T cell receptor-like antibodies specific for Foxp3-derived peptides
11505599 · 2022-11-22
Assignee
Inventors
Cpc classification
C07K16/468
CHEMISTRY; METALLURGY
C07K2317/32
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/732
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
A61P43/00
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
A61K47/6849
HUMAN NECESSITIES
A61K47/6843
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61P35/00
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
A61K47/68
HUMAN NECESSITIES
Abstract
The presently disclosed subject matter provides antigen-binding proteins (e.g., chimeric antigen receptors) and antibodies or antigen-binding portions thereof that bind to a Foxp3 peptide/MHC molecule complex. Such antibodies, fusion proteins and conjugates thereof are useful for inhibiting regulatory T cells and treating cancers.
Claims
1. A monoclonal antibody or an antigen-binding portion thereof, which binds to a Foxp3 peptide bound to a human major histocompatibility complex (MEW) molecule, wherein the antibody or antigen-binding portion thereof each comprises a heavy chain variable region that comprises a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 39, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 40, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 41; and a light chain variable region that comprises a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 42, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 43, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 44.
2. The antibody or antigen-binding portion thereof of claim 1, wherein the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 103, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 104.
3. The antibody or antigen-binding portion thereof of claim 1, wherein (a) the antibody comprises a human variable region framework region; (b) the antibody or antigen-binding portion thereof is a fully human antibody or an antigen-binding portion thereof; (c) the antigen-binding portion of the antibody is a Fab, a Fab′, a F(ab′).sub.2, a variable fragment (Fv), or a single chain variable fragment (scFv); (d) the antibody or antigen-binding portion thereof is of an IgG1, IgG2, IgG3, or IgG4 isotype; and/or (e) the antibody or antigen-binding portion thereof comprises one or more post-translational modifications.
4. An immunoconjugate comprising the antibody or antigen-binding portion thereof of claim 1 linked to a therapeutic agent.
5. A composition comprising the antibody or antigen-binding portion thereof of claim 1 and a pharmaceutically acceptable carrier.
6. A kit for inducing death of cancer cells, comprising the antibody or antigen-binding portion thereof of claim 1, wherein the cancer cells present the Foxp3 peptide bound to the MHC molecule.
7. The immunoconjugate of claim 4, wherein the therapeutic agent is a drug, a cytotoxin, or a radioactive isotope.
8. An immunoconjugate comprising the antibody or antigen-binding portion thereof of claim 2 linked to a therapeutic agent.
9. The immunoconjugate of claim 8, wherein the therapeutic agent is a drug, a cytotoxin, or a radioactive isotope.
10. A composition comprising the antibody or antigen-binding portion thereof of claim 2 and a pharmaceutically acceptable carrier.
11. A kit for inducing death of cancer cells, comprising the antibody or antigen-binding portion thereof of claim 2, wherein the cancer cells present the Foxp3 peptide bound to the MHC molecule.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
DETAILED DESCRIPTION
I. Definitions
(14) Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of ordinary skill in the art with a general definition of many of the terms used in the presently disclosed subject matter: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991); Molecular Cloning: a Laboratory Manual 3rd edition, J. F. Sambrook and D. W. Russell, ed. Cold Spring Harbor Laboratory Press 2001; Recombinant Antibodies for Immunotherapy, Melvyn Little, ed. Cambridge University Press 2009; “Oligonucleotide Synthesis” (M. J. Gait, ed., 1984); “Animal Cell Culture” (R. I. Freshney, ed., 1987); “Methods in Enzymology” (Academic Press, Inc.); “Current Protocols in Molecular Biology” (F. M. Ausubel et al., eds., 1987, and periodic updates); “PCR: The Polymerase Chain Reaction”, (Mullis et al., ed., 1994); “A Practical Guide to Molecular Cloning” (Perbal Bernard V., 1988); “Phage Display: A Laboratory Manual” (Barbas et al., 2001). The contents of these references and other references containing standard protocols, widely known to and relied upon by those of skill in the art, including manufacturers' instructions are hereby incorporated by reference as part of the presently disclosed subject matter. As used herein, the following terms have the meanings ascribed to them below, unless specified otherwise.
(15) The following abbreviations are used throughout the present application:
(16) Ab: Antibody
(17) ADCC: Antibody-dependent cellular cytotoxicity
(18) ALL: Acute lymphocytic leukemia
(19) AML: Acute myeloid leukemia
(20) APC: Antigen presenting cell
(21) 132M: Beta-2-microglobulin
(22) BITE: Bi-specific T cell engaging antibody
(23) CAR: Chimeric antigen receptor
(24) CDC: Complement dependent cytotoxicity
(25) CMC: Complement mediated cytotoxicity
(26) CDR: Complementarity determining region
(27) C.sub.L: Constant domain of the light chain
(28) CH.sub.1: 1.sup.st constant domain of the heavy chain
(29) CH.sub.1, 2, 3: 1.sup.st, 2.sup.nd and 3.sup.rd constant domains of the heavy chain
(30) CH.sub.2, 3: 2.sup.nd and 3.sup.rd constant domains of the heavy chain
(31) CHO: Chinese hamster ovary
(32) CTL: Cytotoxic T cell
(33) E:T Ratio: Effector:Target ratio
(34) Fab: Antibody binding fragment
(35) FACS: Flow assisted cytometric cell sorting
(36) FBS: Fetal bovine serum
(37) FR: Framework region
(38) HC: Heavy chain
(39) HLA: Human leukocyte antigen
(40) Ig: Immunoglobulin
(41) IRES: Internal ribosome entry site
(42) K.sub.D: Dissociation constant
(43) k.sub.off: Dissociation rate
(44) k.sub.on: Association rate
(45) MHC: Major histocompatibility complex
(46) MM: Multiple myeloma
(47) scFv: Single-chain variable fragment
(48) TCR: T cell receptor
(49) TIL: Tumor infiltration lymphocyte
(50) TLI: Foxp3-7 peptide (sequence TLIRWAILEA (SEQ ID NO: 8))
(51) V.sub.H: Variable heavy chain includes heavy chain hypervariable region and heavy chain variable framework region
(52) V.sub.L: Variable light chain includes light chain hypervariable region and light chain variable framework region
(53) Foxp3: Foxhead box P3
(54) As used herein, the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 3 or more than 3 standard deviations, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, e.g., up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, e.g., within 5-fold, or within 2-fold, of a value.
(55) As used herein, the term “cell population” refers to a group of at least two cells expressing similar or different phenotypes. In non-limiting examples, a cell population can include at least about 10, at least about 100, at least about 200, at least about 300, at least about 400, at least about 500, at least about 600, at least about 700, at least about 800, at least about 900, at least about 1000 cells expressing similar or different phenotypes.
(56) As used herein, the term “antigen-binding protein” refers to a protein or polypeptide that comprises an antigen-binding region or antigen-binding portion, that is, has a strong affinity to another molecule to which it binds. Antigen-binding proteins encompass antibodies, chimeric antigen receptors (CARs) and fusion proteins.
(57) The terms “antibody” and “antibodies” refer to antigen-binding proteins of the immune system. As used herein, the term “antibody” includes whole, full length antibodies having an antigen-binding region, and any fragment thereof in which the “antigen-binding portion” or “antigen-binding region” is retained, or single chains, for example, single chain variable fragment (scFv), thereof. The term “antibody” means not only intact antibody molecules, but also fragments of antibody molecules that retain immunogen-binding ability. Such fragments are also well known in the art and are regularly employed both in vitro and in vivo. Accordingly, as used herein, the term “antibody” means not only intact immunoglobulin molecules but also the well-known active fragments F(ab′).sub.2, and Fab. F(ab′).sub.2, and Fab fragments that lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983). In certain embodiments, an antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V.sub.H) and a heavy chain constant (C.sub.H) region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as V.sub.L) and a light chain constant C.sub.L region. The light chain constant region is comprised of one domain, C.sub.L. The V.sub.H and V.sub.L regions can be further sub-divided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L is composed of three CDRs and four FRs arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1 q) of the classical complement system.
(58) The term “antigen-binding portion”, “antigen-binding fragment”, or “antigen-binding region” of an antibody, as used herein, refers to that region or portion of an antibody that binds to the antigen and which confers antigen specificity to the antibody; fragments of antigen-binding proteins, for example, antibodies includes one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., an peptide/HLA complex). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of antigen-binding portions encompassed within the term “antibody fragments” of an antibody include a Fab fragment, a monovalent fragment consisting of the V.sub.L, V.sub.H, C.sub.L and CH1 domains; a F(ab).sub.2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the V.sub.H and CH1 domains; a Fv fragment consisting of the V.sub.L and V.sub.H domains of a single arm of an antibody; a dAb fragment (Ward et al., 1989 Nature 341:544-546), which consists of a V.sub.H domain; and an isolated complementarity determining region (CDR).
(59) Furthermore, although the two domains of the Fv fragment, V.sub.L and V.sub.H, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V.sub.L and V.sub.H regions pair to form monovalent molecules. These are known as single chain Fv (scFv); see e.g., Bird et al., 1988 Science 242:423-426; and Huston et al., 1988 Proc. Natl. Acad. Sci. 85:5879-5883. These antibody fragments are obtained using conventional techniques known to those of ordinary skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
(60) An “isolated antibody” or “isolated antigen-binding protein” is one which has been identified and separated and/or recovered from a component of its natural environment. “Synthetic antibodies” or “recombinant antibodies” are generally generated using recombinant technology or using peptide synthetic techniques known to those of skill in the art.
