulin protein, cytokine receptor, integrins, Signaling Lymphocytic Activation Molecules (SLAM proteins), activating NK cell receptors, BTLA, a Toll ligand receptors, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8alpha, CD8beta, IL-2R beta, IL-2R gamma, IL-7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD1 1a, LFA-1, ITGAM, CD1 1b, ITGAX, CD1 1c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, CD19a, a ligand that specifically binds with CD83, or any combination thereof.

    [0077] The intracellular domains of the CARs of the disclosure may incorporate, in addition to the activating domains described above, costimulatory signaling domains (interchangeably referred to herein as costimulatory molecules or costimulatory domains) to increase their potency. Costimulatory domains can provide a signal in addition to the primary signal provided by an activating molecule as described herein.

    [0078] A co-stimulatory molecule as used herein refers to the cognate binding partner on a T cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the cell, such as, but not limited to proliferation. Co-stimulatory molecules include, but are not limited to, an MHC class I molecule, BTLA and Toll ligand receptor. Examples of costimulatory molecules include CD27, CD28, CD8, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3 and a ligand that specifically binds with CD83 and the like. In certain embodiments, the anti-idiotype antibodies are multispecific. Among the multispecific binding molecules are multispecific antibodies, including, e.g. bispecific. Multispecific binding partners, e.g., antibodies, have binding specificities for at least two different sites, which may be in the same or different antigens. In certain embodiments, one of the binding specificities is for an anti-CD70 antibody moiety and the other is for another antigen. In certain embodiments, bispecific antibodies may bind to two different epitopes of an anti-CD70 antibody moiety. Bispecific antibodies may also be used to localize cytotoxic agents to cells which express an anti-CD70 antibody moiety on their surface, such as anti-CD70 CAR T cells. Bispecific antibodies can be prepared as full length antibodies or antibody fragments. Among the bispecific antibodies are multispecific single-chain antibodies, e.g., diabodies, triabodies, and tetrabodies, tandem di-scFvs, and tandem tri-scFvs.

    [0079] Furthermore, in certain embodiments, anti-idiotype antibodies and antigen-binding fragments may be selected as agonists or antagonists of chimeric receptors comprising their target antibodies or antigen-binding fragments, allowing for selective detection, isolation, ablation and/or depletion (for example, killing via antibody-dependent cell-mediated cytotoxicity, ADCC), and/or stimulation or activation of cells with such chimeric receptors bound to or expressed on their surface. In some embodiments, the anti-idiotype antibodies can be humanized or fully human antibodies. Provided herein are anti-idiotype antibody agonists that exhibit activity to stimulate, such as activate, a CAR containing an extracellular binding domain derived from anti-CD70 antibody designated 4F11. In some aspects, such antibodies can be used in methods of stimulating and expanding specific CAR-expressing cells, including in processes for generating and preparing the CAR-expressing cells. In some embodiments, the methods of stimulating and expanding can be in vitro methods. In some embodiments, the methods of stimulating and expanding can be incorporated into the CAR T manufacturing process. In some embodiments, the methods of stimulating and expanding can be in vivo methods. In some embodiments, the anti-idiotype antibodies can be humanized or fully human antibodies.

    [0080] Also provided herein are nucleic acids encoding the provided anti-idiotype antibodies and fragments, and cells, such as recombinant cells, expressing and for production of these anti-idiotype antibodies and fragments. Also provided are methods of making and using the anti-idiotype antibodies and fragments, as well as cells expressing or containing the anti-idiotype antibodies and fragments.

    [0081] The scFv portion of some chimeric antigen receptors (CARs) is derived from the fully-human antibody clones 4F11 with high affinity to CD70. The present disclosure provides reagents to detect anti-CD70 CARs comprising an scFv portion derived from antibody clones 4F11. Disclosed herein are anti-idiotype antibodies that specifically bind to anti-CD70 clones 4F11, and anti-CD70 molecules derived from 4F11. Anti-id antibodies from 4F11 derived molecules disclosed herein demonstrate specific high affinity binding to chimeric antigen receptors (CARs) comprising a 4F11 derived scFv. One non-limiting example of the 4F11 derived scFv comprises the amino acid sequence of SEQ ID NO: 35.

    [0082] When conjugated to a bright fluorochrome, the anti-id antibodies disclosed herein stain cells expressing chimeric antigen receptors (CARs) comprising a 4F11 derived scFv with a high MFI and low background. The antibodies described herein can be used in a method to detect anti-CD70 CAR expression. These antibodies can be used for identification by both flow cytometry and immunohistochemistry. These antibodies can also be used in the context of, for example, non-clinical research studies, in the manufacturing of immune cells comprising a 4F11 derived scFv, as clinical flow-based pharmacokinetic reagents, and in clinical immunogenicity studies.

    [0083] 4F11 is a CD70 monoclonal antibody that recognizes human CD70. Single chain variable fragments (scFv) formed from 4F11 comprise the targeting component of some chimeric antigen receptors (CARs). In some embodiments, the scFv derived from the CD70 monoclonal antibody 4F11 comprises a part of the CD70 monoclonal antibody 4F11 immunoglobulin gamma 1 heavy chain (SEQ ID NO: 15) and a part of anti-CD70 monoclonal antibody 4F11 immunoglobulin kappa light chain (SEQ ID NO: 16), linked together by a flexible linker. In some embodiments, the scFv comprises the variable fragments of the anti-CD70 monoclonal antibody 4F11 immunoglobulin gamma 1 heavy chain and the variable fragments of the anti-CD70 monoclonal antibody 4F11 immunoglobulin kappa light chain linked together by a flexible linker.

    [0084] The anti-CD70 monoclonal antibody 4F11 immunoglobulin gamma 1 heavy chain variable domain comprises the amino acid sequence (4F11 VH), bolded residues indicating CDR sequences according to the Kabat naming system and underlined residues indicating CDR sequences according to the Chothia naming system:

    TABLE-US-00001 (SEQIDNO:15) QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVTWIRQPPGKALEW LAHIFSNDEKSYSTSLKSRLTISKDTSKTQVVLTMTNMDPVDTATYYCA RIRDYYDISSYYDYWGQGTLVSVSS

    [0085] The anti-CD70 monoclonal antibody 4F11 immunoglobulin kappa light chain variable domain comprises the amino acid sequence (4F11 VL), bolded residues indicating CDR sequences according to the Kabat naming system and underlined residues indicating CDR sequences according to the Chothia naming system:

    TABLE-US-00002 (SEQIDNO:16) DIQMTQSPSAMSASVGDRVTITCRASQDISNYLAWFQQKPGKVPKRLIY AASSLQSGVPSRFSGSGSGTEFTLTISSLLPEDFATYYCLQLNSFPFTF GGGTKVEIN

    [0086] An exemplary 4F11-derived chimeric antigen receptor (CAR) comprises or, alternatively, consists of the following amino acid sequence (the underlined is an exemplary signal peptide MALPVTALLLPLALLLHAARP SEQ ID NO: 39):

    TABLE-US-00003 (SEQIDNO:1) MALPVTALLLPLALLLHAARPQVTLKESGPVLVKPTETLTLTCTVSGFS LSNARMGVTWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSK TQVVLTMTNMDPVDTATYYCARIRDYYDISSYYDYWGQGTLVSVSSGGG GSGGGGSGGGGSDIQMTQSPSAMSASVGDRVTITCRASQDISNYLAWFQ QKPGKVPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLLPEDFATY YCLQLNSFPFTFGGGTKVEINTTTPAPRPPTPAPTIASQPLSLRPEACR PAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLL YIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQ GQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQK DKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
    or the mature protein without the signal peptide:

    TABLE-US-00004 (SEQIDNO:37) QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVTWIRQPPGKALEW LAHIFSNDEKSYSTSLKSRLTISKDTSKTQVVLTMTNMDPVDTATYYCA RIRDYYDISSYYDYWGQGTLVSVSSGGGGSGGGGSGGGGSDIQMTQSPS AMSASVGDRVTITCRASQDISNYLAWFQQKPGKVPKRLIYAASSLQSGV PSRFSGSGSGTEFTLTISSLLPEDFATYYCLQLNSFPFTFGGGTKVEIN TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIW APLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCS CRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLD KRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKG HDGLYQGLSTATKDTYDALHMQALPPR.

    [0087] A second exemplary 4F11-derived chimeric antigen receptor (CAR) comprises or, alternatively, consists of the following amino acid sequence (the underlined is an exemplary signal peptide, e.g., derived from CD8a):

    TABLE-US-00005 (SEQIDNO:34) MALPVTALLLPLALLLHAARPGGGGSCPYSNPSLCSGGGGSGGGGSQVT LKESGPVLVKPTETLTLTCTVSGFSLSNARMGVTWIRQPPGKALEWLAH IFSNDEKSYSTSLKSRLTISKDTSKTQVVLTMTNMDPVDTATYYCARIR DYYDISSYYDYWGQGTLVSVSSGGGGSGGGGSGGGGSDIQMTQSPSAMS ASVGDRVTITCRASQDISNYLAWFQQKPGKVPKRLIYAASSLQSGVPSR FSGSGSGTEFTLTISSLLPEDFATYYCLQLNSFPFTFGGGTKVEINGSG GGGSCPYSNPSLCSGGGGSELPTQGTFSNVSTNVSPAKPTTTACPYSNP SLCTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI YIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEED GCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYD VLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRR GKGHDGLYQGLSTATKDTYDALHMQALPPR
    or the mature protein without the signal peptide:

    TABLE-US-00006 (SEQIDNO:38) GGGGSCPYSNPSLCSGGGGSGGGGSQVTLKESGPVLVKPTETLTLTCTV SGFSLSNARMGVTWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISK DTSKTQVVLTMTNMDPVDTATYYCARIRDYYDISSYYDYWGQGTLVSVS SGGGGSGGGGSGGGGSDIQMTQSPSAMSASVGDRVTITCRASQDISNYL AWFQQKPGKVPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLLPED FATYYCLQLNSFPFTFGGGTKVEINGSGGGGSCPYSNPSLCSGGGGSEL PTQGTFSNVSTNVSPAKPTTTACPYSNPSLCTTTPAPRPPTPAPTIASQ PLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITL YCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFS RSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNP QEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDA LHMQALPPR.

    [0088] In some embodiments, the scFv comprises at least a part of amino acid sequences of SEQ ID NO: 15 and/or SEQ ID NO: 16. In some embodiments, the scFv comprises at least a part of amino acid sequences of SEQ ID NO: 15 and/or SEQ ID NO: 16, with or without the signal sequence. In some embodiments, the scFv comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98% or at least 99% sequence identity with the amino acid sequence of SEQ ID NO: 15 and/or SEQ ID NO: 16 and/or with SEQ ID NO: 35.

    [0089] An exemplary 4F11-derived scFv comprises or, alternatively, consists of the following amino acid sequence:

    TABLE-US-00007 (SEQIDNO:35) QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVTWIRQPPGKALEW LAHIFSNDEKSYSTSLKSRLTISKDTSKTQVVLTMTNMDPVDTATYYCA RIRDYYDISSYYDYWGQGTLVSVSSGGGGSGGGGSGGGGSDIQMTQSPS AMSASVGDRVTITCRASQDISNYLAWFQQKPGKVPKRLIYAASSLQSGV PSRFSGSGSGTEFTLTISSLLPEDFATYYCLQLNSFPFTFGGGTKVEIN

    [0090] An exemplary 4F11-derived scFv with a His tag comprises the following amino acid sequence:

    TABLE-US-00008 (SEQIDNO:36) QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVTWIRQPPGKALEW LAHIFSNDEKSYSTSLKSRLTISKDTSKTQVVLTMTNMDPVDTATYYCA RIRDYYDISSYYDYWGQGTLVSVSSGGGGSGGGGSGGGGSDIQMTQSPS AMSASVGDRVTITCRASQDISNYLAWFQQKPGKVPKRLIYAASSLQSGV PSRFSGSGSGTEFTLTISSLLPEDFATYYCLQLNSFPFTFGGGTKVEIN GGSGHHHHHHHHHH

    [0091] In some embodiments, the scFv comprises at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100% sequence identity with the amino acid sequence of SEQ ID NO: 1 or the amino acid sequence of SEQ ID NO: 34. Disclosed herein are antigen binding molecules, including antibodies, that specifically bind to the anti-CD70 scFv derived from 4F11, as well as molecules comprising these sequences and cells presenting such molecules. Humanized forms of the antigen binding molecules also form an aspect of the disclosure. Applications and uses of these antigen binding molecules are also disclosed.

    [0092] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.

    I. Antigen Binding Molecules and Polynucleotides Encoding Same

    [0093] An antigen binding domain as used herein means any polypeptide that binds a specified target antigen, for example the specified target antigen can be the CD70 protein or fragment thereof (referred to interchangeably herein as a CD70 antigen, CD70 target antigen, or CD70 target). In the context of an anti-idiotype antibody of the present disclosure, the target antigen is an antigen binding molecule that specifically binds CD70 (e.g., antibody clones 4F11 and antigen binding molecules derived from or related to 4F11, including scFvs).

    [0094] In some embodiments, the antigen binding domain binds to a CD70 antigen on a tumor cell. In some embodiments, the antigen binding domain binds to a CD70 antigen on a cell involved in a hyperproliferative disease or to a viral or bacterial antigen.

    [0095] Antigen binding domains include, but are not limited to, antibody binding regions that are immunologically functional fragments. The term immunologically functional fragment (or fragment) of an antigen binding domain is a species of antigen binding domain comprising a portion (regardless of how that portion is obtained or synthesized) of an antibody that lacks at least some of the amino acids present in a full-length chain, but which is still capable of specifically binding to a target antigen. Such fragments are biologically active in that they bind to the target antigen and can compete with other antigen binding domains, including intact antibodies, for binding to a given epitope. In some embodiments, the fragments are neutralizing fragments. In some embodiments, the fragments can block or reduce the activity of an anti-CD70 CAR (e.g., a blocking effect). In some embodiments, the fragments can antagonize the activity of an anti-CD70 CAR.

    [0096] In specific embodiments, an anti-id antibody of the instant disclosure is an antibody identified herein as Clone 60 or Clone 37 and comprises the heavy and light chain amino acids, variable regions, CDR sequences and nucleotide sequences encoding such sequences, as provided and labeled herein.

    [0097] Immunologically functional immunoglobulin fragments include, but are not limited to, scFv fragments, Fab fragments (Fab, F(ab)2, and the like), one or more complementarity determining regions (CDRs), a diabody (heavy chain variable domain on the same polypeptide as a light chain variable domain, connected via a short peptide linker that is too short to permit pairing between the two domains on the same chain), domain antibodies, bivalent antigen binding domains (comprises two antigen binding sites), multispecific antigen binding domains, and single-chain antibodies. These fragments can be derived from any mammalian source, including but not limited to human, mouse, rat, camelid or rabbit. As will be appreciated by one of skill in the art, an antigen binding domain can include non-protein components.

    [0098] The variable regions typically exhibit the same general structure of relatively conserved framework regions (FR) joined by the 3 hypervariable regions (CDRs). The CDRs from the two chains of each pair typically are aligned by the framework regions, which can enable binding to a specific epitope. From N-terminal to C-terminal, both light and heavy chain variable regions typically comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. By convention, CDR regions in the heavy chain are typically referred to as HC CDR1, CDR2, and CDR3. The CDR regions in the light chain are typically referred to as LC CDR1, CDR2, and CDR3.

    [0099] In some embodiments, antigen binding domains comprise one or more complementarity binding regions (CDRs) present in the full-length light or heavy chain of an antibody, and in some embodiments comprise a single heavy chain and/or light chain or portion thereof. These fragments can be produced by recombinant DNA techniques or can be produced by enzymatic or chemical cleavage of antigen binding domains, including intact antibodies.

    [0100] In some embodiments, the antigen binding domain is an antibody of fragment thereof, including one or more of the complementarity determining regions (CDRs) thereof. In some embodiments, the antigen binding domain is a single chain variable fragment (scFv), comprising light chain CDRs CDR1, CDR2 and CDR3, and heavy chain CDRs CDR1, CDR2 and CDR3.

    [0101] The assignment of amino acids to each of the framework, CDR, and variable domains is typically in accordance with numbering schemes of Kabat numbering (see, e.g., Kabat et al. in Sequences of Proteins of Immunological Interest, 5th Ed., NIH Publication 91-3242, Bethesda Md. 1991), Chothia numbering (see, e.g., Chothia & Lesk, (1987), J Mol Biol 196: 901-917; Al-Lazikani et al., (1997) J Mol Biol 273: 927-948; Chothia et al., (1992) J Mol Biol 227: 799-817; Tramontano et al., (1990) J Mol Biol 215(1): 175-82; and U.S. Pat. No. 7,709,226), contact numbering, or the AbM scheme (Antibody Modeling program, Oxford Molecular).

    [0102] Accordingly, in some embodiments, the CDRs of the anti-idiotype antibodies presented herein are numbered according to the Kabat numbering scheme. In other embodiments, the CDRs of the anti-idiotype antibodies presented herein are numbered according to the Chothia numbering scheme. In other embodiments, the CDRs of the anti-idiotype antibodies presented herein are numbered according to the contact numbering scheme. In other embodiments, the CDRs of the anti-idiotype antibodies presented herein are numbered according to the AbM numbering scheme.

    [0103] Humanized antibodies are described herein and can be prepared by known techniques. In some embodiments, a humanized monoclonal antibody comprises the variable domain of an anti-id antibody (or all or part of the antigen binding site thereof) and a constant domain derived from a human antibody. Alternatively, a humanized antibody fragment can comprise an antigen binding site of a murine or rabbit monoclonal antibody and a variable domain fragment (lacking the antigen binding site) derived from a human antibody. Procedures for the production of engineered monoclonal antibodies include those described in, e.g., Riechmann et al., (1988) Nature 332:323, Liu et al., (1987) Proc. Nat. Acad. Sci. USA 84:3439, Larrick et al., (1989) Bio Technology 7:934, and Winter et al., (1993) TIPS 14:139. In some embodiments, the chimeric antibody is a CDR grafted antibody. Techniques for humanizing antibodies are discussed in, e.g., U.S. Pat. Nos. 5,869,619; 5,225,539; 5,821,337; 5,859,205; 6,881,557; Padlan et al., (1995) FASEB J. 9:133-39; Tamura et al., (2000) J. Immunol. 164:1432-41; Zhang et al., (2005) Mol. Immunol. 42(12):1445-1451; Hwang et al., Methods. (2005) 36(1):35-42; Dall'Acqua et al., (2005) Methods 36(1):43-60; and Clark, (2000) Immunology Today 21(8):397-402.

    [0104] Variants of the anti-idiotype antibodies are also within the scope of the disclosure, e.g., variants that comprise a variable light and/or variable heavy domain or region that each have at least 70-80%, 80-85%, 85-90%, 90-95%, 95-97%, 97-99%, or above 99% identity to the amino acid sequences of the antigen binding domain sequences described herein. In some embodiments, the anti-idiotype antibody comprises an amino acid sequence that is at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to a heavy chain variable region sequence provided in Table 1a and/or a light chain variable region sequence provided in Table 1b, and optionally further comprise an amino acid sequence that is at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or 100% identical to a heavy chain constant region sequence provided in Table 1e and/or a light chain constant region sequence provided in Table 1e.

    [0105] In some instances, such molecules include at least one heavy chain and one light chain, whereas in other instances the variant forms contain two variable light chains and two variable heavy chains (or subparts thereof). A skilled artisan will be able to determine suitable variants of the anti-idiotype antibodies as set forth herein using well-known techniques. In certain embodiments, one skilled in the art can identify suitable areas of the molecule that can be changed without destroying activity by targeting regions not believed to be important for activity.

    [0106] An anti-id antibody of the present disclosure can also be a fully human monoclonal antibody. Fully human monoclonal antibodies can be generated by any number of techniques with which those having ordinary skill in the art will be familiar. Such methods include, but are not limited to, Epstein Barr Virus (EBV) transformation of human peripheral blood cells (e.g., containing B lymphocytes), in vitro immunization of human B-cells, fusion of spleen cells from immunized transgenic mice carrying inserted human immunoglobulin genes, isolation from human immunoglobulin V region phage libraries, or other procedures as known in the art and based on the disclosure herein.

    [0107] An anti-id antibody that specifically binds to anti-CD70 clone 4F11 and anti-CD70 molecules derived from 4F11 is said to be selective when it binds to one target more tightly than it binds to a second target.

    [0108] An anti-id antibody that specifically binds to anti-CD70 clones 4F11 and anti-CD70 molecules derived from 4F11 is said to specifically bind its target antigen (e.g., mouse 4F11 and molecules derived from 4F11) when the dissociation constant (Kd) is ?1 nM. The antigen binding domain specifically binds antigen with high affinity when the Kd is 1-5 nM, and with very high affinity when the Kd is 0.1-0.5 nM. In one embodiment, the antigen binding domain has a Kd of ?1 nM. In one embodiment, the off-rate is <1?10.sup.?5. In other embodiments, the antigen binding domains will bind to mouse 4F11 and molecules derived from 4F11 with a Kd of between about 1?10.sup.?7 M and 1?10.sup.?12 M, and in yet another embodiment the antigen binding domains will bind with a Kd between about 1?10.sup.?5 and 1?10.sup.?12.

    [0109] As provided herein, the anti-id antibodies of the present disclosure specifically bind 4F11 and molecules derived from 4F11 (e.g., 4F11 derived CARs). In certain embodiments, the anti-id antibodies of the present disclosure bind 4F11 and molecules derived from 4F11 with a KD of less than 1?10.sup.?6 M, less than 1?10.sup.?7 M, less than 1?10.sup.?8 M, or less than 1?10.sup.?9 M. In one particular embodiment, the anti-id antibodies bind 4F11 and molecules derived from 4F11 with a KD of less than 1?10.sup.?7 M. In another embodiment, the anti-id antibodies bind 4F11 and molecules derived from 4F11 with a KD of less than 1?10.sup.?8 M. In some embodiments, the anti-id antibodies bind 4F11 and molecules derived from 4F11 with a Kd of about 1?10.sup.?7 M, about 2?10-7 M, about 3?10.sup.?7 M, about 4?10.sup.?7 M, about 5?10.sup.?7 M, about 6?10.sup.?7 M, about 7?10.sup.?7 M, about 8?10?7 M, about 9?10.sup.?7 M, about 1?10.sup.?8 M, about 2?10.sup.?8 M, about 3?10.sup.?8 M, about 4?10.sup.?8 M, about 5?10.sup.?8 M, about 6?10-8 M, about 7?10.sup.?8 M, about 8?10.sup.?8 M, about 9?10.sup.?8 M, about 1?10.sup.?9 M, about 2?10.sup.?9 M, about 3?10.sup.?9 M, about 4?10.sup.?9 M, about 5?10.sup.?9 M, about 6?10.sup.?9 M, about 7?10.sup.?9 M, about 8?10.sup.?9 M, about 9?10.sup.?9 M, about 1?10.sup.?10 M, or about 5?10.sup.?10 M. In certain embodiments, the Kd is calculated as the quotient of K.sub.off/K.sub.on, and the K.sub.on and K.sub.off are determined using a monovalent antibody, such as a Fab fragment, as measured by, e.g., BIAcore? surface plasmon resonance technology. In other embodiments, the Kd is calculated as the quotient of K.sub.off/K.sub.on, and the K.sub.on and K.sub.off are determined using a bivalent antibody, such as a Fab fragment, as measured by, e.g., BIAcore? surface plasmon resonance technology.

    [0110] In some embodiments, the anti-id antibodies bind 4F11 and molecules derived from 4F11 with an association rate (k.sub.on) of less than 1?10.sup.?4 M.sup.?1 s.sup.?1, less than 2?10.sup.?4 M.sup.?1 s.sup.?1, less than 3?10.sup.?4 M.sup.?1 s.sup.?1, less than 4?10.sup.?4 M.sup.?1 s.sup.?1, less than 5?10.sup.?4 M.sup.?1 s.sup.?1, less than 7?10.sup.?4 M.sup.?1 s.sup.?1 less than 8?10.sup.?4 M.sup.?1 s.sup.?1, less than 9?10.sup.?4 M.sup.?1 s.sup.?1 less than 1?10.sup.?5 M.sup.?1 s.sup.?1, less than 2?10.sup.?5 M.sup.?1 s.sup.?1, less than 3?10.sup.?5 M.sup.?1 s.sup.?1, less than 4?10.sup.?5 M.sup.?1 s.sup.?1, less than 5?10.sup.?5 M.sup.?1 s.sup.?1 less than 6?10.sup.?5 M.sup.?1 s.sup.?1, less than 7?10.sup.?5 M.sup.?1 s.sup.?1 less than 8?10.sup.?5 M.sup.?1 s.sup.?1, less than 9?10.sup.?5 M.sup.?1 s.sup.?1, less than 1?10.sup.?6 M.sup.?1 s.sup.?1, less than 2?10.sup.?6 M.sup.?1 s.sup.?1, less than 3?10.sup.?6 M.sup.?1 s.sup.?1, less than 4?10.sup.?6 M.sup.?1 s.sup.?1, less than 5?10.sup.?6 M.sup.?1 s.sup.?1, less than 6?10.sup.?6 M.sup.?1 s.sup.?1, less than 7?10.sup.?6 M.sup.?1 s.sup.?1, less than 8?10.sup.?6 M.sup.?1 s.sup.?1, less than 9?10.sup.?6 M.sup.?1 s.sup.?1, or less than 1?10.sup.?7 M.sup.?1 s.sup.?1. In certain embodiments, the k.sub.on is determined using a monovalent antibody, such as a Fab fragment, as measured by, e.g., BIAcore? surface plasmon resonance technology. In other embodiments, the k.sub.on is determined using a bivalent antibody as measured by, e.g., BIAcore? surface plasmon resonance technology.