(61) As used herein, the term “single-chain variable fragment” or “scFv” is a fusion protein of the variable regions of the heavy (V.sub.H) and light chains (V.sub.L) of an immunoglobulin (e.g., mouse or human) covalently linked to form a V.sub.H::V.sub.L heterodimer. The heavy (V.sub.H) and light chains (V.sub.L) are either joined directly or joined by a peptide-encoding linker (e.g., 10, 15, 20, 25 amino acids), which connects the N-terminus of the V.sub.H with the C-terminus of the V.sub.L, or the C-terminus of the V.sub.H with the N-terminus of the V.sub.L. The linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility. Despite removal of the constant regions and the introduction of a linker, scFv proteins retain the specificity of the original immunoglobulin. Single chain Fv polypeptide antibodies can be expressed from a nucleic acid comprising V.sub.H- and V.sub.L-encoding sequences as described by Huston, et al. (Proc. Nat. Acad. Sci. USA, 85:5879-5883, 1988). See, also, U.S. Pat. Nos. 5,091,513, 5,132,405 and 4,956,778; and U.S. Patent Publication Nos. 20050196754 and 20050196754. Antagonistic scFvs having inhibitory activity have been described (see, e.g., Zhao et al., Hyrbidoma (Larchmt) 2008 27(6):455-51; Peter et al., J Cachexia Sarcopenia Muscle 2012 Aug. 12; Shieh et al., J Imuno12009 183(4):2277-85; Giomarelli et al., Thromb Haemost 2007 97(6):955-63; Fife eta., J Clin Invst 2006 116(8):2252-61; Brocks et al., Immunotechnology 1997 3(3):173-84; Moosmayer et al., Ther Immunol 1995 2(10:31-40). Agonistic scFvs having stimulatory activity have been described (see, e.g., Peter et al., J Bioi Chern 2003 25278(38):36740-7; Xie et al., Nat Biotech 1997 15(8):768-71; Ledbetter et al., Crit Rev Immunol 1997 17(5-6):427-55; Ho et al., BioChim Biophys Acta 2003 1638(3):257-66).
(62) As used herein, “F(ab)” refers to a fragment of an antibody structure that binds to an antigen but is monovalent and does not have a Fc portion, for example, an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g., a heavy (H) chain constant region; Fc region that does not bind to an antigen).
(63) As used herein, “F(ab′)2” refers to an antibody fragment generated by pepsin digestion of whole IgG antibodies, wherein this fragment has two antigen binding (ab′) (bivalent) regions, wherein each (ab′) region comprises two separate amino acid chains, a part of a H chain and a light (L) chain linked by an S—S bond for binding an antigen and where the remaining H chain portions are linked together. A “F(ab′)2” fragment can be split into two individual Fab′ fragments.
(64) As used herein, the term “vector” refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences into cells. Thus, the term includes cloning and expression vehicles, as well as viral vectors and plasmid vectors.
(65) As used herein, the term “expression vector” refers to a recombinant nucleic acid sequence, e.g., a recombinant DNA molecule, containing a desired coding sequence and appropriate nucleic acid sequences necessary for the expression of the operably linked coding sequence in a particular host organism. Nucleic acid sequences necessary for expression in prokaryotes usually include a promoter, an operator (optional), and a ribosome binding site, often along with other sequences. Eukaryotic cells are known to utilize promoters, enhancers, and termination and polyadenylation signals.
(66) As used herein, “CDRs” are defined as the complementarity determining region amino acid sequences of an antibody which are the hypervariable regions of immunoglobulin heavy and light chains. See, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 4th U. S. Department of Health and Human Services, National Institutes of Health (1987). Generally, antibodies comprise three heavy chain and three light chain CDRs or CDR regions in the variable region. CDRs provide the majority of contact residues for the binding of the antibody to the antigen or epitope. In certain embodiments, the CDRs regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
(67) As used herein, the term “affinity” is meant a measure of binding strength. Without being bound to theory, affinity depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, and on the distribution of charged and hydrophobic groups. Affinity also includes the term “avidity,” which refers to the strength of the antigen-antibody bond after formation of reversible complexes. Methods for calculating the affinity of an antibody for an antigen are known in the art, comprising use of binding experiments to calculate affinity. Antibody activity in functional assays (e.g., flow cytometry assay) is also reflective of antibody affinity. Antibodies and affinities can be phenotypically characterized and compared using functional assays (e.g., flow cytometry assay).
(68) Nucleic acid molecules useful in the presently disclosed subject matter include any nucleic acid molecule that encodes an antibody or an antigen-binding portion thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence. Polynucleotides having “substantial homology” or “substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule. Homology and the percent homology can be determined by standard software programs such as BLAST or FASTA. By “hybridize” is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency. (See, e.g., Wahl, G. M. and S. L. Berger (1987) Methods Enzymol. 152:399; Kimmel, A. R. (1987) Methods Enzymol. 152:507).
(69) For example, stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate. Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide. Stringent temperature conditions will ordinarily include temperatures of at least about 30° C., more preferably of at least about 37° C., and most preferably of at least about 42° C. Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art. Various levels of stringency are accomplished by combining these various conditions as needed. In a preferred: embodiment, hybridization will occur at 30° C. in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS. In a more preferred embodiment, hybridization will occur at 37° C. in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 μg/ml denatured salmon sperm DNA (ssDNA). In a most preferred embodiment, hybridization will occur at 42° C. in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 μg/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
(70) For most applications, washing steps that follow hybridization will also vary in stringency. Wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature. For example, stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate. Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C., more preferably of at least about 42° C., and even more preferably of at least about 68° C. In a preferred embodiment, wash steps will occur at 25° C. in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42° C. in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C. in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Rogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
(71) As used herein, the term “cross-compete” or “compete” refers to the situation where binding of a presently disclosed antibody or an antigen-binding portion thereof to a given antigen, e.g., a Foxp3 peptide or a Foxp3/HLA class I complex (e.g., a Foxp3/HLA-A complex, e.g., a Foxp3/HLA-A2 complex, e.g., a Foxp3/HLA-A*02:01 complex), decreases or reduces binding of a reference antibody or an antigen-binding portion thereof, e.g., that comprises the V.sub.H and V.sub.L CDR1, CDR2, and CDR3 sequences or V.sub.H and V.sub.L sequences of any of the presently disclosed antibodies or antigen-binding portions thereof to the same antigen. The term “cross-compete” or “compete” also refers to the situation where binding of a reference antibody or an antigen-binding portion thereof to a given antigen, e.g., a Foxp3 peptide or a Foxp3/HLA class I complex (e.g., a Foxp3/HLA-A complex, e.g., a Foxp3/HLA-A2 complex, e.g., a Foxp3/HLA-A*02:01 complex), decreases or reduces binding of a presently disclosed antibody or an antigen-binding portion thereof to the same antigen. The “cross-competing” or “competing” antibodies or antigen-binding portions thereof bind to the same or substantially the same epitope, an overlapping or substantially overlapping epitope, or an adjacent epitope on the antigen (e.g., a Foxp3 peptide or a Foxp3/HLA class I complex (e.g., a Foxp3/HLA-A complex, e.g., a Foxp3/HLA-A2 complex, e.g., a Foxp3/HLA-A*02:01 complex)) as the reference antibody or antigen-binding portion thereof.
(72) As used herein, an “effective amount” or “therapeutically effective amount” is an amount sufficient to affect a beneficial or desired clinical result upon treatment. An effective amount can be administered to a subject in one or more doses. In terms of treatment, an effective amount is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease, or otherwise reduce the pathological consequences of the disease. The effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art. Several factors are typically taken into account when determining an appropriate dosage to achieve an effective amount. These factors include age, sex and weight of the subject, the condition being treated, the severity of the condition and the form and effective concentration of the immunoresponsive cells administered.
(73) As used herein, the term “heterologous nucleic acid molecule or polypeptide” refers to a nucleic acid molecule (e.g., a cDNA, DNA or RNA molecule) or polypeptide that is not normally present in a cell or sample obtained from a cell. This nucleic acid may be from another organism, or it may be, for example, an mRNA molecule that is not normally expressed in a cell or sample.