    [0111] In some embodiments, the anti-id antibodies bind 4F11 and molecules derived from 4F11 with an dissociation rate (k.sub.off) of less than 1?10.sup.?2 s.sup.?1, less than 2?10.sup.?2 s.sup.?1, less than 3?10.sup.?2 s.sup.?1, less than 4?10.sup.?2 s.sup.?1, less than 5?10.sup.?2 s.sup.?1, less than 6?10.sup.?2 s.sup.?1, less than 7?10.sup.?2 s.sup.?1, less than 8?10.sup.?2 s.sup.?1, less than 9?10.sup.?2 s.sup.?1, less than 1?10.sup.?3 s.sup.?1, less than 2?10.sup.?3 s.sup.?1, less than 3?10.sup.?3 s.sup.?1, less than 4?10.sup.?3 s.sup.?1, less than 5?10.sup.?3 s.sup.?1, less than 6?10.sup.?3 s.sup.?1, less than 7?10.sup.?3 s.sup.?1, less than 8?10.sup.?3 s.sup.?1, less than 9?10.sup.?3 s.sup.?1, less than 1?10.sup.?4 s.sup.?1, less than 2?10.sup.?4 s.sup.?1, less than 3?10.sup.?4 s.sup.?1, less than 4?10.sup.?4 s.sup.?1, less than 5?10.sup.?4 s.sup.?1, less than 6?10.sup.?4 s.sup.?1 less than 7?10.sup.?4 s.sup.?1, less than 8?10.sup.?4 s.sup.?1, less than 9?10.sup.?4 s.sup.?1, less than 1?10.sup.?5 s.sup.?1, or less than 5?10.sup.?5 s.sup.?1. In certain embodiments, the k.sub.off is determined using a monovalent antibody, such as a Fab fragment, as measured by, e.g., BIAcore? surface plasmon resonance technology. In other embodiments, the k.sub.off is determined using a bivalent antibody as measured by, e.g., BIAcore? surface plasmon resonance technology.

    [0112] Provided herein are anti-idiotype antibodies that specifically bind to anti-CD70 clones 4F11 and antigen binding molecules derived from 4F11, comprising a variable heavy chain (VH), wherein the amino acid sequence or polynucleotide sequence of the VH is selected from the VH sequences presented in Table 1a (CDRs under or according to the Kabat naming system are in bold and CDRs under or according to the Chothia naming system are underlined).

    TABLE-US-00009 TABLE1a HeavyChainVariableRegions(VH) Clone VHSequence SEQIDNO: AminoAcidSequence 1.60 EVQLQQSGPELVKTGTSVKISCKASGYSITGYYIHWVKQSHGRSLDW 2 IGSISFYNGATTYNQKFKGKVTFTVDTSSSTAYMQFNSLTSEDSAVY YCGRRGDDYDVFAYWGQGTLVTVSA 1.37 EVKLEESGGGLVQPGGSMKLSCAASGFTFSDAWMDWVRQSPEKGL 21 EWVAEIRNKANNHATYYAESVKGRFTISRDDSKYNVYLQMNSLRA EDTGIYYCARPLLRGNFDVWGAGTTVTVSS PolynucleotideSequence 1.60 GAGGTCCAGCTGCAGCAGTCTGGACCTGAACTAGTGAAGACTGGG 3 ACTTCAGTGAAGATTTCCTGCAAGGCTTCTGGTTACTCAATCACTG GTTACTACATACACTGGGTCAAACAGAGCCATGGAAGGAGCCTTG ACTGGATTGGAAGTATTAGTTTTTACAATGGTGCTACTACCTACAA CCAGAAATTCAAGGGCAAGGTCACATTTACTGTAGACACGTCTTC CAGCACAGCCTACATGCAGTTCAACAGCCTGACATCTGAAGACTC TGCGGTCTATTACTGTGGAAGAAGGGGAGATGATTACGACGTCTT TGCTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCA 1.37 GAAGTGAAGCTTGAGGAGTCTGGAGGAGGCTTGGTGCAACCTGG 22 AGGATCCATGAAACTCTCTTGTGCTGCCTCTGGATTCACTTTTAGT GACGCCTGGATGGACTGGGTCCGCCAGTCTCCAGAGAAGGGGCTT GAGTGGGTTGCTGAAATTAGAAACAAAGCTAATAATCATGCAACA TATTATGCTGAGTCTGTGAAAGGGAGGTTCACCATCTCAAGAGAT GATTCCAAATATAATGTCTACCTGCAAATGAACAGCTTAAGAGCT GAAGACACTGGCATTTATTACTGTGCCAGGCCTCTACTTAGGGGT AACTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTCTCCTCA

    [0113] Provided herein are anti-idiotype antibodies that specifically bind to anti-CD70 clones 4F11, comprising a variable light chain (VL), wherein the amino acid sequence or polynucleotide sequence of the VL is selected from the VL sequences presented in Table 1b (CDRs under or according to the Kabat naming system are in bold and CDRs under or according to the Chothia naming system are underlined).

    TABLE-US-00010 TABLE1b LightChainVariableRegions Clone VLSequence SEQIDNO: AminoAcidSequence 1.60 DIVLTQSPASLAVSLGQRATISCRASESVDSYGYSFLHWYQQKP 4 GQPPTLLIYRASNLESGIPARFSGSGSRTDFTLTINSVEADDVATY YCQQSNEDPWTFGGGTKLEIK 1.37 DIQMTQSSSYLSISLGGRVTITCKASDHINNWLAWYQQKSGNAP 23 RLLISGGTSLETGVPSRFSGSGSGKDYTLSITSLQTEDVATYYCQ QYWRTPFTFGSGTKLEIK PolynucleotideSequence 1.60 GACATTGTGCTGACCCAATCTCCAGCTTCTTTGGCTGTGTCTCT 5 AGGGCAGAGGGCCACCATATCCTGCAGAGCCAGTGAGAGTGT TGATAGTTATGGCTATAGTTTTTTGCACTGGTACCAGCAGAAA CCAGGACAGCCACCCACACTCCTCATCTATCGTGCATCCAACC TAGAATCTGGGATCCCTGCCAGGTTCAGTGGCAGTGGGTCTAG GACAGACTTCACCCTCACCATTAATTCTGTGGAGGCTGATGAT GTTGCAACCTATTACTGTCAGCAAAGTAATGAGGATCCGTGGA CGTTCGGTGGAGGCACCAAGCTGGAAATCAAA 1.37 GACATCCAGATGACACAATCTTCATCCTACTTGTCTATATCTCT 24 AGGAGGCAGAGTCACCATTACTTGCAAGGCAAGTGACCACAT TAATAATTGGTTAGCCTGGTATCAGCAGAAATCAGGAAATGC GCCTAGGCTCTTAATATCTGGTGGAACCAGTTTGGAAACTGGG GTTCCTTCCAGATTCAGTGGCAGTGGATCTGGAAAGGATTACA CTCTCAGCATTACCAGTCTTCAGACTGAAGATGTTGCTACTTA TTACTGTCAACAGTATTGGCGTACTCCATTCACGTTCGGCTCG GGGACAAAGTTGGAAATAAAA

    [0114] Provided herein are anti-idiotype antibodies that specifically bind to anti-CD70 clones 4F11 and antigen binding molecules derived from 4F11, wherein anti-id antibodies comprise a variable heavy chain (VH) and a variable light chain (VL), wherein the amino acid sequence or polynucleotide sequence of the VH is selected from the VH sequences presented in Table 1a; and wherein the amino acid sequence or polynucleotide sequence of the VL is selected from the VL sequences presented in Table 1b.

    [0115] In some embodiments, the anti-idiotype antibodies that specifically bind to anti-CD70 clones 4F11 and antigen binding molecules derived from 4F11, comprise a VH CDR 1, CDR2, and CDR3 of a VH sequence presented in Table 1a. In some embodiments, the VH CDR 1, CDR2, and CDR3 are selected from a CDR sequence presented in Table 1c.

    TABLE-US-00011 TABLE1c HeavyChainCDRs Clone CDRH1 CDRH2 CDRH3 1.60 GYYIH(SEQIDNO:6) SISFYNGATTYNQKFKG RGDDYDVFAY(SEQ (Kabat) (SEQIDNO:9)(Kabat) IDNO:11) GYSITGY(SEQIDNO:7) SFYNGA(SEQIDNO:10) (Kabat/Chothia) (Chothia) (Chothia) GYSITGYYIH(SEQID NO:8)(Extended) 1.37 DAWMD(SEQIDNO:25) EIRNKANNHATYYAESVKG PLLRGNFDV(SEQ (Kabat) (SEQIDNO:28)(Kabat) IDNO:30) GFTFSDA(SEQIDNO: RNKANNHA (Kabat/Chothia) 26)(Chothia) (SEQIDNO:29)(Chothia) GFTFSDAWMD(SEQID NO:27)(Extended)

    [0116] In some embodiments, the anti-idiotype antibodies that specifically bind to anti-CD70 clones 4F11 and antigen binding molecules derived from 4F11, comprise a VL CDR 1, CDR2, and CDR3 sequence presented in Table 1d.

    [0117] In some embodiments, the anti-idiotype antibodies that specifically bind to anti-CD70 clones 4F11 and antigen binding molecules derived from 4F11, comprise heavy chain and light chain constant region sequences presented in Table Ile.

    TABLE-US-00012 TABLE1d LightChainCDRs Clone CDRL1 CDRL2 CDRL3 1.60 RASESVDSYGYSFLH RASNLES(SEQIDNO: QQSNEDPWT(SEQID (SEQIDNO:12)(Kabat 13)(Kabat&Chothia) NO:14)(Kabat&Chothia) &Chothia) 1.37 KASDHINNWLA(SEQID GGTSLET(SEQIDNO: QQYWRTPFT(SEQID NO:31)(Kabat& 32)(Kabat&Chothia) NO:33)(Kabat&Chothia) Chothia)

    TABLE-US-00013 TABLEle 1.60ConstantRegions SEQID Clone Sequence NO: AminoAcidSequence IDA2002-1.60(or RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDG 17 clone60)mouse SERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEA kappalightchain THKTSTSPIVKSFNRNEC constant(1.60CL)- AminoAcid IDA2002-1.60 GTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTT 18 mousekappalight CGGGCTGATGCTGCACCAACTGTATCCATCTTCCCACCATCCA chainconstant GAACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGAT (1.60CL)-DNA TGATGGCAGTGAACGACAAAATGGCGTCCTGAACAGTTGGAC TGATCAGGACAGCAAAGACAGCACCTACAGCATGAGCAGCAC CCTCACGTTGACCAAGGACGAGTATGAACGACATAACAGCTA TACCTGTGAGGCCACTCACAAGACATCAACTTCACCCATTGTC AAGAGCTTCAACAGGAATGAGTGT PolynucleotideSequence IDA2002-1.60 SLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASS 19 mouseIgG1heavy AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSG chainconstant TKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVT (1.60CH)- CVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVS AminoAcid ELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVY TIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKN TQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHH TEKSLSHSPGK IDA2002-1.60 TGGGGCCAAGGGACTCTGGTCACTGTCTCTGCAGCCAAAACG 20 mouseIgG1heavy ACACCCCCATCTGTCTATCCACTGGCCCCTGGATCTGCTGCCC chainconstant AAACTAACTCCATGGTGACCCTGGGATGCCTGGTCAAGGGCT (1.60CH)-DNA ATTTCCCTGAGCCAGTGACAGTGACCTGGAACTCTGGATCCCT GTCCAGCGGTGTGCACACCTTCCCAGCTGTCCTGCAGTCTGAC CTCTACACTCTGAGCAGCTCAGTGACTGTCCCCTCCAGCACCT GGCCCAGCGAGACCGTCACCTGCAACGTTGCCCACCCGGCCA GCAGCACCAAGGTGGACAAGAAAATTGTGCCCAGGGATTGTG GTTGTAAGCCTTGCATATGTACAGTCCCAGAAGTATCATCTGT CTTCATCTTCCCCCCAAAGCCCAAGGATGTGCTCACCATTACT CTGACTCCTAAGGTCACGTGTGTTGTGGTAGACATCAGCAAGG ATGATCCCGAGGTCCAGTTCAGCTGGTTTGTAGATGATGTGGA GGTGCACACAGCTCAGACGCAACCCCGGGAGGAGCAGTTCAA CAGCACTTTCCGCTCAGTCAGTGAACTTCCCATCATGCACCAG GACTGGCTCAATGGCAAGGAGTTCAAATGCAGGGTCAACAGT GCAGCTTTCCCTGCCCCCATCGAGAAAACCATCTCCAAAACCA AAGGCAGACCGAAGGCTCCACAGGTGTACACCATTCCACCTC CCAAGGAGCAGATGGCCAAGGATAAAGTCAGTCTGACCTGCA TGATAACAGACTTCTTCCCTGAAGACATTACTGTGGAGTGGCA GTGGAATGGGCAGCCAGCGGAGAACTACAAGAACACTCAGCC CATCATGGACACAGATGGCTCTTACTTCGTCTACAGCAAGCTC AATGTGCAGAAGAGCAACTGGGAGGCAGGAAATACTTTCACC TGCTCTGTGTTACATGAGGGCCTGCACAACCACCATACTGAGA AGAGCCTCTCCCACTCTCCTGGTAAA

    [0118] In some of any such embodiments, the target antibody or antigen-binding fragment is within or including in the antigen-binding domain of the extracellular portion of a chimeric antigen receptor; and/or the anti-id antibody or antigen-binding fragment specifically binds the target antibody or antigen-binding fragment contained within or included in the antigen-binding domain of the extracellular portion of a CAR. In some embodiments, the target antibody or antigen-binding fragment is an scFv and the anti-id antibody or antigen-binding fragment specifically binds to an epitope in the scFv of the CAR. In some of any such embodiments, the antibody or fragment specifically binds to a scFv derived from antibody 4F11 contained in the extracellular portion of a chimeric antigen receptor, optionally wherein the scFv derived from antibody 4F11 contains a heavy chain variable region set forth in SEQ ID NO: 15 and/or a light chain variable region set forth in SEQ ID NO: 16 (e.g. an scFv comprising the amino acid sequence of SEQ ID NO: 35). In certain embodiments, the anti-id antibody or antigen-binding fragment thereof binds to an epitope in an scFv derived from 4F11, e.g., the scFv of SEQ ID NO: 35, and does not bind to the anti-CD70 antibody clone 4F11 in an IgG format. In some embodiments, the anti-id antibody or antigen-binding fragment thereof binds to 4F11 differentially in the scFv format and the IgG format. In some embodiments, the anti-id antibody or antigen-binding fragment thereof advantageously differentiates 4F11 in the scFv format from the IgG format.