(74) As used herein, the term “increase” refers to alter positively by at least about 5%, including, but not limited to, alter positively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
(75) As used herein, the term “reduce” refers to alter negatively by at least about 5% including, but not limited to, alter negatively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
(76) As used herein, the term “isolated,” “purified,” or “biologically pure” refers to material that is free to varying degrees from components which normally accompany it as found in its native state. “Isolate” denotes a degree of separation from original source or surroundings. “Purify” denotes a degree of separation that is higher than isolation. A “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or polypeptide of the presently disclosed subject matter is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography. The term “purified” can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
(77) As used herein, the term “specifically binds” or “specifically binds to” or “specifically target” is meant a polypeptide or fragment thereof (including an antibody or an antigen-binding portion thereof) that recognizes and binds a biological molecule of interest (e.g., a Foxp3/MHC complex, (e.g., a Foxp3/HLA complex, more specifically, a Foxp3/HLA class I complex, more specifically, a Foxp3/HLA-A complex, more specifically, a Foxp3/HLA-A2 complex, or more specifically, a Foxp3/HLA-A*02:01 complex), but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample. In certain embodiments, an antibody or an antigen-binding portion thereof that “specifically binds to a Foxp3/MHC complex” refers to an antibody or an antigen-binding portion thereof that binds to a Foxp3/MHC complex with a K.sub.D of 5×10.sup.−7 M or less, 1×10.sup.−7 M or less, 5×10.sup.−8 M or less, 1×10.sup.−8 M or less, 5×10.sup.−9 M or less, 1×10.sup.−9 M or less, 5×10.sup.−10 M or less, 1×10.sup.−10 M or less, 5×10.sup.−11M or less, or 1×10.sup.−11 M or less.
(78) As used herein, the term “treating” or “treatment” refers to clinical intervention in an attempt to alter the disease course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Therapeutic effects of treatment include, without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastases, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. By preventing progression of a disease or disorder, a treatment can prevent deterioration due to a disorder in an affected or diagnosed subject or a subject suspected of having the disorder, but also a treatment may prevent the onset of the disorder or a symptom of the disorder in a subject at risk for the disorder or suspected of having the disorder.
(79) As used herein, the term “subject” refers to any animal (e.g., a mammal), including, but not limited to, humans, and non-human animals (including, but not limited to, non-human primates, dogs, cats, rodents, horses, cows, pigs, mouses, rats, hamsters, rabbits, and the like (e.g., which is to be the recipient of a particular treatment, or from whom cells are harvested). In certain embodiments, the subject is a human.
II. Foxp3 and Treg Cells
(80) Foxp3 has been identified as a key player in Treg function, and is the most definitive marker of CD4.sup.+CD25.sup.+ Treg cells. Foxp3 is required for Treg cell lineage differentiation, maintenance and suppressive function. Apart from naturally occurring Treg cells that arise in the thymus, inducible Treg cells have been identified, with predominance in infection and cancer. Extrathymic generation of Treg cells requires Foxp3 induction by suboptimal antigen stimulation of CD4.sup.+ T cells in the presence of transforming growth factor (TGF)-β. Analysis of Foxp3 expression in tumor-infiltrating lymphocytes (TILs) has shown that the accumulation of Treg cells correlates with poor prognosis in many cancer types, including breast, lung, melanoma, ovarian and pancreatic cancers (1-4). Therapeutically targeting the Treg population promote antitumor immunity and tumor rejection in mouse models of various types of cancer (5, 6). It has also been shown in patients that depletion of Treg cells enhances vaccine-mediated anti-tumor immunity in pancreatic cancer and induces regression of melanoma metastasis (7-9). These studies demonstrate a prominent tumor-promoting role of Treg cells in cancer by suppression of immune response.
(81) In addition to the accumulation of Foxp3.sup.+ Treg cells in tumor infiltrating lymphocytes (TIL)s, local lymph nodes and the blood of cancer patients, which confers growth and metastatic advantage of cancer cells by inhibiting anti-tumor immunity, the expression of Foxp3 has also been shown in some cancer cells. Foxp3-expressing pancreatic carcinoma cells and cutaneous T cell lymphoma cells have been shown to suppress T cell proliferation (2, 11). Therefore, cancer cells may share suppressive effects with regulatory T (Treg) cells, and that mimicking Treg function may represent a new mechanism of immune evasion in cancer.
(82) Overall, Treg cells are considered the most powerful inhibitors of anti-tumor immunity and the greatest barrier to successful immunotherapy. A number of strategies for depletion or interference with Treg function have been attempted. These include: depletion of Treg by monoclonal antibodies (mAb) specific for CD25, glucorticoid-induced TNF-related protein (GITR) and ligand-directed toxins targeted to cell surface receptor CD25 (such as Dennileukin diftitox). However, both CD25 and GITR are expressed not only in Treg cells, but also in activated CD4 and CD8 effector T cells. In addition, disruption of tumor homing by Treg, and modulation of T cell plasticity have all been attempted. The problem with these strategies is a lack of specificity, resulting in depletion of the beneficial anti-tumor effector T cells.
(83) Hence there is a need for drugs that could selectively inhibit Treg cells. To the best knowledge of the inventors, no drugs could selectively inhibit Treg cells, no effective targets for Treg cells on the cell surface that could be or are currently being used to suppress Treg cells or to kill Treg cells, and no selective drugs that can deplete Treg cells.
(84) Foxp3 is an ideal target except that it is no druggable by small molecules and it is inside the cell so antibody therapy is not feasible. However, peptides from Foxp3 protein that are degraded and processed for cell surface presentation can serve as a target of a TCR mimic antibody. TCR-mimic antibodies specific for Foxp3-derived epitopes specifically and directly deplete Foxp3.sup.+ Treg cells and tumor cells. The depletion of Treg cells can greatly unleash anti-tumor immunity by removing immunosuppression caused by both Treg cells and tumor cells.
(85) Tregs can be identified using various surface cell markers, such as CD4 (cluster of differentiation 4) and CD25 (alpha chain of IL-2 receptor). Additionally, it is known that activated conventional T cells can transiently express Foxp3. The expression of CD127 can be used as a cell marker to distinguish activated conventional T cells from Tregs. CD127 is also known as the alpha chain of IL-7 receptor. It has been found that Tregs express low CD127, whereas activated T cells express high CD127.
(86) In certain embodiments, Tregs are identified by one or more of presence of CD4 (CD4.sup.+), low expression level of CD127 (CD127.sup.low), high expression level of CD25 (CD25.sup.high), and high expression level of Foxp3 (Foxp3.sup.high). In certain embodiments, Tregs are identified by the presence of CD4 and high expression level of CD25, e.g., CD4.sup.+CD25.sup.high T cells. In certain embodiments, Tregs are identified by the presence of CD4, and low expression level of CD127, e.g., CD4.sup.+CD127.sup.low T cells. In certain embodiments, Tregs are identified by the presence of CD4, high expression level of
(87) CD25 and low expression level of CD127, e.g., CD4.sup.+CD25.sup.highCD127.sup.low T cells.
(88) In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more Treg cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more T cell selected from the group consisting of CD4.sup.+ T cells, CD127.sup.low T cells, CD25.sup.high T cells, Foxp3.sup.high T cells, and combinations thereof. The combinations include all possible combinations including CD4.sup.+ T cells, CD127.sup.low T cells, CD25.sup.high T cells, and Foxp3.sup.high T cells: e.g., any two of CD4.sup.+ T cells, CD127.sup.low T cells, CD25.sup.high T cells, and Foxp3.sup.high T cells (e.g., CD4.sup.+CD127.sup.low T cells, CD4.sup.+CD25.sup.high T cells, CD4.sup.+ Foxp3.sup.high T cells, CD127.sup.low CD25.sup.high T cells, D127.sup.low Foxp3.sup.high T cells, or CD25.sup.high Foxp3.sup.high T cells), any three of CD4.sup.+ T cells, CD127.sup.low T cells, CD25.sup.high T cells, and Foxp3.sup.high T cells (e.g., CD4.sup.+CD127.sup.low CD25.sup.high T cells, CD4.sup.+CD127.sup.low Foxp3.sup.high T cells, CD4.sup.+CD25.sup.high Foxp3.sup.high T cells, or CD127.sup.low CD25.sup.high Foxp3.sup.high T cells), and all four of CD4.sup.+ T cells, CD127.sup.low T cells, CD25.sup.high T cells, and Foxp3.sup.high T cells (e.g., CD4.sup.+CD127.sup.low CD25.sup.high Foxp3.sup.high T cells).
(89) In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD127.sup.low T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more Foxp3.sup.high T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD25.sup.high T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD4.sup.+ T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD4.sup.+CD25.sup.high T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD4.sup.+CD127.sup.low T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD4.sup.+CD25.sup.highCD127.sup.low T cell.
III. Anti-Foxp3 Antibodies Targeting Foxp3/MHC Peptide Complex
(90) The presently disclosed subject matter employs an approach to obtaining therapeutic antibodies to any protein, including those proteins that are inaccessible because they are not expressed on the cell surface, e.g., Foxp3.
(91) In order to target antigens derived from intracellular or nuclear proteins, development of a therapeutic antibody an uncommon approach is required. This approach is to generate recombinant antibodies (Abs, e.g., monoclonal Abs (mAb)) that recognize the peptide/MHC complex expressed on the cell surface, with the same specificity as a T-cell receptor (TCR). Such Abs share functional homology with TCRs regarding target recognition, but confer higher affinity and capabilities of arming with potent cytotoxic agents that antibodies feature. Technically, TCR-like mAbs may be generated by conventional hybridoma techniques or by in vitro antibody library techniques known to those of skill in the art, to produce human, humanized or chimeric antibodies.