    [0119] In some of any such embodiments, the anti-idiotype antibody or antigen-binding fragment specifically binds to an epitope within or including all or a portion of a complementarity determining region (CDR) of the target antibody or antigen-binding fragment.

    [0120] In some of any such embodiments, the anti-idiotype antibody or fragment is an antagonist antibody of a CAR containing the target antibody or antigen-binding fragment. In some of any such embodiments, the antibody or fragment is an antagonist of a CAR containing the target antibody or antigen-binding fragment.

    [0121] In some of any such embodiments, the anti-idiotype antibody or antigen-binding fragment thereof is humanized. In some of any such embodiments, the anti-idiotype antibody or antigen-binding fragment thereof is recombinant. In some of any such embodiments, the anti-idiotype antibody or antigen-binding fragment thereof is monoclonal.

    [0122] In some of any such embodiments, the anti-idiotype antibody or antigen-binding fragment thereof is an antigen-binding fragment. In some aspects, the antigen-binding fragment is selected from among fragment antigen binding (Fab) fragments, F(ab) 2 fragments, Fab fragments, Fv fragments, a single chain variable fragment (scFv) or a single domain antibody.

    [0123] In some of any such embodiments, the anti-idiotype antibody or antigen-binding fragment thereof contains at least a portion of an immunoglobulin constant region. In some embodiments, the at least a portion of an immunoglobulin constant region contains an Fc region or a portion of the Fc containing the CH2 and CH3 domains. In some aspects, the constant region is derived from human IgG. In some of any such embodiments, the anti-idiotype antibody or antigen-binding fragment is an intact antibody or full-length antibody.

    [0124] Provided herein is a vector containing the nucleic acid molecule according to any one of the embodiments described herein. Also provided herein is a cell containing the anti-idiotype antibody or antigen-binding fragment thereof according to any one of the embodiments described herein or the nucleic acid molecule according to any one of the embodiments described herein.

    [0125] The disclosure encompasses modifications to the anti-id antibodies comprising the sequences shown in Tables 1a to 1e, including functionally equivalent anti-id antibodies having modifications which do not significantly affect their properties and variants which have enhanced or decreased activity and/or affinity. For example, the amino acid sequence can be mutated to obtain an anti-id antibody with the desired binding affinity to anti-CD70 clones 4F11 and antigen binding molecules derived from 4F11. Modification of polypeptides is routine practice in the art and thus need not be described in detail herein. Examples of modified polypeptides include polypeptides with conservative substitutions of amino acid residues, one or more deletions or additions of amino acids which do not significantly deleteriously change the functional activity, or which mature (enhance) the affinity of the polypeptide for its ligand, or the use of chemical analogs.

    [0126] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to an epitope tag. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody of an enzyme or a polypeptide which increases the half-life of the antibody in the blood circulation.

    [0127] Substitution variants have at least one amino acid residue in the antigen binding domain removed and a different residue inserted in its place. In some embodiments, sites of interest for substitutional mutagenesis include the hypervariable regions/CDRs, but FR alterations are also contemplated. Conservative substitutions are shown in Table 2 under the heading of conservative substitutions. If such substitutions result in a change in biological activity, then more substantial changes, denominated exemplary substitutions in Table 2, or as further described below in reference to amino acid classes, can be introduced and the products screened.

    TABLE-US-00014 TABLE 2 Amino Acid Substitutions Original Residue (naturally occurring amino Conservative acid) Substitutions Exemplary Substitutions Ala (A) Val Val; Leu; Ile Arg (R) Lys Lys; Gln; Asn Asn (N) Gln Gln; His; Asp, Lys; Arg Asp (D) Glu Glu; Asn Cys (C) Ser Ser; Ala Gln (Q) Asn Asn; Glu Glu (E) Asp Asp; Gln Gly (G) Ala Ala His (H) Arg Asn; Gln; Lys; Arg Ile (I) Leu Leu; Val; Met; Ala; Phe; Norleucine Leu (L) Ile Norleucine; Ile; Val; Met; Ala; Phe Lys (K) Arg Arg; Gln; Asn Met (M) Leu Leu; Phe; Ile Phe (F) Tyr Leu; Val; Ile; Ala; Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr Tyr; Phe Tyr (Y) Phe Trp; Phe; Thr; Ser Val (V) Leu Ile; Leu; Met; Phe; Ala; Norleucine

    II. Methods of Making Anti-Id Antibodies

    [0128] For cloning of polynucleotides, the vector can be introduced into a host cell (an isolated host cell) to allow replication of the vector itself and thereby amplify the copies of the polynucleotide contained therein. The cloning vectors can contain sequence components generally include, without limitation, an origin of replication, promoter sequences, transcription initiation sequences, enhancer sequences, and selectable markers. These elements can be selected as appropriate by a person of ordinary skill in the art. For example, the origin of replication can be selected to promote autonomous replication of the vector in the host cell.

    [0129] In certain embodiments, the present disclosure provides isolated host cells containing the vector provided herein. The host cells containing the vector can be useful in expression or cloning of the polynucleotide contained in the vector. Suitable host cells can include, without limitation, prokaryotic cells, fungal cells, yeast cells, or higher eukaryotic cells such as mammalian cells. Suitable prokaryotic cells for this purpose include, without limitation, eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescens, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis, Pseudomonas such as P. aeruginosa, and Streptomyces.

    [0130] The vector can be introduced to the host cell using any suitable methods known in the art, including, without limitation, DEAE-dextran mediated delivery, calcium phosphate precipitate method, cationic lipids mediated delivery, liposome mediated transfection, electroporation, microprojectile bombardment, receptor-mediated gene delivery, delivery mediated by polylysine, histone, chitosan, and peptides. Standard methods for transfection and transformation of cells for expression of a vector of interest are well known in the art. In a further embodiment, a mixture of different expression vectors can be used in genetically modifying a donor population of immune effector cells wherein each vector encodes a different CAR as disclosed herein. The resulting transduced immune effector cells form a mixed population of engineered cells, with a proportion of the engineered cells expressing more than one different CARs.

    [0131] In one embodiment, the disclosure provides a method of evaluating genetically engineered cells expressing a CAR which targets a CD70. In some embodiments the engineered cells are evaluated after thawing the cryopreserved immune cells.

    [0132] In some embodiments, the cells are formulated by first harvesting them from their culture medium, and then washing and concentrating the cells in a medium and container system suitable for administration (a pharmaceutically acceptable carrier) in a treatment-effective amount. Suitable infusion media can be any isotonic medium formulation, typically normal saline, Normosol? R (Abbott) or Plasma-Lyte? A (Baxter), but also 5% dextrose in water or Ringer's lactate can be utilized. The infusion medium can be supplemented with human serum albumin.

    [0133] In some aspects, the anti-id antibodies of the present disclosure are used to quantify desired treatment amounts of cells in a composition of engineered T cells comprising a 4F11 derived CAR, e.g., an anti-CD70 CAR (such as a CAR comprising a 4F11 derived scFv) or a fragment thereof. In some embodiments, the desired treatment amount is generally at least 2 cells (for example, at least 1 CD8+ central memory T cell and at least 1 CD4+ helper T cell subset) or is more typically greater than 10.sup.2 cells, and up to 10.sup.6, up to and including 10.sup.8 or 10.sup.9 cells and can be more than 10.sup.10 cells. The number of cells will depend upon the desired use for which the composition is intended, and the type of cells included therein. The density of the desired cells is typically greater than 10.sup.6 cells/ml and generally is greater than 10.sup.7 cells/ml, generally 10.sup.8 cells/ml or greater. A clinically relevant number of immune cells can be apportioned into multiple infusions that cumulatively equal or exceed 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, or 10.sup.12 cells. In some aspects of the present disclosure, particularly since all the infused cells will be redirected to a particular target antigen (CD70), lower numbers of cells, in the range of 10.sup.6/kilogram (10.sup.6-10.sup.11 per patient) can be administered. CAR treatments can be administered multiple times at dosages within these ranges. The cells can be autologous, allogeneic, or heterologous to the patient undergoing therapy.

    [0134] The CAR expressing cell populations of the present disclosure can be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2 or other cytokines or cell populations. Pharmaceutical compositions of the present disclosure can comprise a CAR or TCR expressing cell population, such as T cells, as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions can comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions of the present disclosure can be formulated for intravenous administration. The pharmaceutical compositions (solutions, suspensions or the like), can include one or more of the following: sterile diluents such as water for injection, saline solution such as physiological saline, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic mono- or diglycerides which can serve as the solvent or suspending medium, polyethylene glycols, glycerin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic. An injectable pharmaceutical composition can be sterile.

    III. Methods of Determining Numbers of Cells Expressing an Anti-CD70 CAR

    [0135] The present disclosure provides a method to determine the number of cells present in a sample that are expressing an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof. For example, it can be desirable to determine the number of immune cells present in a sample obtained from a subject that are expressing an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof. Or it can be desirable to determine the number of cells transfected and expressing an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof, which can be used as a measure of the level of efficiency of the transfection. The disclosed method can be employed in these and other applications in which it is desirable to determine the number of cells present in a sample that are expressing a molecule of interest such as an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof.

    [0136] Thus, a method of determining a number of cells presenting a molecule in a sample wherein the molecule comprises a polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof is provided.

    [0137] In some embodiments, a sample comprising cells known or suspected to be expressing a molecule of interest comprising a polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof is provided.

    [0138] The sample is then contacted with an antigen binding molecule that specifically binds the molecule of interest, under conditions that permit the formation of a binding complex comprising a cell present in the sample and the antigen binding molecule. The antigen binding molecule can be an antigen binding molecule (or fragment thereof) disclosed herein, e.g., in the Figures, Sequence Listing or the instant section of the disclosure. Any antigen binding molecule that specifically binds a polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof can be employed in the disclosed method. Multiple examples of suitable antigen binding molecules are provided herein, e.g., those having or one or more of the VH and VL shown in Tables 1a and 1b or one or more of the CDRs shown in Tables 1c and 1d and described herein.

    [0139] The cell can be of any type, and can be human or non-human (e.g., mouse, rat, rabbit, hamster, etc.). In some embodiments, the cell is an immune cell. An immune cell of the method can be any type of immune cell (e.g., B lymphocytes, monocytes, dendritic cells, Langerhans cells, keratinocytes, endothelial cells, astrocytes, fibroblasts, and oligodendrocytes). In some embodiments, the immune cells are T cells including T cytotoxic, T helper and Treg cells. In specific embodiments, the cells are T cells, which can be obtained as described herein and by methods known in the art. Any type of immune cell can be employed in this embodiment of the disclosed method, and the cell can be a human or non-human cell (including both prokaryotic and eukaryotic cells). Exemplary cells include, but are not limited to, immune cells such as T cells, tumor infiltrating lymphocytes (TILs), NK cells, TCR-expressing cells, dendritic cells, and NK-T cells. The T cells can be autologous, allogeneic, or heterologous. In additional embodiments, the cells are T cells presenting a CAR. The T cells can be CD4+ T cells or CD8+ T cells. When a T cell is employed in the disclosed methods, the T cell can be an in vivo T cell or an in vitro T cell. Moreover, the cells can be disposed in, or isolated from, any environment capable of maintaining the cells in a viable form, such as blood, tissue or any other sample obtained from a subject, cell culture media, tissue grown ex vivo, a suitable buffer, etc.

    [0140] In some embodiments, the sample comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof is contacted with an anti-id antibody disclosed herein that specifically binds a CD70 derived binding molecule. In some embodiments, the anti-id antibody comprises a detectable label. In some embodiments, the detectable label conjugated anti-id antibody is contacted with the sample expressing an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv), under conditions that permit the formation of a binding complex comprising a cell present in the sample and the anti-id antibody. Any anti-id antibody that specifically binds an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) can be employed in the disclosed method. Multiple examples of suitable anti-id antibody are provided herein, e.g., those having one or more of the CDRs shown in Table 1c or 1d.

    [0141] Any detectable label can be employed in the methods, as described herein, and suitable labels can be selected using a desired set of criteria. Examples of types of detectable labels include fluorescent labels (e.g., fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malachite green, stilbene, Lucifer Yellow, Cascade Blue, Texas Red, IAEDANS, EDANS, BODIPY FL, LC Red 640, Cy 5, Cy 5.5, LC Red 705, Oregon green, the Alexa-Fluor dyes (Alexa Fluor 350, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 647, Alexa Fluor 660, Alexa Fluor 680), Cascade Blue, Cas-cade Yellow and R-phycoerythrin (PE) (Molecular Probes), FITC, Rhodamine, and Texas Red (Pierce), Cy5, Cy5.5, Cy7 (Amersham Life Science). Suitable optical dyes, including fluoro-phores, are described in Johnson, Molecular Probes Handbook: A Guide to Fluorescent Probes and Labeling Techniques, 11.sup.th Edition, Life Technologies, (2010), hereby expressly incorporated by reference, radiolabels (e.g., isotope markers such as .sup.3H, .sup.11C, .sup.14C, .sup.15N, .sup.18F, .sup.35S, .sup.64CU, .sup.90Y .sup.99Tc, .sup.111In, .sup.124I, .sup.125I .sup.131I), photochromic compounds, a Halo-tag, Atto dyes, Tracy dyes, proteinaceous fluorescent labels (e.g., proteinaceous fluorescent labels also include, but are not limited to, green fluorescent protein, including a Renilla, Ptilosarcus, or Aequorea species of GFP (Chalfie et al., (1994) Science 263:802-805), EGFP (Clon-tech Labs., Inc., Genbank Accession Number U55762), blue fluorescent protein (BFP, Quantum Biotechnologies, Inc; Stauber, (1998) Biotechniques 24:462-471; Heim et al., (1996) Curr. Biol. 6: 178-182), enhanced yellow fluorescent protein (Clontech Labs., Inc.), luciferase (Ichiki et al., (1993) J. Immunol. 150:5408-5417), magnetic labels (e.g., DYNABEADS), etc. Strategies for the labeling of proteins are well known in the art and can be employed in the disclosed method. See, e.g., Obermaier et al., (2015) Methods Mol Biol 1295:153-65; Strack (2016) Nature Methods 13:33; Site-Specific Protein Labeling: Methods and Protocols, (Gautier and Hinner, eds.) 2015, Springer. In some embodiments, the detectable label is a phycoerythrin (PE) or allophycocyanin (APC) fluorescent probe.

    [0142] The label can be associated with the anti-id antibody at any position in the molecule, although it can be desirable to associate the label with the antibody at a position (or positions, if multiple labels are employed) at a point such that the binding properties of the molecule are not modified (unless such modified binding activity is desired). Any antigen binding molecule that specifically binds a CD70 binding molecule (or fragment thereof) can be employed, such as those disclosed herein, e.g., those having one or more of the CDRs shown in Table 1c or 1d.

    [0143] The antigen binding molecule can be disposed on any surface, or no surface at all. For example, the antigen binding molecule can be present in a buffer and the buffer-antigen binding molecule can be contacted with the sample. Alternatively, the antigen binding molecule can be associated with a surface. Suitable surfaces include agarose beads, magnetic beads such as DYNABEADS?, or a plastic, glass or ceramic plate such as a welled plate, a bag such as a cell culture bag, etc. The surface can itself be disposed in another structure, such as a column.

    [0144] Conditions that permit the formation of a binding complex will be dependent on a variety of factors, however generally aqueous buffers at physiological pH and ionic strength, such as in phosphate-buffered saline (PBS), will favor formation of binding complexes and are desirable in the disclosed method.

    [0145] The number of cells present in a binding complex in the sample is determined. The specific method employed to determine the number of cells present in a binding complex will be dependent on the nature of the label selected. For example, FACS can be employed when a fluorescent label is selected; when an isotope label is selected mass spectrometry, NMR or other technique can be employed; magnetic-based cell sorting can be employed when a magnetic label is chosen; microscopy can also be employed. The output of these detection methods can be in the form of a number of cells or the output can be of a form that allows the calculation of the number of cells based on the output.

    IV. Methods of Determining the Presence or Absence of a 4F11 Derived Anti-CD70 CAR

    [0146] In some embodiments, knowing whether a molecule comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof, is present or absent from a sample is sufficient information. For example, it can be beneficial to know that such a molecule is being expressed, regardless of the level of expression. In other cases, it can be desirable to know if a purification process or step designed to remove such a molecule has been effective. Thus, the qualitative determination of the presence or absence of an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof, can be useful in multiple applications.

    [0147] In some embodiments, a method of determining the presence or absence in a sample of a polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof, in a sample is provided.

    [0148] In some embodiments, the method comprises providing a sample known or suspected to comprise a polypeptide comprising an anti-CD70CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof.

    [0149] The disclosure provides an antigen binding molecule that specifically binds a polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof, which includes a detectable label. Suitable labels can be selected using a desired set of criteria. Examples of types of detectable labels include fluorescent labels (e.g., fluorescein, rhodamine, tetramethylrhodamine, eosin, erythrosin, coumarin, methyl-coumarins, pyrene, Malachite green, stilbene, Lucifer Yellow, Cascade Blue, Texas Red, IAEDANS, EDANS, BODIPY FL, LC Red 640, Cy 5, Cy 5.5, LC Red 705, Oregon green, the Alexa-Fluor dyes (Alexa Fluor 350, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 633, Alexa Fluor 647, Alexa Fluor 660, Alexa Fluor 680), Cascade Blue, Cas-cade Yellow and R-phycoerythrin (PE) (Molecular Probes), FITC, Rhodamine, and Texas Red (Pierce), Cy5, Cy5.5, Cy7 (Amersham Life Science)). Suitable optical dyes, including fluorophores, are described in Johnson, Molecular Probes Handbook: A Guide to Fluorescent Probes and Labeling Techniques, 11.sup.th Edition, Life Technologies, (2010), hereby expressly incorporated by reference, radiolabels (e.g., isotope markers such as .sup.3H, .sup.11C, .sup.14C, .sup.15N, .sup.18F, 35S, .sup.64CU, .sup.90Y, .sup.99Tc, .sup.111In, 124I 125I 131I). Photochromic compounds, a Halo-tag, Atto dyes, Tracy dyes, proteinaceous fluorescent labels (e.g., proteinaceous fluorescent labels also include, but are not limited to, green fluorescent protein, including a Renilla, Ptilosarcus, or Aequorea species of GFP (Chalfie et al., (1994) Science 263:802-805), EGFP (Clon-tech Labs, Inc., Genbank Accession Number U55762), blue fluorescent protein (BFP, Quantum Biotechnologies, Inc.; Stauber, (1998) Biotechniques 24:462-471; Heim et al., (1996) Curr. Biol. 6: 178-182), enhanced yellow fluorescent protein (Clontech Labs, Inc.), luciferase (Ichiki et al., (1993) J. Immunol. 150:5408-5417), magnetic labels (e.g., DYNABEADS?), etc. can also be employed. Strategies for the labeling of proteins are well known in the art and can be employed in the disclosed methods. The label can be associated with the antigen binding molecule at any position in the molecule, although it can be desirable to associate the label with the molecule at a position (or positions, if multiple labels are employed) at a point such that the binding properties of the molecule are not modified (unless such modified binding activity is desired). Any antigen binding molecule that specifically binds a polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof can be employed, such as those disclosed herein, e.g., those having one or more of the VH and VL sequences described in Tables 1a and 1b and/or one or more CDRs described in Tables 1c and 1d.

    [0150] Next, the sample is contacted with the antigen binding molecule under conditions that permit the formation of a binding complex comprising a cell present in the sample and the antigen binding molecule.

    [0151] The sample is contacted with the antigen binding molecule, under conditions that permit the formation of a binding complex between a polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof and the antigen binding molecule. Conditions that permit the formation of a binding complex will be dependent on a variety of factors. Since the component parts of a binding complex can be disposed on surfaces as described herein, formed binding complexes can also be disposed on surfaces.

    [0152] At this stage, no binding complexes can have formed, or a plurality of binding complexes comprising one or more antigen binding molecules bound to a polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof can have formed. Unbound molecules comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof and/or unbound antigen binding molecules can also be present in the local environment of any formed binding complexes.

    [0153] Any molecules not part of a binding complex are then separated from any formed binding complexes. The method of the removal will depend on the structure and/or local environment of the binding complexes. For example, if the antigen binding molecule is disposed on a bead, plate or bag the unbound components of the reaction mixture can be washed away using a solution that leaves formed binding complexes intact. In some embodiments, separation of the binding complex is not required for detection.

    [0154] The solution used to induce the formation of binding complexes can be used, for example, as a wash solution to remove unbound components. Any suitable buffer or solution that does not disrupt formed binding complexes can also be used. Typically, buffers having high salt concentrations, non-physiological pH, containing chaotropes or denaturants, should be avoided when performing this step of the method.

    [0155] The presence or absence of a binding complex, which will comprise a polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof and an antigen binding molecule, can be detected. The specific method employed to detect the presence or absence of a binding complex will typically be dependent on the nature of the label selected. In some embodiments, the detection method is by colorimetric assay. The result of the method is a qualitative assessment of the presence or absence of the antigen binding molecule comprising the detectable label, and thus, the presence or absence of its binding partner, a polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof.

    [0156] As is the case with the disclosed methods, the polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof can be disposed in any environment. In some embodiments, the polypeptide comprising an anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv) or a fragment thereof is expressed on the surface of a cell. In this embodiment, the cell can be of any type, and can be human or non-human (e.g., mouse, rat, rabbit, hamster, etc.). In some embodiments, the cell is an immune cell. An immune cell of the method can be any type of immune cell (e.g., B lymphocytes, monocytes, dendritic cells, Langerhans cells, keratinocytes, endothelial cells, astrocytes, fibroblasts, and oligodendrocytes). T cells (including T cytotoxic, T helper and Treg cells) are especially suitable. In specific embodiments, the cells are T cells, which can be obtained as described herein and by methods known in the art. Any type of immune cell can be employed in this embodiment of the disclosed method, and the cell can be a human or non-human cell. Exemplary cells include, but are not limited to, immune cells such as T cells, tumor infiltrating lymphocytes (TILs), NK cells, dendritic cells, and NK-T cells. The T cells can be autologous, allogeneic, or heterologous. In additional embodiments, the cells are T cells presenting a TCR. The T cells can be CD4+ T cells or CD8+ T cells. When a T cell is employed in the disclosed methods, the T cell can be an in vivo T cell or an in vitro T cell. Further, cells can be derived from a stem cell, such as an iPSC cell, cord blood cell, or mesenchymal stem cell.

    [0157] In some embodiments, the cell can be disposed in, or isolated from, any environment capable of maintaining the cell in a viable form, such as blood, tissue or any other sample obtained from a subject, cell culture media, tissue grown ex vivo, a suitable buffer, etc. In some embodiments, the cell is in a formalin-fixed sample. In some embodiments, the sample is a formalin-fixed paraffin embedded tissue (FFPE).

    V. Methods and Uses of the Antibodies

    [0158] In some embodiments, provided herein are methods involving the use of one or more anti-idiotype antibodies. In some aspects, provided herein are methods for measuring or detecting a target antibody, such as a CAR or a cell expressing a CAR, and methods for modifying the activity of the target antibody, such as the activity of a CAR or the activity of a cell expressing a CAR. In certain embodiments, the one or more anti-idiotype antibodies bind, detect, identify, and/or quantify the CAR and/or cells expressing the CAR. In some embodiments, the methods provided herein provide one or more steps of contacting and/or incubating the one or more anti-idiotype antibodies with a cell or a sample containing or thought to be containing cells that express a chimeric antigen receptor (CAR). In some embodiments, the anti-idiotype antibody is treated, incubated, and/or contacted with the composition or sample under conditions that allow for the formation of a complex between the anti-idiotype antibody and the target antibody, e.g., the CAR. In some aspects, the complex may be utilized for the purposes of detecting, isolating, and/or measuring the CAR. In some embodiments, the formation of the complex modifies the activity of the target antibody, e.g., the CAR, such as by stimulating receptor signaling activity, or in some embodiments, antagonizing the activity of the target antibody, e.g., the CAR, by preventing the association of the CAR with an antigen.