(92) Only 10% of a cell's proteins are destined for expression on the cell surface. Therefore, monoclonal antibodies do not exist for the vast majority of proteins. In contrast, nearly all proteins within the cell are processed and presented on the cell surface as peptides within the context of MHC molecules for recognition by T cell receptors. Traditionally, the MHC-peptide complex could only be recognized by a T-cell receptor (TCR), limiting the ability to detect an epitope of interest using T cell-based readout assays. Phage display methodology now has enabled the reliable generation of monoclonal antibodies to these unique epitopes, thus opening the door to a new universe of antigens that were previously inaccessible. The use of phage display libraries has made it possible to select large numbers of antibody repertoires for unique and rare antibodies against very defined epitopes (for more details on phage display (see McCafferty et al., Nature, 348: 552-554.). The rapid identification of human Fab or scFv fragments highly specific for tumor antigen-derived peptide-MHC complex molecules has thus become possible (Noy, Expert Rev Anticancer Ther 2005:5 (3): 523-536. Chames et al., Proc Natl Acad Sci USA 2000; 97: 7969-7974; Held et al., Eur J. Immunol. 2004: 34:2919-2929; Lev et al., Cancer Res 2002; 62: 3184-3194). Immuno-toxins, generated by fusing TCR-like Fab specific for melanoma Ag MART-1 26-35/A2 or gp100 280-288/A2 to a truncated form of Pseudomonas endotoxin, have been shown to inhibit human melanoma growth both in vitro and in vivo (Klechevsky et al., Cancer Res 2008; 68 (15): 6360-6367). The presently disclosed subject matter involves the development of a TCR-like, fully human Ab (e.g., mAb) that recognizes, for example, the Foxp3 peptide/HLA-A2 complex for cancer therapy. Therefore, the presently disclosed subject matter provides for methods and compositions to construct phage-antibody reagents that will recognize specific MHC/peptide complexes on the cell surface in order to vastly expand Treg specific targets. The presently disclosed subject matter provides for antibodies (e.g., monoclonal antibodies) to the neo-epitopes of peptide/MHC complexes derived from the prototypical intracellular Treg marker, Foxp3.
(93) In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a high binding affinity, for example with a K.sub.D of about 5×10.sup.−7 M or less, e.g., about 1×10.sup.−7 M or less, about 5×10.sup.−8 M or less, about 1×10.sup.−8 M or less, about 5×10.sup.−9M or less about 1×10.sup.−9M or less, about 5×10.sup.−10 M or less, about 1×10.sup.−10 M or less, about 5×10.sup.−11M or less, or about 1×10.sup.−11 M or less. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of from about 1×10.sup.−11 M to about 5×10.sup.−7 M, e.g., from about 1×10.sup.−11M to about 1×10.sup.−10 M, from about 1×10.sup.−11M to about 5×10.sup.−11 M, from about 5×10.sup.−11M to about 1×10.sup.−10 M, from about 1×10.sup.−10 M to about 1×10.sup.−9 M, from about 1×10.sup.−1° M to about 5×10.sup.−10 M, from about 5×10.sup.−10 M to about 1×10.sup.−9 M, from 1×10.sup.−9M to about 1×10.sup.−8 M, from 1×10.sup.−9 M to about 5×10.sup.−9 M, from 5×10.sup.−9M to about 1×10.sup.−8 M, from about 1×10.sup.−8M to about 1×10.sup.−7 M, from about 1×10.sup.−8M to about 5×10.sup.−8 M, or from about 5×10.sup.−8M to about 1×10.sup.−7 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of from about 1×10.sup.−7 M to about 2.5×10.sup.−7 M, e.g., from about 1×10.sup.−7M to about 1.5×10.sup.−7 M, from about 1.5×10.sup.−7M to about 2×10.sup.−7 M, or from about 2×10.sup.−7M to about 2.5×10.sup.−7 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 1.4×10.sup.−7 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 1.9×10.sup.−7 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 2.2×10.sup.−7 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of from about 3×10.sup.−7 M to about 7×10.sup.−8 M, e.g., from about 3×10.sup.−8 M to about 4×10.sup.−8 M, from about 4×10.sup.−8 M to about 5×10.sup.−8 M, from about 5×10.sup.−8 M to about 6×10.sup.−8 M, or from about 6×10.sup.−8 M to about 7×10.sup.−8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 3.3×10.sup.−8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 3.5×10.sup.−8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 4.8×10.sup.−8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 4.9×10.sup.−8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 5×10.sup.−8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 7×10.sup.−8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 7.2×10.sup.−8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of from about 1×10.sup.−10 M to about 5×10.sup.−10 M, e.g., from about 1×10.sup.−10 M to about 2×10.sup.−10 M, from about 2×10.sup.−10 M to about 3×10.sup.−10 M, from about 3×10.sup.−10 M to about 4×10.sup.−10 M or 4×10.sup.−10 M to about 5×10.sup.−10 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 2×10.sup.−10 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 5×10.sup.−10 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a K.sub.D of about 4.6×10.sup.−10 M.
(94) In the presently disclosed subject matter, antigen-binding proteins, including antibodies, having an antigen-binding region based on scFvs that are selected from human scFv phage display libraries using recombinant HLA-peptide complexes are described. These molecules demonstrated exquisite specificity, for example as shown with anti-Foxp3 antibodies that recognize only Foxp3/MHC complexes (e.g., Foxp3/HLA complexes, more specifically, Foxp3/HLA class I complexes, more specifically, Foxp3/HLA-A complexes, more specifically, Foxp3/HLA-A2 complexes, and more specifically, Foxp3/HLA-A*02:01 complexes). In addition, along with their inability to bind to MHC-complexes containing other peptides, the molecules are also unable to bind to the peptides themselves, further demonstrating their TCR-like specificity.
(95) Recombinant antibodies with TCR-like specificity represent a new and valuable tool for research and therapeutic applications in tumor immunology and immunotherapy. Foxp3 is a well-established and validated Treg marker.
(96) The presently disclosed antigen-binding portion can be a Fab, Fab′, F(ab′).sub.2, Fv or a single chain variable fragment (scFv). In certain non-limiting embodiments, the presently disclosed antigen-binding portion thereof is a scFv. In certain embodiments, the scFv is a human scFv. The scFvs of the presently disclosed subject matter selected by phage display are initially tested for their ability to bind to peptide presented on the surface of HLA-positive cells. After T2 cells are incubated in the presence of peptide, fluorescently labeled antibodies can be used to selectively recognize the antigen pulsed cells using flow cytometry.
(97) In certain embodiments, the presently disclosed subject matter provides for antibodies that have the scFv sequence fused to one or more constant domains of the heavy or light chain variable region of the antibodies to form an antibody with an Fc region of a human immunoglobulin to yield a bivalent protein, increasing the overall avidity and stability of the antibody. In addition, the Fc portion allows the direct conjugation of other molecules, including but not limited to fluorescent dyes, cytotoxins, radioisotopes, etc. to the antibody for example, for use in antigen quantitation studies, to immobilize the antibody for affinity measurements, for targeted delivery of a therapeutic agent, and/or to test for Fc-mediated cytotoxicity using immune effector cells and many other applications.
(98) The molecules of the presently disclosed subject matter are based on the identification and selection of scFv using phage display, the amino acid sequence of which confers the molecules' specificity for the MHC restricted peptide of interest and forms the basis of all antigen-binding proteins of the disclosure. The scFv, therefore, can be used to design a diverse array of “antibody” molecules, including, for example, full length antibodies, fragments thereof, such as Fab and F(ab′).sub.2, minibodies, fusion proteins, including scFv-Fc fusions, multivalent antibodies, that is, antibodies that have more than one specificity for the same antigen or different antigens, for example, bispecific T-cell engaging antibodies (BITE), tribodies, etc. (see Cuesta et al., Multivalent antibodies: when design surpasses evolution. Trends in Biotechnology 28:355-362 2010).
(99) In constructing a recombinant immunoglobulin, appropriate amino acid sequences for constant regions of various immunoglobulin isotypes and methods for the production of a wide array of antibodies are known to those of ordinary skill in the art.
(100) Phage display technology allows for the rapid selection and production of antigen-specific scFv and Fab fragments, which are useful in and of themselves, or which can be further developed to provide complete antibodies, antigen binding proteins or antigen binding fragments thereof. Complete Abs with Fc domains have a number of advantages over the scFv and Fab antibodies. First, only full length Abs exert immunological function such as CDC and ADCC mediated via Fc domain. Second, bivalent mAbs offer stronger antigen-binding affinity than monomeric Fab Abs. Third, plasma half-life and renal clearance will be different with the Fab and bivalent mAb. The particular features and advantages of each can be matched to the planned effector strategy. Fourth, bivalent mAb may be internalized at different rates than scFv and Fab, altering immune function or carrier function. Alpha emitters, for example, do not need to be internalized to kill the targets, but many drugs and toxins will benefit from internalization of the immune complex. In certain embodiments, therefore, once scFv clones specific for a Foxp3 peptide-HLA complex are obtained from phage display libraries, a full length IgG Ab (e.g., mAb) using the scFv fragments is produced.
(101) To produce recombinant human monoclonal IgG in HEK293 or Chinese hamster ovary (CHO) cell lines cells, a full length IgG mAb can be engineered based on a method known to those of skill in the art (Tomomatsu et al., Production of human monoclonal antibodies against FceRIa by a method combining in vitro immunization with phage display. Biosci Biotechnol Biochem 73(7): 1465-1469 2009). Briefly, antibody variable regions can be sub-cloned into mammalian expression vectors, with matching Lambda or Kappa light chain constant sequences and IgG1 subclass Fc (for example) (Lidija P, et al. An integrated vector system for the eukaryotic expression of antibodies or their fragments after selection from phage display libraries. Gene 1997; 187(1): 9-18; Lisa J H, et al. Crystallographic structure of an intact lgG1 monoclonal antibody. Journal of Molecular Biology 1998; 275 (5): 861-872). Kinetic binding analysis (Yasmina N A, et al. Probing the binding mechanism and affinity of tanezumab, a recombinant humanized anti-NGF monoclonal antibody, using a repertoire of biosensors. Protein Science 2008; 17(8): 1326-1335) can be used to confirm specific binding of full length IgG to a Foxp3/HLA class I complex with a K.sub.D in nanomolar range.
(102) In certain embodiments, the presently disclosed subject matter provides for an antigen-binding protein that is a full length antibody (anti-Foxp3 antibody), the heavy and light chains of an antibody of the presently disclosed subject matter may be full-length (e.g., an antibody including at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains). The antibody can be of an IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, or IgE isotype. In certain embodiments, an antigen binding portion is comprised in a fusion protein with one or more non-immunoglobulin component. In certain embodiments, the antibody is of an IgG1, IgG2, IgG3, or IgG4 isotype. In one non-limiting embodiment, the antibody is of an IgG1 isotype (e.g., a human IgG1 antibody). The choice of antibody type may depend on the immune effector function that the antibody is designed to elicit. The light chain constant region can be a kappa or lambda constant region, preferably is a kappa constant region.
(103) In certain embodiments, a presently disclosed antibody or other antigen-binding protein specifically binds to a Foxp3 peptide bound to an MHC molecule, e.g., a HLA molecule, more specifically, a HLA class I molecule, more specifically, a HLA-A molecule, more specifically, a HLA-A2, even more specifically, HLA-A*02:01. The Foxp3 peptide can include 6-20 amino acids, e.g., 8-12 amino acids, e.g., 8, 9, 10, 11, or 12 amino acids. In certain embodiments, the Foxp3 peptide is a 9-mer peptide. In certain embodiments, the Foxp3 peptide is a 10-mer peptide. The Foxp3 peptide can be one known in the art.
(104) In certain embodiments, the Foxp3 peptide is a portion of a Foxp3 protein. In certain embodiments, the Foxp3 peptide is a portion of a human Foxp3 protein. In certain embodiments, the human Foxp3 protein has an amino acid sequence set forth in SEQ ID NO: 1 (Genbank Accession No. ABQ15210.1), which is provided below.
(105) TABLE-US-00001 [SEQ ID NO: 1] 1 mpnprpgkps apslalgpsp gaspswraap kasdllgarg pggtfqgrdl rggahassss 61 lnpmppsqlq lptlplvmva psgarlgplp hlqallqdrp hfmhqlstvd ahartpvlqv 121 hplespamis ltppttatgv fslkarpglp pginvaslew vsrepallct fpnpsaprkd 181 stlsavpqss ypllangvck wpgcekvfee pedflkhcqa dhlldekgra qcllqremvq 241 sleqqlvlek eklsamqahl agkmaltkas svassdkgsc civaagsqgp vvpawsgpre 301 apdslfavrr hlwgshgnst fpeflhnmdy fkfhnmrppf tyatlirwai leapekqrtl 361 neiyhwftrm faffrnhpat wknairhnls lhkcfvrves ekgavwtvde lefrkkrsqr 421 psrcsnptpg p
(106) In certain embodiments, the Foxp3 peptide is selected from the group consisting of Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 (which is amino acid sequences 252-260 of SEQ ID NO:1) or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 (which is amino acid sequences 390-398 of SEQ ID NO:1) or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 (which is amino acid sequences 304-312 of SEQ ID NO:1) or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 (which is amino acid sequences 388-396 of SEQ ID NO:1) or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 (which is amino acid sequences 95-103 of SEQ ID NO:1) or a portion thereof, Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 (which is amino acid sequences 69-77 of SEQ ID NO:1) or a portion thereof, and Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 (which is amino acid sequences 344-353 of SEQ ID NO:1) or a portion thereof. The sequences of SEQ ID NOS: 2-8 are provided below.
(107) TABLE-US-00002 (SEQ ID NO: 2) KLSAMQAHL (SEQ ID NO: 3) SLHKCFVRV, (SEQ ID NO: 4) SLFAVRRHL (SEQ ID NO: 5) NLSLHKCFV (SEQ ID NO: 6) LLQDRPHFM (SEQ ID NO: 7) LQLPTLPLV (SEQ ID NO: 8) TLIRWAILEA
(108) In certain embodiments, the Foxp3 peptide is Foxp3-7. In certain embodiments, the Foxp3 peptide is Foxp3-2. In certain embodiments, the Foxp3 peptide is Foxp3-4. In certain embodiments, the antibody or other antigen-binding protein binds to the C-terminal of the Foxp3 peptide in the Foxp3/MHC complex. In certain embodiments, the antibody or other antigen-binding protein binds to the N-terminal of the Foxp3 peptide in the Foxp3/MHC complex. The epitope mapping data shown in Example 2 below demonstrate that the certain antibodies bind to the C terminal of the amino acid sequence in the MHC molecule.
(109) In certain embodiments, the antibody or other antigen-binding protein binds to Foxp3-7 in conjunction with HLA-A*02:01. Non-limiting examples of scFvs that bind to Foxp3-7 include EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, and EXT017-55.
(110) In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to at least one portion of Foxp3-1, Foxp3-2, Foxp3-3, Foxp3-4, Foxp3-5, Foxp3-6, or Foxp3-7. More specifically, in certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to at least one portion of Foxp3-7 (SEQ ID NO: 8).
(111) The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT017-17, EXT017-18, EXT017-20, EXT017-27, EXT017-28, EXT017-32, EXT017-53, and EXT017-54 are shown in Table 1 below. The CDR regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT017-17, EXT017-18, EXT017-20, EXT017-27, EXT017-28, EXT017-32, EXT017-53, and EXT017-54 are shown in Appendix A.
(112) TABLE-US-00003 TABLE 1 clones HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 EXT017- GDTFSRYA IIPIFGTP ARSIYRYSEY SSNIGAGYD GNS QSYDSSLSGYV 17 (SEQ ID NO: (SEQ ID NO: DH (SEQ ID (SEQ ID NO: 12) (SEQ ID (SEQ ID NO: 14) 9) 10) NO: 11) NO: 13) EXT017- GYTFSNYY INPSVGTT ARDWWGQM SSNIGSNT (SEQ SNN AAWDDSLNGQ 18 (SEQ ID NO: (SEQ ID NO: MYDG (SEQ ID NO: 18) (SEQ ID GV 15) 16) ID NO: 17) NO: 19) (SEQ ID NO: 20) EXT017- GGTFSSYA IIPIFGTA ARYSYKYGEL SSNIGAGYD GNS (SEQ QSYDSSLSGSV 20 (SEQ ID NO: (SEQ ID NO: DT (SEQ ID (SEQ ID NO: 24) ID NO: (SEQ ID NO: 26) 21) 22) NO: 23) 25) EXT017- GYTFTNYY IRPSGGIT ARSWDYFAS NIGSES (SEQ ID DDD QVWDRSSDHW 27 (SEQ ID NO: (SEQ ID NO: NDF (SEQ ID NO: 30) (SEQ ID F (SEQ ID NO: 27) 28) NO: 29) NO: 31) 32) EXT017- GGTFSTYA IIPIFGTA ARAEYVYGE SSNIGAGYD GNS (SEQ QSYDSSLSGYV 28 (SEQ ID NO: (SEQ ID NO: YDQ (SEQ ID (SEQ ID NO: 36) ID NO: (SEQ ID NO: 38) 33) 34) NO: 35) 37) EXT017- GFTFNNHA ISFDGDD K SRDPYHFASG NIGSKS (SEQ ID YDS (SEQ QVWDSSSDHY 32 (SEQ ID NO: (SEQ ID NO: SYSYFDY NO: 42) ID NO: V (SEQ ID NO: 39) 40) (SEQ ID NO: 43) 44) 41) EXT017- GYTFTNYY IRPSGGNT ARSWNSRDV SGSIASHY(SEQ ENN QSYDRSNHVV 53 (SEQ ID NO: (SEQ ID NO: DS (SEQ ID ID NO: 48) (SEQ ID (SEQ ID NO: 50 45) 46) NO: 47) NO: 49) EXT017- GGTFSSYA IIPIFGTA ARPSYYSIKS TSNIGKNG (SEQ NDH ATWDDTLDLPL 54 (SEQ ID NO: (SEQ ID NO: AWDH (SEQ ID NO: 54) (SEQ ID (SEQ ID NO: 56) 51) 52) ID NO: 53) NO: 55)
(113) The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-29, EXT017-30, EXT017-34, and EXT017-55 are shown in Appendix B. The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-29, EXT017-30, EXT017-34, and EXT017-55 are shown in Appendix C.
(114) In certain embodiments, the antibody or other antigen-binding protein binds to Foxp3-2 in conjunction with HLA-A*02:01. Non-limiting examples of scFvs that bind to Foxp3-2 include EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8. The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT019-6, EXT019-9, EXT019-12, EXT019-15, and EXT019-20 are shown in Table 2 below. The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT019-6, EXT019-9, EXT019-12, EXT019-15, and EXT019-20 are shown in Appendix D.