    A. Detection/Isolation Methods

    [0159] In some embodiments, there are provided methods involving use of one or more of the anti-idiotype antibodies, and/or molecules (such as conjugates and complexes) containing one or more of such anti-idiotype antibodies, for detecting, binding, and/or isolating an antibody, e.g., a target antibody. In certain embodiments, the methods provide one or more steps of contacting, incubating, and/or exposing the one or more anti-idiotype antibodies to a sample and/or composition. In some embodiments, the sample and/or composition has, is likely to have, and/or is suspected of having a target antibody and/or antigen binding fragment thereof that is bound by and/or recognized by the one or more anti-idiotype antibodies. In certain embodiments, the antibody or antigen binding fragment thereof that is bound by or recognized by the one or more anti-idiotype antibodies contains one or more fusion domains and/or is a fusion protein. In certain embodiments, the target antibody and/or antigen binding fragment thereof is or is present in a CAR. In certain embodiments, the anti-idiotype antibody binds to and/or recognizes an anti-CD70 antibody (e.g., antibody 4F11), or an antigen-binding fragment thereof, including a chimeric molecule or conjugate including a CAR, containing such anti-CD70 antibody (e.g., antibody fragment).

    [0160] The methods in some embodiments include incubating, treating, and/or contacting a sample and/or a composition containing or suspected of containing the target antibody with the anti-idiotype antibody. In certain embodiments, the incubating is under conditions permissive for binding of the anti-idiotype antibody to the target antibody present in the composition, for example to form a complex containing the anti-idiotype antibody and the target antibody.

    [0161] In some embodiments, the sample and/or composition contains or is suspected of containing the target antibody, e.g., a CAR. In certain embodiments, the sample and/or composition contains or is suspected of containing cells that express the target antibody, e.g., a CAR. In certain embodiments, the sample is a biological sample. In particular embodiments, the sample is a serum sample or a blood sample. In some embodiments, the biological sample contains one or more immune cells. In some embodiments, the biological sample is or is derived from a tissue, such as connective tissue, muscle tissue, nervous tissue, or epithelial tissue. In particular embodiments, the biological sample is taken, collected, and/or obtained from a human subject. In certain embodiments, the sample contains cells that are live and/or intact. In some embodiments, the sample is or contains a homogenate and/or cells that have been disrupted and/or lysed. In some embodiments, the biological sample contains proteins and/or antibodies that have been isolated from blood, serum, and/or a tissue.

    [0162] In particular embodiments, the anti-idiotype antibody forms or is capable of forming a complex with a target antibody, e.g., a CAR. In particular embodiments, the complex is detected, measured, quantified, and/or assessed, for example, to allow for the detection, identification, measurement, and/or quantification of the target antibody, for example in a composition or a sample. In certain embodiments, the methods include detecting whether a complex is formed between the anti-idiotype antibody and the target antibody in the sample, and/or detecting the presence or absence or level of such binding. In some embodiments, the complex contains a detectable label. In particular embodiments, the anti-idiotype antibody is an immunoconjugate that contains a detectable label. In certain embodiments, the anti-idiotype antibody contains, is conjugated with, bound to, and/or attached to the detectable label. In some embodiments, the complex contains an antibody that binds to and/or recognizes the anti-idiotype antibody, e.g., a secondary antibody, that in conjugated with, bound to, and/or attached to a detectable label.

    [0163] In some embodiments, methods for detecting, quantifying, detecting, and/or assessing a target antibody, for example in a sample or composition, includes detecting a complex of the target antibody and the anti-idiotype antibody. In some embodiments, the complex contains a detectable label. In certain embodiments, the complex is probed and/or contacted with a detectable label. In some embodiments, the complex is detected by any suitable method or means, such as but not limited to flow cytometry, immunocytochemistry, immunohistochemistry, western blot analysis, and ELISA.

    [0164] In some embodiments, the target antibody or antigen-binding fragment is bound to a cell or expressed on the surface of a cell. In particular embodiments, target antibody, e.g., the CAR is not bound or contained within a cell, for example, in some embodiments, the target antibody is secreted. In certain embodiments, the antibody has been detached, removed, and/or lysed from the surface of a cell.

    [0165] In some embodiments, the target antibody is an anti-CD70 antibody. In some embodiments, the target antibody is or is derived from antibody 4F11 or an antigen-binding fragment thereof. In some embodiments, the target antibody or antigen-binding fragment thereof comprises a heavy chain variable region set forth in SEQ ID NO: 15 and/or a light chain variable region set forth in SEQ ID NO: 16.

    [0166] In some embodiments, there is provided a method of detecting a target antibody, such as antibody 4F11, or an antigen-binding fragment thereof (and/or chimeric molecules comprising such antibody, e.g., antibody fragment, such as a CAR), comprising contacting a composition comprising the target antibody or antigen-binding fragment with an anti-idiotype antibody or antigen-binding fragment thereof or an anti-idiotype antibody immunoconjugate described herein, and detecting the anti-idiotype antibody bound to the target antibody or antigen-binding fragment. In some embodiments, the method further includes detecting whether a complex is formed between the anti-idiotype antibody and the target antibody in the composition, such as detecting the presence or absence or level of such binding. In some embodiments, the target antibody or antigen-binding fragment is bound to a cell or expressed on the surface of a cell and the detecting comprises detecting cells bound with the anti-idiotype antibody. In some embodiments, the anti-idiotype antibody or antigen-binding fragment thereof is directly or indirectly labeled for detection. In some embodiments, the target antibody or antigen-binding fragment thereof comprises a heavy chain variable region set forth in SEQ ID NO: 15 and/or a light chain variable region set forth in SEQ ID NO: 16.

    [0167] In certain embodiments, the methods for detecting a target antibody with an anti-idiotype antibody described herein are used to assess the target antibody in a subject. For example, in some embodiments, provided herein are methods of use for the anti-idiotype antibody for assessing, measuring, and/or quantifying the in vivo pharmacokinetics, expansion, and/or persistence of a CAR expressing cells of a therapeutic cell composition. In some embodiments, the in vivo pharmacokinetics, expansion, and/or persistence of the cells, and/or changes in cell phenotypes or functional activity of cells, such as CAR expressing cells administered for immunotherapy, e.g. CAR-T cell therapy, in the methods provided herein, can be measured with the anti-idiotype antibodies provided herein. In some embodiments, the pharmacokinetics, expansion, and/or persistence of the CAR expressing cells are measured, assessed by detecting the presence and/or amount of cells expressing the CAR in the subject and/or in sample obtained from the subject following the administration of the therapeutic cell composition during and/or after the administration of the therapy with an anti-idiotype antibody provided herein.

    [0168] In some aspects, the anti-idiotype antibody is used with flow cytometry to assess the quantity of cells expressing the recombinant receptor (e.g., CAR-expressing cells administered for T cell based therapy) in the blood or serum or organ or tissue sample (e.g., disease site, e.g., tumor sample) of the subject. In some aspects, persistence is quantified as the number of CAR-expressing cells per microliter of the sample, e.g., of blood or serum, or per total number of peripheral blood mononuclear cells (PBMCs) or white blood cells or T cells per microliter of the sample. In certain aspects, expansion is quantified as the increase in the number of CAR-expressing cells per microliter between samples, e.g., of blood or serum, or per total number of peripheral blood mononuclear cells (PBMCs) or white blood cells or T cells per microliter of the samples over time. In some embodiments, the pharmacokinetics, expansion, and/or persistence are measured or assessed by detecting the amount of CAR expressing cells in the subject and/or in samples collected from the subject at multiple time points.

    [0169] In some embodiments, there is provided a method of selecting cells expressing a CAR comprising a target antibody, such as antibody 4F11, or an antigen-binding fragment thereof, comprising contacting a population of cells comprising cells expressing the CAR with an anti-idiotype antibody or antigen-binding fragment thereof described herein, and selecting cells bound with the anti-idiotype antibody. In some embodiments, the cells bound with the anti-idiotype antibody are selected by affinity-based separation. In some embodiments, the affinity-based separation is selected from the group consisting of immunoaffinity-based separation, flow cytometry, magnetic-based separation, and affinity chromatography. In some embodiments, the anti-idiotype antibody or antigen-binding fragment thereof or anti-idiotype antibody immunoconjugate is reversibly bound or immobilized to a support or a stationary phase. In some embodiments, the target antibody or antigen-binding fragment thereof comprises a heavy chain variable region amino acid sequence set forth in SEQ ID NO: 15 and/or a light chain variable region amino acid sequence set forth in SEQ ID NO: 16 (e.g. comprises the amino acid sequence of SEQ ID NO: 35).

    [0170] In some embodiments, there is provided a method of validating a CAR comprising a target antibody, such as antibody 4F11, or an antigen-binding fragment thereof, comprising a) incubating a sample comprising T cells transduced with the CAR with an anti-idiotype antibody or antigen-binding fragment thereof targeting the CAR; b) determining the percent of cells bound with the anti-idiotype antibody or antigen-binding fragment thereof; and c) validating the CAR based on the percent of anti-idiotype antibody-bound T cells. In some embodiments, the anti-idiotype antibody is labeled, and anti-idiotype antibody-bound T cells are assayed by flow cytometry. In some embodiments, the target antibody or antigen-binding fragment thereof comprises a heavy chain variable region amino acid sequence set forth in SEQ ID NO: 15 and/or a light chain variable region amino acid sequence set forth in SEQ ID NO: 16 (e.g. comprises the amino acid sequence of SEQ ID NO: 35).

    [0171] Also provided are methods involving use of the provided anti-idiotype antibodies, and molecules (such as conjugates and complexes) containing one or more of such anti-idiotype antibodies, for informing treatment decisions in an individual, such as by the detection of CARs recognized by the anti-idiotype antibody, such as CARs comprising a target antibody, such as an anti-CD70 antibody (e.g., antibody 4F11), or an antigen-binding fragment thereof. In some embodiments, the methods are for informing treatment decisions in an individual in association with a therapy comprising administration of CAR T cells, such as anti-CD70 CAR T cells. The methods in some embodiments include incubating and/or probing a biological sample with the anti-idiotype antibody and/or administering the anti-idiotype antibody to the individual. In certain embodiments, a biological sample includes a cell or tissue or portion thereof, such as tumor or cancer tissue or biopsy or section thereof. In certain embodiments, the incubating is under conditions permissive for binding of the anti-idiotype antibody to CARs present in the sample. In some embodiments, the methods further include detecting whether a complex is formed between the anti-idiotype antibody and CARs in the sample, such as detecting the presence or absence or level of such binding. Such a method may be an in vitro or in vivo method.

    B. Use in Cell Stimulation

    [0172] In some embodiments, the provided anti-idiotype antibodies or antigen-binding fragments thereof are agonists and/or exhibit specific activity to stimulate cells expressing a target antibody including conjugates or chimeric receptors containing the same, such as an anti-CD70 antibody (e.g., antibody 4F11), or an antigen-binding fragment thereof. In some embodiments, provided are methods involving use of the provided anti-idiotype antibodies, and molecules (such as conjugates and complexes) containing one or more of such anti-idiotype antibodies, for stimulation or activation of CAR-expressing or other chimeric receptor-expressing cells, such as T cells. In some aspects, the CAR or other receptor comprises the target antibody, such as an anti-CD70 antibody (e.g., antibody 4F11), or an antigen-binding fragment thereof.

    [0173] In some embodiments, the methods can be used in connection with methods of preparing genetically engineered T cells, such as in methods of expanding genetically engineered T cells or other cells into which a nucleic acid molecule encoding the chimeric receptor such as the CAR comprising the target antibody has been introduced, e.g., by transfection, transduction, or a non-viral means of nucleic acid transfer, such as transposon-based approaches. In some aspects, the target antibody is an anti-CD70 antibody (e.g., antibody 4F11), or an antigen-binding fragment thereof. In particular embodiments, the target antibody is or contains a CAR, e.g., an anti-CD70 CAR. In particular embodiments, the anti-CD70 CAR contains an scFv that is from and/or is derived from an anti-CD70 antibody such as antibody 4F11.

    [0174] The methods in some embodiments include incubating a sample comprising T cells transduced with a CAR with the anti-idiotype antibody. In certain embodiments, the methods further include detecting whether the CAR T cells are activated or stimulated, such as by assessing the viability, proliferation, and/or expression of activation markers in the CAR T cells. In some embodiments, the target antibody is an anti-CD70 antibody. In some embodiments, the target antibody is or is derived from antibody 4F11 or an antigen-binding fragment thereof. In some embodiments, the target antibody or antigen-binding fragment thereof comprises a heavy chain variable region amino acid sequence set forth in SEQ ID NO: 15 and/or a light chain variable region amino acid sequence set forth in SEQ ID NO: 16 (e.g. comprises the amino acid sequence of SEQ ID NO: 35).