(115) TABLE-US-00004 TABLE 2 VL VH CDR1 VHCDR2 VH CDR3 VL CDR1 CDR2 VL CDR3 EXT019- GYNFASEW IYPAESEI (SEQ ARAWDANYIYMDI SSNIGAGYD GNN QSYDSSLSDVV 06 (SEQ ID NO: 57) ID NO: 58) (SEQ ID NO: 59) (SEQ ID NO: (SEQ ID (SEQ ID NO: 62) 60) NO: 61) EXT019- GFAFSGSS ITSKAYNYAT TQTGDSSAY (SEQ NIGSKS YDS QVWDSSSDHWV 09 (SEQ ID NO: 63) (SEQ ID NO: 64) ID NO: 65) (SEQ ID NO: (SEQ ID (SEQ ID NO: 68) 66) NO: 67) EXT019- GFTFSSYW IKQDGSEK (SEQ ARYGGGPYDS (SEQ NIGSKS YDS QVWDSSSDHRV 12 (SEQ ID NO: 69) ID NO: 70) ID NO: 71) (SEQ ID NO: (SEQ ID (SEQ ID NO: 74) 72) NO: 73) EXT019- GFSFSNYA ISGRGGSI (SEQ AKSSEDYYFYHMDA NIGSES YDS QVWDHINDHYV 15 (SEQ ID NO: 75) ID NO: 76) (SEQ ID NO: 77) (SEQ ID NO: (SEQ ID (SEQ ID NO: 80) 78) NO: 79) EXT019- SISSKSAAWN YRSKWYY (SEQ ARSTGTFDY (SEQ ID NIGSKS YDS QVWDSSSDRVV 20 (SEQ ID NO: 81) ID NO: 82) NO: 83) (SEQ ID NO: (SEQ ID (SEQ ID NO: 86) 84) NO: 85)
(116) The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT019-4, EXT019-13, and EXT019-8 are shown in Appendix E. The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT019-4, EXT019-13, and EXT019-8 are shown in Appendix D.
(117) In certain embodiments, the antibody or other antigen-binding protein binds to Foxp3-4 in conjunction with HLA-A*02:01. Non-limiting examples of scFvs that bind to Foxp3-4 include EXT018-5, EXT018-2, and EXT018-4. The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT018-5 are shown in Table 3 below. The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT018-5 shown in Appendix F.
(118) TABLE-US-00005 TABLE 3 clones HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 EXT018-5 GFTFSSYA ISYDGSNK ARDRHDYVMDV NIGSKT YDS (SEQ QVWDGSSDHVI (SEQ ID (SEQ ID (SEQ ID NO: 89) (SEQ ID ID NO: 91) (SEQ ID NO: 92) NO: 87) NO: 88) NO: 90)
(119) The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT018-2, and EXT018-4 are shown in Appendix G. The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT018-2, and EXT018-4 are shown in Appendix F.
(120) Given that each of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, and EXT017-55 can bind to Foxp3-7 in conjunction with HLA-A*02:01, the V.sub.H and V.sub.L sequences of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, and EXT017-55 can be “mixed and matched” to create other antibodies or other antigen-binding proteins that bind to Foxp3-7 in conjunction with HLA-A*02:01.
(121) Similarly, given that each of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8 can bind to Foxp3-2 in conjunction with HLA-A*02:01, the V.sub.H and V.sub.L sequences of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8 can be “mixed and matched” to create other antibodies or other antigen-binding proteins that bind to Foxp3-2 in conjunction with HLA-A*02:01.
(122) Similarly, given that each of EXT018-5, EXT018-2, and EXT018-4 can bind to Foxp3-4 in conjunction with HLA-A*02:01, the V.sub.H and V.sub.L sequences of EXT018-5, EXT018-2, and EXT018-4 can be “mixed and matched” to create other antibodies or other antigen-binding proteins that bind to Foxp3-4 in conjunction with HLA-A*02:01.
(123) Such “mixed and matched” antibodies can be tested using the binding assays known in the art, including for example, ELISAs, Western blots, RIAs, Biacore analysis. Preferably, when V.sub.H and V.sub.L chains are mixed and matched, a V.sub.H sequence from a particular V.sub.H/V.sub.L pairing is replaced with a structurally similar V.sub.H sequence. Likewise, a V.sub.L sequence from a particular V.sub.H/V.sub.L pairing is replaced with a structurally similar V.sub.L sequence.
(124) In certain embodiments, a presently disclosed antibody or other antigen-binding protein comprises: (a) the V.sub.H of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Appendices A and C, and/or (b) the V.sub.L of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Appendices A and C.
(125) In certain embodiments, the antibody or other antigen-binding protein comprises (a) a V.sub.H comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 93, 95, 97, 99, 101, 103, 105, and 107; and/or (b) a V.sub.L comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 94, 96, 98, 100, 102, 104, 106, and 108.
(126) Preferred heavy and light chain combinations include:
(127) (a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94;
(128) (b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(129) (c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(130) (d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100;
(131) (e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(132) (f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104; (g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106; or
(133) (h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108.
(134) In certain embodiments, a presently disclosed antibody or other antigen-binding protein comprises: (a) the V.sub.H of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8 as shown in Appendix D, and/or (b) the V.sub.L of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8, as shown in Appendix D.
(135) For example, the antibody or other antigen-binding protein comprises (a) a VH comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 109, 111, 113, 115, and 117; and/or (b) a V.sub.L comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 110, 112, 114, 116, and 118.
(136) Preferred heavy and light chain combinations include:
(137) (a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110;
(138) (b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112;
(139) (c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114;
(140) (d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116; or
(141) (e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118.
(142) In certain embodiments, a presently disclosed antibody or other antigen-binding protein comprises: (a) the V.sub.H of EXT018-5, EXT018-2, and EXT018-4 as shown in Appendix F, and/or (b) the V.sub.L of EXT018-5, EXT018-2, and EXT018-4, as shown in Appendicx F.
(143) For example, the antibody or other antigen-binding protein comprises (a) a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 119; and/or (b) a V.sub.L comprising the amino acid sequence set forth in SEQ ID NOS: 120.
(144) In certain embodiments, the presently disclosed antibody or other antigen-binding protein comprises the heavy chain and light chain CDR1s, CDR2s and CDR3s of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B.
(145) Given that each of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55 can bind to Foxp3-7 in conjunction with HLA-A*02:01 and that antigen-binding specificity is provided primarily by the CDR1, CDR2, and CDR3 regions, the V.sub.H CDR1, CDR2, and CDR3 sequences and V.sub.L CDR1, CDR2, and CDR3 sequences of each of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55 can be “mixed and matched” (i.e., CDRs from different antibodies can be mixed and match, although each antibody must contain a V.sub.H CDR1, CDR2, and CDR3 and a V L CDR1, CDR2, and CDR3) to create other antibodies or other antigen-binding proteins that bind to Foxp3-7 in conjunction with HLA-A*02:01.
(146) Similarly, given that each of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8 can bind to Foxp3-2 in conjunction with HLA-A*02:01 and that antigen-binding specificity is provided primarily by the CDR1, CDR2, and CDR3 regions, the V.sub.H CDR1, CDR2, and CDR3 sequences and V.sub.L CDR1, CDR2, and CDR3 sequences of each of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8 can be “mixed and matched” to create other antibodies or other antigen-binding proteins that bind to Foxp3-2 in conjunction with HLA-A*02:01. Such “mixed and matched” antibodies can be tested using the binding assays described above.
(147) Similarly, given that each of EXT018-5, EXT018-2, and EXT018-4 can bind to Foxp3-4 in conjunction with HLA-A*02:01 and that antigen-binding specificity is provided primarily by the CDR1, CDR2, and CDR3 regions, the V.sub.H CDR1, CDR2, and CDR3 sequences and V.sub.L CDR1, CDR2, and CDR3 sequences of each of EXT018-5, EXT018-2, and EXT018-4 can be “mixed and matched” to create other antibodies or other antigen-binding proteins that bind to Foxp3-4 in conjunction with HLA-A*02:01. Such “mixed and matched” antibodies can be tested using the binding assays described above.
(148) When V.sub.H CDR sequences are mixed and matched, the CDR1, CDR2 and/or CDR3 sequence from a particular V.sub.H sequence is replaced with a structurally similar CDR sequence(s). Likewise, when V.sub.L CDR sequences are mixed and matched, the CDR1, CDR2 and/or CDR3 sequence from a particular V.sub.L sequence preferably is replaced with a structurally similar CDR sequence(s). It will be readily apparent to the ordinarily skilled artisan that novel V.sub.H and V.sub.L sequences can be created by substituting one or more V.sub.H and/or V.sub.L CDR region sequences with structurally similar sequences from the CDR sequences of the antibodies or antigen-binding portions thereof disclosed herein.
(149) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises:
(150) (a) the V.sub.H CDR1 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B;
(151) (b) the V.sub.H CDR2 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B;
(152) (c) the V.sub.H CDR3 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B;
(153) (d) the V.sub.L CDR1 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B;
(154) (e) the V.sub.L CDR2 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B; and
(155) (f) the V.sub.L CDR3 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B.