    [0175] In some embodiments, there is provided a method of simulating cells, comprising incubating an input composition comprising cells expressing a CAR comprising a target antibody, such as antibody 4F11, or an antigen-binding fragment thereof, with an anti-idiotype antibody or antigen-binding fragment thereof described herein, thereby generating an output composition comprising stimulated cells. In some embodiments, the incubation is performed under conditions in which the anti-idiotype antibody or antigen-binding fragment thereof binds to the CAR, thereby inducing or modulating a signal in one or more cells in the input composition. In some embodiments, the cells comprise T cells. In some embodiments, the T cells comprise CD4+ and/or CD8+ T cells.

    [0176] In certain embodiments, the anti-idiotype antibody is administered to a subject, such as a subject who has previously been administered a therapeutic cell composition containing CAR expressing cells. In some embodiments, administering the anti-idiotype antibody to a subject promotes re-expansion of the CAR expressing cells in the subject, which, in some cases, may reach or exceed the initial peak level of expansion prior to the administration of the anti-idiotype antibody. In some embodiments, the anti-idiotype antibody is administered to modulate expansion and/or persistence of the CAR expressing cells at times when the levels of the CAR expressing cells have declined or are not detectable. In some embodiments, CAR expressing cells that re re-expanded by the anti-idiotype antibody exhibit increased potency in a subject to which it is administered, for example, as compared to the potency prior to administration of the anti-idiotype antibody.

    [0177] In some embodiments, there is provided a method of producing a cell composition, comprising introducing into cells a nucleic acid molecule encoding a CAR, thereby generating an input composition, and incubating the input composition with an anti-idiotype antibody or antigen-binding fragment thereof specific for the antigen-binding domain of the CAR, thereby producing the cell composition. In some embodiments, the CAR comprises a target antibody or antigen-binding fragment thereof that specifically binds to CD70. In some embodiments, the target antibody is antibody 4F11 or an antigen-binding fragment thereof. In some embodiments, the anti-idiotype antibody or antigen-binding fragment thereof is an anti-idiotype antibody or antigen-binding fragment thereof described herein. In some embodiments, the anti-idiotype antibody or antigen-binding fragment thereof is an agonist of the CAR. In some embodiments, the introducing comprises introducing the nucleic acid molecule into the cells by viral transduction, transposition, electroporation, or chemical transfection. In some embodiments, the introducing comprises introducing the nucleic acid molecule in the cells by transduction with a retroviral vector comprising the nucleic acid molecule, by transduction with a lentiviral vector comprising the nucleic acid molecule, by transposition with a transposon comprising the nucleic acid molecule, or by electroporation or transfection of a vector comprising the nucleic acid molecule.

    C. Use in Cell Inactivation/Depletion

    [0178] In some embodiments, the provided anti-idiotype antibodies or antigen-binding fragments thereof are antagonists and/or exhibit specific activity to inhibit, ablate, and/or deplete (for example, kill via antibody-dependent cell-mediated cytotoxicity, ADCC) cells expressing a target antibody, such as an anti-CD70 antibody (e.g., antibody 4F11), or an antigen-binding fragment thereof. Also provided are methods involving use of the provided anti-idiotype antibodies, and molecules (such as conjugates and complexes) containing one or more of such anti-idiotype antibodies, for inactivation, ablation, and/or depletion of CAR T cells, wherein the CAR comprises a target antibody, such as an anti-CD70 antibody (e.g., antibody clone 4F11), or an antigen-binding fragment thereof.

    [0179] The methods in some embodiments include treating, contacting, and/or incubating a composition and/or a sample comprising T cells transduced with a CAR with the anti-idiotype antibody. In certain embodiments, the methods further include detecting whether the CAR T cells are inactivated, such as by assessing the viability, proliferation, and/or expression of activation markers in the CAR T cells. In some embodiments, the methods are in association with a therapy comprising administration of CAR T cells. The methods in some embodiments include administering the anti-idiotype antibody to an individual. In one embodiment, an anti-idiotype antibody or conjugate is used to ablate and/or deplete (such as kill) CAR T cells in an individual. In some embodiments, the target antibody is an anti-CD70 antibody. In some embodiments, the target antibody is or is derived from antibody 4F11 or an antigen-binding fragment thereof. In some embodiments, the target antibody or antigen-binding fragment thereof comprises a heavy chain variable region set amino acid sequence forth in SEQ ID NO: 15 and/or a light chain variable region amino acid sequence set forth in SEQ ID NO: 16 (e.g. comprises the amino acid sequence of SEQ ID NO: 35).

    [0180] In some embodiments, the anti-idiotype antibody is administered to deplete, reduce, and/or decrease the number of CAR expressing cells in a subject. In particular embodiments, administration of the anti-idiotype antibody depletes, reduces, and/or decreases the amount of CAR expressing cells, e.g., circulating CAR-T cells, by at least 25%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 99%, at least 99.9%, 100% or about 100%. In certain embodiments, the depletion, reduction, and/or decrease is in relation to an amount of CAR expressing cells in the subject prior to the administration of the anti-idiotype antibody. In particular embodiments, the depletion, reduction, and/or decrease is in relation to an amount of CAR expressing cells in a subject that is not administered the anti-idiotype antibody. In some embodiments, CAR expressing cells are not detectable in the subject following administration of the anti-idiotype antibody. In particular embodiments, the anti-idiotype antibody is a human or humanized antibody.

    [0181] In some embodiments, there is provided a method of inactivating CAR T cells, wherein the CAR comprises a target antibody, such as antibody 4F11, or an antigen-binding fragment thereof, comprising incubating a sample comprising the CAR T cells with an antagonistic anti-idiotype antibody or antigen-binding fragment thereof targeting the CAR, thereby inactivating the CAR T cells in the sample. In some embodiments, the anti-idiotype antibody is used in an amount sufficient to attenuate the activation of the CAR T cells in the sample. In some embodiments, the anti-idiotype antibody is used in an amount sufficient to substantially inactivate the CAR T cells in the sample. In some embodiments, incubation with the anti-idiotype antibody results in ablation and/or depletion of CAR T cells in the sample. In some embodiments, the anti-idiotype antibody is used in an amount sufficient to result in clearance of the CAR T cells in the sample. In some embodiments, the target antibody or antigen-binding fragment thereof comprises a heavy chain variable region amino acid sequence set forth in SEQ ID NO: 15 and/or a light chain variable region set forth amino acid sequence in SEQ ID NO: 16 (e.g. comprises the amino acid sequence of SEQ ID NO: 35).

    [0182] In some embodiments, there is provided a method of adjusting a CAR T cell therapy in an individual, wherein the CAR comprises a target antibody, such as antibody 4F11, or an antigen-binding fragment thereof, comprising administering an anti-idiotype antibody immunoconjugate targeting the CAR to the individual, wherein the anti-idiotype antibody immunoconjugate comprises a cytotoxic agent. In some embodiments, the anti-idiotype antibody immunoconjugate is administered in an amount sufficient to attenuate the CAR T cell therapy in the individual. In some embodiments, the anti-idiotype antibody immunoconjugate is administered in an amount sufficient to substantially stop the CAR T cell therapy in the individual. In some embodiments, the anti-idiotype antibody immunoconjugate is administered in an amount sufficient to result in clearance of the CAR T cells in the individual. In some embodiments, the cytotoxic agent is selected from the group consisting of chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), and radioactive isotopes. In some embodiments, the target antibody or antigen-binding fragment thereof comprises a heavy chain variable region amino acid sequence set forth in SEQ ID NO: 15 and/or a light chain variable region amino acid sequence set forth in SEQ ID NO: 16.

    D. Use in Binding Assay or Method

    [0183] Provided herein are methods for assessing the presence or absence of a molecule in a sample that binds to a chimeric antigen receptor (CAR), such as the extracellular domain of a CAR or to a portion thereof containing the antigen-binding domain. In some embodiments, the methods can be used to assess the presence or absence of a humoral response or antibody response in a subject to an administered cell therapy comprising a chimeric antigen receptor (CAR). In some embodiments, the chimeric antigen receptor comprises a target antibody that is antibody 4F11 or an antigen-binding fragment thereof. In some embodiments, the chimeric antigen receptor comprises a target antibody that is antibody 4F11 or an antigen-binding fragment thereof. In some embodiments, an anti-idiotype antibody or antigen-binding fragment thereof specific to the extracellular domain of the CAR, such as any described herein, can be used as a positive control in the method.

    [0184] Any anti-idiotype antibody that specifically binds a polypeptide comprising an anti-CD70 antibody 4F11, or anti-CD70 CAR (e.g., a CAR comprising a 4F11-derived scFv), or a fragment thereof can be employed, such as those disclosed herein, e.g., those having one or more of the VH and VL sequences described in Tables 1a and 1b and/or one or more CDRs described in Tables 1c and 1d. In some embodiments, the binding of the anti-CD70 antibody to the target antigen CD70 does not interfere with the binding of the anti-idiotype antibody to the anti-CD70 antibody, i.e., non-blocking. In some embodiments, the binding of the anti-idiotype antibody to the anti-CD70 antibody does not interfere with the binding of the anti-CD70 antibody to the target antigen CD70. In some embodiments, the anti-idiotype antibody is a non-blocking anti-idiotype antibody. In some embodiments, the binding of a non-blocking anti-idiotype antibody can more accurately detect the presence, or quantify the amount or number, of the anti-CD70 antibody, either alone or as part of a CAR, in the presence of the target antigen CD70.

    [0185] In some embodiments, the binding of the anti-idiotype antibody interferes with the binding of the anti-CD70 antibody to the target antigen CD70 or the binding of anti-CD70 antibody to the target antigen CD70 interferes with the binding of the anti-idiotype antibody to the anti-CD70 antibody, i.e., blocking. In some embodiments, the anti-idiotype antibody is a blocking anti-idiotype antibody. In some embodiments, the binding of a blocking anti-idiotype antibody can be used to deduce or determine the level of engagement or occupancy of the target antibody, e.g., the anti-CD70 antibody either alone or as part of a CD70-specific CAR, with the target antigen, e.g., CD70.

    [0186] In some embodiments, there are provided methods that involve contacting or incubating a binding reagent with a sample from a subject having been administered a cell therapy comprising cell engineered with a chimeric antigen receptor in which the binding reagent is a protein that includes the extracellular domain of the CAR or a portion thereof containing the target antibody or the antigen-binding fragment thereof. In some embodiments, the methods further include detecting whether a complex is formed between the binding reagent and a molecule, e.g. binding molecule, such as an antibody, present in the sample, and/or detecting the presence or absence or level of such binding. In certain embodiments, the contacting or incubating is under conditions permissive for binding of the binding reagent to a molecule present in the sample from the subject. In certain aspects, the method can be further carried out on a positive control sample containing an anti-idiotypic antibody or antigen-binding fragment thereof specific for the CAR, such as any as described. In some embodiments, determining the presence, absence or level of binding of the molecule to the binding reagent can include comparison of the binding or detection to the binding or detection of the positive control sample to the binding reagent.

    [0187] In some embodiments, the methods include detecting whether a complex is formed between the binding reagent and a molecule, e.g. binding molecule, such as an antibody, present in the sample, and/or detecting the presence or absence or level of such binding. In certain embodiments, the contacting or incubating is under conditions permissive for binding of the binding reagent to a molecule present in the sample from the subject. In some aspects, the complex is detected by an immunoassay, optionally a sandwich or bridge assay. For examples, the immunoassay is an enzyme-linked immunosorbent assay (ELISA), chemiluminescent, electrochemiluminescent, surface plasmon resonance (SPR)-based biosensor (e.g., BIAcore), flow cytometry, or Western blot. In some embodiments, the immunoassay is or includes meso scale discovery.

    [0188] In some aspects, the immunoassay is a sandwich assay or a bridge assay. In a sandwich or bridge assay, the binding reagent is a first binding reagent and detecting the presence or absence of a molecule or a complex comprising a molecule includes contacting the complex formed between the first binding reagent and molecule with a second binding reagent in which the second binding reagent is an agent that is able to bind to the same or similar molecule as the first binding reagent. In some embodiments, the second binding reagent comprises the extracellular domain of the CAR or a portion thereof. In some aspects, the extracellular domain of the CAR or portion thereof of the first binding agent and the second binding agent is the same or substantially the same.

    EXAMPLES

    Example 1: Generation of Anti-Idiotypic Antibodies to Anti-Human CD70 scFv Clone 4F11

    [0189] Balb/c mice were immunized with an anti-CD70 scFv 4F11 clone human IgG2 Fc fusion protein. The 4F11 scFv was used to generate an anti-CD70 chimeric antigen receptor (CAR) that comprises in addition to the 4F11 scFv, a CD8a hinge/transmembrane domain, a CD3z activating domain and a 4-1BB costimulatory domain.

    [0190] The 4F11 scFv amino acid sequence is shown in SEQ ID NO: 35. Hybridomas were generated, cloned, and the secreted antibodies were screened for binding specificity to 4F11. Antibody clones were identified and selected based on their ability to specifically bind the 4F11-derived scFv by testing mice serum by ELISA against the immunogen.