(156) For example, a presently disclosed antibody, or antigen-binding portion thereof comprises:
(157) (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 15, 21, 27, 33, 39, 45, and 51;
(158) (b) a heavy chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52;
(159) (c) a heavy chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, and 53;
(160) (d) a light chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 18, 24, 30, 36, 40, 42, 48, and 54;
(161) (e) a light chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, and 55; and
(162) (f) a light chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, and 56.
(163) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT017-17”.
(164) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT017-18”.
(165) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT017-20”.
(166) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT017-27”.
(167) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT017-28”.
(168) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT017-32”.
(169) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT017-53”.
(170) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT017-54”.
(171) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises:
(172) (a) the V.sub.H CDR1 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E;
(173) (b) the V.sub.H CDR2 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E;
(174) (c) the V.sub.H CDR3 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E;
(175) (d) the V.sub.L CDR1 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E;
(176) (e) the V.sub.L CDR2 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E; and
(177) (f) the V.sub.L CDR3 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E.
(178) For example, a presently disclosed antibody, or antigen-binding portion thereof comprises:
(179) (a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 57, 63, 69, 75, and 81;
(180) (b) a heavy chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 58, 64, 70, 76, and 82;
(181) (c) a heavy chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 59, 65, 71, 77, and 83;
(182) (d) a light chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 60, 66, 72, 78, and 84;
(183) (e) a light chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 61, 67, 73, 79, and 85; and
(184) (f) a light chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 62, 68, 74, 80, and 86.
(185) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT019-6”.
(186) In certain embodiment, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT019-9”.
(187) In certain embodiment, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT019-12”.
(188) In certain embodiment, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT019-15”.
(189) In certain embodiment, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT019-20”.
(190) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises:
(191) (a) the V.sub.H CDR1 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G;
(192) (b) the V.sub.H CDR2 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G;
(193) (c) the V.sub.H CDR3 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G;
(194) (d) the V.sub.L CDR1 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G;
(195) (e) the V.sub.L CDR2 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G; and
(196) (f) the V.sub.L CDR3 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G.
(197) In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as “EXT018-5”.
(198) The constant region/framework region of the presently disclosed antibodies can be altered, for example, by amino acid substitution, to modify the properties of the antibody (e.g., to increase or decrease one or more of: antigen binding affinity, Fc receptor binding, antibody carbohydrate, for example, glycosylation, fucosylation, etc, the number of cysteine residues, effector cell function, effector cell function, complement function or introduction of a conjugation site).
(199) In certain embodiments, a presently disclosed antibody is a fully-human antibody. In certain embodiments, a presently disclosed antibody is a fully-human monoclonal antibody (mAb). Fully-human mAbs are preferred for therapeutic use in humans because murine antibodies cause an immunogenicity reaction, known as the HAMA (human anti-mouse antibodies) response (Azinovic I, et al. Survival benefit associated with human anti-mouse antibody (HAMA) in patients with B-cell malignancies. Cancer Immunol Immunother 2006; 55(12):1451-8; Tjandra J J, et al. Development of human anti-murine antibody (HAMA) response in patients. Immunol Cell Biol 1990; 68(6):367-76), when administered to humans, causing serious side effects, including anaphylaxis and hypersensitivity reactions. This immunogenicity reaction is triggered by the human immune system recognizing the murine antibodies as foreign because of slightly different amino acid sequences from natural human antibodies. Humanization methods known in the art (Riechmann L, et al. Reshaping human antibodies for therapy. Nature 1988; 332 (6162): 332:323; Queen C, et al. A humanized antibody that binds to the interleukin 2 receptor. Proc Natl Acad Sci USA 1989; 86 (24): 10029-33) can be employed to reduce the immunogenicity of murine-derived antibodies (Gerd R, et al. Serological Analysis of Human Anti-Human Antibody Responses in Colon Cancer Patients Treated with Repeated Doses of Humanized Monoclonal Antibody A33. Cancer Res 2001; 61, 6851-6859).
(200) The use of phage display libraries has made it possible to select large numbers of antibodies repertoires for unique and rare antibodies against very defined epitopes (for more details on phage display see McCafferty et al., Phage antibodies: filamentous phage displaying antibody variable domains. Nature, 348: 552-554.) The rapid identification of human Fab or scFvs highly specific for tumor antigen-derived peptide-MHC complex molecules has thus become possible. Immuno-toxins, generated by fusing TCR-like Fab specific for melanoma Ag MART-1 26-35/A2 or gp100 280-288/A2 to a truncated form of Pseudomonas endotoxin, have been shown to inhibit human melanoma growth both in vitro and in vivo (Klechevsky E, et al. Antitumor activity of immunotoxins with T-cell receptor-like specificity against human melanoma xenografts. Cancer Res 2008; 68 (15): 6360-6367). In addition, by engineering full-length monoclonal antibodies (mAbs) using the Fab fragments, it is possible to directly generate a therapeutic human mAbs, bypassing months of time-consuming work, normally needed for developing therapeutic mAbs, e.g., for treating cancers, or immune diseases.
(201) Homologous Antibodies
(202) In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof comprises heavy and light chain variable regions comprising amino acid sequences that are homologous to the amino acid sequences of the antibodies or antigen-binding portions thereof (e.g., scFvs) described herein (e.g., EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55, EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, or EXT018-4), and wherein the antibodies or antigen-binding portions thereof retain the desired functional properties of the anti-Foxp3 antibodies or antigen-binding portions thereof of the presently disclosed subject matter.
(203) For example, a presently disclosed antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous (e.g., at least about 81% homologous, at least about 82% homologous, at least about 83% homologous, at least about 84% homologous, at least about 85% homologous, at least about 86% homologous, at least about 87% homologous, at least about 88% homologous, at least about 89% homologous, at least about 90% homologous, at least about 91% homologous, at least about 92% homologous, at least about 93% homologous, at least about 94% homologous, at least about 95% homologous, at least about 96% homologous, at least about 97% homologous, at least about 98% homologous, at least about 99% homologous, or about 100% homologous) to the V.sub.H sequence of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55, EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, or EXT018-4 (as shown in Appendices A, C, D, and F), and a light chain variable region comprising an amino acid sequence that is at least 80% homologous (e.g., at least about 81% homologous, at least about 82% homologous, at least about 83% homologous, at least about 84% homologous, at least about 85% homologous, at least about 86% homologous, at least about 87% homologous, at least about 88% homologous, at least about 89% homologous, at least about 90% homologous, at least about 91% homologous, at least about 92% homologous, at least about 93% homologous, at least about 94% homologous, at least about 95% homologous, at least about 96% homologous, at least about 97% homologous, at least about 98% homologous, at least about 99% homologous, or about 100% homologous) to the V.sub.L sequence of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55, EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, or EXT018-4 (as shown in Appendices A, C, D, and F), and the antibody or antigen-binding portion thereof binds to a Foxp3 peptide in conjunction with HLA-A*02:01 with a K.sub.D of about 5×10.sup.−7M or less.
(204) For example, a presently disclosed antibody or antigen-binding portion thereof comprises:
(205) (a) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOs: 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, and 119;
(206) (b) a light chain variable region comprising an amino acid sequence that is at least about 80% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOs: 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, and 120; and
(207) wherein the antibody or antigen-binding portion thereof binds to a Foxp3 peptide in conjunction with HLA-A*02:01 with a K.sub.D of about 5×10.sup.−7 M or less.
(208) In certain embodiments, the V.sub.H and/or V.sub.L amino acid sequences can be about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% homologous to the sequences set forth above. An antibody having V.sub.H and V.sub.L regions having high (i.e., about 80% or greater) homology to the V.sub.H and V.sub.L regions of the sequences set forth above, can be obtained by mutagenesis (e.g., site-directed or PCR-mediated mutagenesis), followed by testing of the encoded altered antibody for retained function (i.e., the binding affinity) using the binding assays described herein.
(209) The comparison of sequences and determination of homology between two sequences can be accomplished using a mathematical algorithm and is standard in the art.
(210) As one non-limiting example, the percent homology between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4:11-17 (1988)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percent homology between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol. Biol. 48:444-453 (1970)) algorithm which has been incorporated into the GAP program in the GCG software package (available at gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
(211) Additionally or alternatively, the protein sequences of the presently disclosed subject matter can further be used as a “query sequence” to perform a search against public databases to, for example, identify related sequences. Such searches can be performed using the XBLAST program (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to the antibody molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res. 25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. (See ncbi.nlm.nih.gov).
(212) Antibodies with Modifications
(213) In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences based on the antibodies or antigen-binding portions thereof (e.g., scFvs) described herein (e.g., EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55, EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, or EXT018-4, as shown in Tables 1-3 and Appendices B, E and G), or modifications thereof, and wherein the antibodies or antigen-binding portions thereof retain the desired functional properties of the anti-Foxp3 antibodies or antigen-binding portions thereof of the presently disclosed subject matter.
(214) The presently disclosed subject matter provides an isolated antibody, or antigen-binding portion thereof, comprising a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences, wherein:
(215) (a) the heavy chain variable region CDR3 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, 53, 59, 65, 71, 77, 83, and 89, or a conservative modification thereof;
(216) (b) the light chain variable region CDR3 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, 56, 62, 68, 74, 80, 86, and 92, or a modification thereof, and the antibody or antigen-binding portion thereof specifically binds to a Foxp3 peptide bound to a MHC molecule.