    [0191] Mice with positive serum were selected for making hybridoma fusions. The supernatants of the hybridoma cultures were screened by ELISA with the 4F11 scFv 10?His antigen (10?His disclosed as SEQ ID NO: 40) to identify positive hybridoma clones. The supernatants for these clones were then screened by flow cytometry to confirm binding specificity to the anti-CD70 CAR. Positive clones were then subcloned to ensure clonality. The subclones were screened and the binding specificity was confirmed by flow cytometry.

    [0192] Whether the anti-id antibody can bind to its target antibody in the presence of the target antigen was determined by antigen blocking analysis. Blocking of positive clones binding to the antibody in the presence of the CD70 protein was performed by flow cytometry, and the blocking results of lead clones confirmed by surface plasmon resonance.

    [0193] The full-length or variable region sequences of the lead and backup anti-idiotype clones were determined.

    [0194] Recombinant antibodies were generated and the binding of recombinantly generated antibodies to the antigen was indistinguishable from the antibodies purified from hybridoma.

    [0195] Anti-id antibody clones IDA2002-1.60 (clone 60), IDA2002-1.37 (clone 37) were further analyzed and characterized as described herein.

    Example 2: Flow Cytometry Determination of Specificity

    [0196] We next confirmed binding and determined the optimal titer of 2 phycoerythrin (PE)-conjugated anti-idiotype antibodies (anti-idiotype antibody Clone 37 (also referred to herein as IDA2002-1.37 or clone 1.37) and anti-idiotype antibody Clone 60 (also referred to herein as IDA2002-1.60 or clone 1.60)) to 4F11 scFv. Titrations were performed on clones 60 and 37 and the binding to the target CD70 CAR was evaluated using flow cytometry. CD70-specific (4F11-QR3) CAR T cells and non-transduced T cells (NTD) were generated from PBMC starting material. Cells were thawed, rested for 24 hours, counted and 1?10.sup.5 (1?10{circumflex over ()}5) cells were stained with each pool or fraction starting at 30ug (micrograms)/mL of anti-idiotype antibody for a 5-point half-log titration curve. Cells were stained at 4? C. for 20 minutes, washed with flow cytometry buffer (PBS+2% FBS+2 mM EDTA), and resuspended in buffer prior to analysis on the Cytoflex flow cytometer. FIG. 1A, first and second rows show results for clone 1.37. FIG. 1A, third and fourth rows show results for clone 1.60.

    [0197] To determine specificity of PE-conjugated anti-idiotype clone (Clone 60-PE) to 4F11 scFv, several control CAR T cells, including anti-CD19 CAR T cells, anti-BCMA CAR T cells, and anti-FLT3 CAR T cells. CD70 (4F11-QR3) CAR T cells (Donor A) were included as a positive control and NTD cells (Donor A) were stained as a negative control. Cells were thawed, rested for 48 hours, counted and 1?10.sup.5 cells were stained with Clone 60-PE antibody at 3ug/mL. Cells were also stained with rituximab (RTX) antibody at 10 ug/mL as a control since all CAR T cells contain rituximab mimetope-based off-switch. Cells were stained at 4? C. for 20 minutes, washed with flow cytometry buffer, and resuspended in buffer prior to analysis on the Cytoflex flow cytometer. FIG. 1B shows results of staining for anti-CD19 CAR, anti-BCMA CAR, anti-FLT3 CAR, anti-CD70 CAR, and NTD.

    Example 3: Flow Cytometry Comparison of Recombinant Protein

    [0198] Purified PE-conjugated anti-idiotype Clone 60 from Biolegend was compared using flow cytometry to newly purified antibody generated either recombinantly or purified from hybridoma. CD70 (4F11-QR3) CAR T cells and NTD cells were generated from pan T cell starting material (Donor D). Cells were stained with 0.3ug/mL of PE-conjugated or not conjugated recombinant or hybridoma versions of Clone 60. Cells were stained at 4? C. for 20 minutes, washed with flow cytometry buffer, and resuspended in buffer prior to analysis on the Cytoflex flow cytometer. Results are shown in FIG. 2A (SSC-A: side scatter-A).

    [0199] Separately, cells were stained with 0.3ug/mL of unconjugated recombinant or hybridoma versions of Clone 60. Cells were stained with primary antibody at 4? C. for 20 minutes, washed with flow cytometry buffer, stained with secondary anti-mouse Fc-specific antibody (Jackson, Cat #115-116-071) at 1:100 dilution at 4? C. for 15 minutes, washed with flow cytometry buffer, and resuspended in buffer prior to analysis on the Cytoflex flow cytometer. Results are shown in FIG. 2B. FIG. 2A shows the results of staining with PE-conjugated antibody. FIG. 2B shows the results of staining with unconjugated antibody. The results show that PE-conjugation did not affect antigen binding.

    Example 4: Flow Cytometry Demonstration of Effects on Binding in the Presence of the Target Antigen CD70

    [0200] To determine whether anti-idiotype clones can bind to 4F11 scFv in the presence of target antigen CD70, CD70-specific CAR Jurkat cells were incubated and blocked with recombinant human CD70 (rCD70 or hCD70) prior to staining with the anti-idiotype by flow cytometry. CD70 (4F11-QR3) CAR Jurkat cells and NTD cells were generated by transducing Jurkat cells with LVV comprising the 4F11-QR3 CAR. Cells were thawed, counted, and 1?10.sup.5 cells were incubated with hCD70 (Abcam Cat #ab 119815) at 100ug/mL for 30 minutes. Cells were then stained with various polyclonal supernatants from the hybridoma cultures at a 1:10 dilution for 20 minutes and washed with flow cytometry buffer. The cells were stained with secondary anti-mouse Fc-specific antibody (Jackson, Cat #115-116-071) at 1:100 dilution at 4? C. for 15 minutes, washed with flow cytometry buffer, and resuspended in buffer prior to analysis on the Cytoflex flow cytometer. Cells were also stained with PE-conjugated rituximab (RTX) antibody at 10 ug/mL as a positive control (to show that the cells express the 4F11-QR3 CAR) and with only secondary antibody as a negative control. Results are shown in FIG. 3, top row (NTD control not shown).

    [0201] Cells without treatment with hCD70 were stained as positive control (see FIG. 3, bottom row). The results show that when the 4F11 scFv formed a complex with its target antigen CD70, the binding of clone 37 anti-idiotype antibody to the 4F11 scFv was blocked, whereas 4F11 scFv-CD70 binding did not block binding by the clone 60 anti-idiotype antibody to 4F11 scFv.

    [0202] To confirm, the experiment was repeated using purified PE-conjugated clone (Clone 60) which was determined to be a non-blocker of CAR-CD70 interaction. Cells (4F11-QR3 CAR and non-transduced (NTD) cells) were thawed, rested for 48 hours, counted and 1?10.sup.5 cells were incubated with hCD70 at 100ug/mL for 30 minutes. Cells were then stained with Clone 60-PE antibody at 1.5ug/mL (FIG. 4A) or rituximab (RTX) antibody at 5 ug/mL (FIG. 4B) at 4? C. for 20 minutes, washed with flow cytometry buffer, and resuspended in buffer prior to analysis on the Cytoflex flow cytometer. Cells without treatment with hCD70 were stained as positive control. The results confirm that clone 60 anti-idiotype antibody binding to 4F11 scFv was not blocked by scFv binding to CD70. Thus, clone 60 is a non-blocking anti-idiotype antibody.

    Example 5: Surface Plasmon Resonance (SPR) Determination of Affinity for Clone 60

    [0203] All SPR analysis was determined on a BIACore T200 SPR instrument (Cytiva, Marlborough, MA). For kinetic analysis and determination of simultaneous target antigen binding of CD70 anti-idiotype antibodies, mouse Fc was captured on a Biacore Series S CM4 sensor chip by amine-coupling of an anti-mouse Fc reagent (Mouse Antibody Capture Kit, Cytiva, BR100838) to the Biacore Series S CM4 sensor chip using a running buffer of 10 mM HEPES, 150 mM NaCl, 0.05% (v/v) Tween-20, pH 7.4 at 25? C. All surfaces of the sensor chip were activated with a 1:1 (v/v) mixture of 400 mM 1-Ethyl-3-(3-Dimethylaminopropyl) carbodiimide hydrochloride (EDC) and 100 mM N-hydroxysuccinimide (NHS) for 7 min at 10 ?L/min. The anti-mouse Fc reagent was diluted to 30 ?g/mL in 10 mM sodium acetate (pH 5.0) and injected on all four flow cells for 7 min at 10 ?L/min, then all flow cells were blocked with 100 mM ethylenediamine in 200 mM Borate buffer pH 8.5 for 7 min at 10 ?L/mL.

    [0204] All interaction experiments were performed at 37? C. using the same running buffer as described above supplemented with 1 mg/mL BSA. Binding affinities of the CD70 anti-idiotype antibodies were determined by first capturing 5 ?g/mL of CD70 anti-idiotype antibodies on the anti-mouse Fc chip surface, then buffer and the 4F11 scFv 10?His (10?His disclosed as SEQ ID NO: 40) at concentrations of 1.2, 3.7, 11.1, 33.3, or 100 nM were injected for 2 min at 30 ?L/min. The dissociation was monitored for 10 min followed by regeneration of all flow cells with 10 mM glycine at pH 1.7 for 3 min. Results are shown in FIG. 5 and the data are reproduced in Table 3, below. Table 3.

    TABLE-US-00015 TABLE 3 Binds to t.sub.1/2 K.sub.D R.sub.max-expt R.sub.max-theo. % 4F11 Ligand R.sub.Ligand k.sub.a (1/Ms) k.sub.d (1/s) (min) (nM) (RU) (RU) activity (Y/N) Recombinant 263 2.71E+06 3.59E?03 3.22 1.32 88 98 90 Y IDA2002- 1.60_0357-P Hybridoma 288 2.44E+06 3.48E?03 3.32 1.43 93 107 86 Y IDA2002- 1.60_0356-P Hybridoma 275 2.25E+06 3.43E?03 3.37 1.52 78 103 76 Y IDA2002- 1.60_0292-P IDA2002- 241 2.20E+06 3.12E?03 3.70 1.42 79 90 87 Y 1.60 mIgG Positive Control (+)

    Example 6: SPR Demonstration of Simultaneous Binding with Target Antigen CD70 for Clone

    [0205] To determine simultaneous binding of CD70 anti-idiotype antibodies with the CD70 target antigen using the pre-mix followed by secondary detection method, 0.5ug/ml of CD70 anti-idiotype antibodies were first captured on the anti-mouse Fc chip surface. A premix of 4F11 scFv 10?His (10?His disclosed as SEQ ID NO: 40) at 100 nM and the biotin-hCD70 complex at 100 nM, and Streptavidin (Thermo Fisher, Cat No. 21125) at 100 nM were sequentially injected for 2 min at 30 ?L/min using dual inject. Streptavidin was specific to the premixed Biotin-hCD70 target antigen and was used as a secondary detection reagent to detect whether the complex was formed between the premix and the captured CD70 anti-idiotype antibody. The dissociation was monitored for 3 min followed by regeneration of all flow cells with 10 mM glycine at pH 1.7 for 3 min. FIG. 6A illustrates the assay (left panel) and the results (right top and bottom panels for hybridoma purified and recombinantly produced anti-idiotype antibodies, respectively).

    [0206] To determine simultaneous binding of CD70 anti-idiotype antibodies with the CD70 target antigen using the classic sandwiching method, 0.5ug/ml of CD70 anti-idiotype antibodies were captured on the anti-mouse Fc chip surface. Buffer, 4F11 scFv 10?His (10?His disclosed as SEQ ID NO: 40) at 100 nM, and Biotin-hCD70 at 100 nM were sequentially injected for 2 min at 30 ?L/min using dual inject. The dissociation was monitored for 3 min followed by regeneration of all flow cells with 10 mM glycine at pH 1.7 for 3 min. FIG. 6B illustrates the assay (left panel) and the results (right top and bottom panels for hybridoma purified and recombinantly produced anti-idiotype antibodies, respectively). The results show that the anti-idiotype antibody clone 60 is capable of binding to the anti-CD70 antibody in the presence of the target antigen hCD70, either in the premix assay or the sandwiching assay.

    [0207] All data were fitted to a 1:1 Langmuir binding model with mass transport evaluated using Biacore T200 Evaluation Software (version 2.0). The data in FIGS. 6A-B demonstrate that the anti-idiotype antibody clone 60 can bind to the 4F11 scFv in the presence of the target antigen hCD70 protein, either by the premix assay or the classic sandwich assay.

    INCORPORATION BY REFERENCE

    [0208] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference. However, the citation of a reference herein should not be construed as an acknowledgement that such reference is prior art to the present disclosure. To the extent that any of the definitions or terms provided in the references incorporated by reference differ from the terms and discussion provided herein, the present terms and definitions control.

    [0209] The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the disclosure. The foregoing description and Examples that follow detail certain embodiments of the disclosure and describe the best mode contemplated by the inventors. It will be appreciated, however, that no matter how detailed the foregoing can appear in text, the disclosure can be practiced in many ways and the disclosure should be construed in accordance with the appended claims and any equivalents thereof.