(217) In certain embodiments, the heavy chain variable region CDR2 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, and 88, or a modification thereof; and the light chain variable region CDR2 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, 55, 61, 67, 73, 79, 85, and 91, or a modification thereof.
(218) In certain embodiments, the heavy chain variable region CDR1 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, and 87, and a modification thereof; and the light chain variable region CDR1 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 18, 24, 30, 36, 42, 48, 54, 60, 66, 72, 78, 84, and 90, or a modification thereof.
(219) In certain embodiments, the modification(s) do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Such modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into the presently antibody or antigen-binding portion by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis.
(220) The modifications can be conservative modifications, non-conservative modifications, or mixtures of conservative and non-conservative modifications. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. Exemplary conservative amino acid substitutions are shown in Table 4. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
(221) TABLE-US-00006 TABLE 4 Exemplary conservative amino Original Residue acid Substitutions Ala (A) Val; Leu; Ile Arg (R) Lys; Gln; Asn Asn (N) Gln; His; Asp, Lys; Arg Asp (D) Glu; Asn Cys (C) Ser; Ala Gln (Q) Asn; Glu Glu (E) Asp; Gln Gly (G) Ala His (H) Asn; Gln; Lys; Arg Ile (I) Leu; Val; Met; Ala; Phe Leu (L) Ile; Val; Met; Ala; Phe Lys (K) Arg; Gln; Asn Met (M) Leu; Phe; Ile Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Pro (P) Ala Ser (S) Thr Thr (T) Val; Ser Trp (W) Tyr; Phe Tyr (Y) Trp; Phe; Thr; Ser Val (V) Ile; Leu; Met; Phe; Ala
(222) Amino acids may be grouped according to common side-chain properties: hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; acidic: Asp, Glu; basic: His, Lys, Arg; residues that influence chain orientation: Gly, Pro; aromatic: Trp, Tyr, Phe.
(223) Thus, one or more amino acid residues within a CDR region can be replaced with other amino acid residues from the same group and the altered antibody can be tested for retained function using the functional assays described herein.
(224) Non-conservative substitutions entail exchanging a member of one of these classes for another class.
(225) In certain embodiments, no more than one, no more than two, no more than three, no more than four, no more than five residues within a specified sequence or a CDR region are altered.
(226) Cross-Competing Antibodies
(227) The presently disclosed subject matter provides antibodies or antigen-binding portions thereof that cross-compete for binding to a Foxp3 peptide/HLA complex (e.g., a Foxp3 peptide/HLA class I complex, a Foxp3 peptide/HLA-A2 complex, or a Foxp3 peptide/HLA-A*02:01 complex) with any of the anti-Foxp3 antibodies or antigen-binding portions thereof (e.g., scFvs) of the presently disclosed subject matter (e.g., EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55, EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, or EXT018-4), and specifically binds to a Foxp3 peptide with a binding affinity (K.sub.D) of about 5×10.sup.−7 M or less, e.g., about 1×10.sup.−7 M or less, about 5×10.sup.−8 M or less, about 1×10.sup.−8 M or less, about 5×10.sup.−9 M or less, about 1×10.sup.−9 M or less, about 5×10.sup.−10 M or less, about 1×10.sup.−10 M or less, about 5×10.sup.−11 M or less, or about 1×10.sup.−11M or less. The cross-competing antibodies or antigen-binding portions thereof bind to the same epitope region, e.g., same epitope, adjacent epitope, or overlapping as any of the anti-Foxp3 antibodies or antigen-binding portions thereof described herein. In certain embodiments, the cross-competing antibodies or antigen-binding portions thereof bind to the same epitope on the Foxp3 peptide as any of the anti-Foxp3 antibodies or antigen-binding portions thereof described herein.
(228) Such cross-competing antibodies can be identified based on their ability to cross-compete with any one of the presently disclosed anti-Foxp3 antibodies or antigen-binding portions thereof in standard Foxp3 binding assays. For example, Biacore analysis, ELISA assays or flow cytometry can be used to demonstrate cross-competition with the antibodies or antigen-binding portions thereof of the presently disclosed subject matter. The ability of a test antibody to inhibit the binding of, for example, any one of the presently disclosed anti-Foxp3 antibodies or antigen-binding portions thereof to a Foxp3 peptide/MHC (e.g., a Foxp3/HLA complex more specifically, a Foxp3/HLA class I complex, more specifically, a Foxp3/HLA-A2 complex, and more specifically, a Foxp3/HLA-A*02:01 complex) demonstrates that the test antibody can compete with any one of the presently disclosed anti-Foxp3 antibodies or antigen-binding portions thereof for binding to such Foxp3 peptide/MHC complex.
(229) Characterization of Antibody Binding to Antigen
(230) Antibodies of the presently disclosed subject can be tested for binding to a Foxp3 peptide/HLA complex by, for example, standard ELISA. To determine the isotype of purified antibodies, isotype ELISAs can be performed using reagents specific for antibodies of a particular isotype. Anti-Foxp3 human IgGs can be further tested for reactivity with the Foxp3 peptide/MHC complex by Western blotting.
(231) In certain embodiments, K.sub.D is measured by a radiolabeled antigen binding assay (RIA). In certain embodiments, an RIA is performed with the Fab version of an antibody of interest and its antigen. For example, solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of (.sup.125I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al., J. Mol. Biol. 293:865-881(1999)).
(232) In certain embodiments, K.sub.D is measured using a BIACORE® surface plasmon resonance assay. For example, an assay using a BIACORE®-2000 or a BIACORE®-3000 (BIAcore, Inc., Piscataway, N.J.)
(233) Immunoconjugates
(234) The presently disclosed subject provides for an anti-Foxp3 antibody or an antigen-binding portion thereof conjugated to a therapeutic moiety, such as a cytotoxin, a drug (e.g., an immunosuppressant) or a radiotoxin. Such conjugates are referred to herein as “immunoconjugates”. Immunoconjugates that include one or more cytotoxins are referred to as “immunotoxins.” A cytotoxin or cytotoxic agent includes any agent that is detrimental to (e.g., kills) cells. Examples include taxol (such as ricin, diphtheria, gelonin), cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof. Therapeutic agents also include, for example, calecheamicin, aureastatin, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g., vincristine and vinblastine).
(235) Other examples of therapeutic cytotoxins that can be conjugated to an anti-Foxp3 antibody or an antigen-binding portion thereof disclosed herein include duocarmycins, calicheamicins, maytansines and auristatins, and derivatives thereof. An example of a calicheamicin antibody conjugate is commercially available (Mylotarg™; Wyeth-Ayerst).
(236) Cytoxins can be conjugated to anti-Foxp3 antibody or an antigen-binding portion thereof disclosed herein using linker technology available in the art. Examples of linker types that have been used to conjugate a cytotoxin to an antibody include, but are not limited to, hydrazones, thioethers, esters, disulfides and peptide-containing linkers. A linker can be chosen that is, for example, susceptible to cleavage by low pH within the lysosomal compartment or susceptible to cleavage by proteases, such as proteases preferentially expressed in tumor tissue such as cathepsins (e.g., cathepsins B, C, D). For further discussion of types of cytotoxins, linkers and methods for conjugating therapeutic agents to antibodies, see also Saito, G. et al. (2003) Adv. Drug Deliv. Rev. 55:199-215; Trail, P. A. et al. (2003) Cancer Immunol. Immunother. 52:328-337; Payne, G. (2003) Cancer Cell 3:207-212; Allen, T. M. (2002) Nat. Rev. Cancer 2:750-763; Pastan, I. and Kreitman, R. J. (2002) Curr. Opin. Investig. Drugs 3:1089-1091; Senter, P. D. and Springer, C. J. (2001) Adv. Drug Deliv. Rev. 53:247-264.
(237) Anti-Foxp3 antibodies of the presently disclosed subject matter also can be conjugated to a radioactive isotope to generate cytotoxic radiopharmaceuticals, also referred to as radioimmunoconjugates. Examples of radioactive isotopes that can be conjugated to antibodies for use diagnostically or therapeutically include, but are not limited to, .sup.90Y, .sup.131I, .sup.225Ac, .sup.213Bi, .sup.223Ra, .sup.177Lu, and .sup.227Th. a Method for preparing radioimmunconjugates are established in the art. Examples of radioimmunoconjugates are commercially available, including Zevalin™ (IDEC Pharmaceuticals) and Bexxar™ (Corixa Pharmaceuticals), and similar methods can be used to prepare radioimmunoconjugates using the antibodies of the invention.
(238) The antibody conjugates of the presently disclosed subject matter can be used to modify a given biological response, and the drug moiety is not to be construed as limited to classical chemical therapeutic agents. For example, the drug moiety may be a protein or polypeptide possessing a desired biological activity. Such proteins may include, for example, an enzymatically active toxin, or active fragment thereof, such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor (TNF) or interferon-γ; or, biological response modifiers such as, for example, lymphokines, interleukin-1 (“IL-1”), interleukin-2 (“IL-2”), interleukin-6 (“IL-6”), granulocyte macrophage colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF”), or other growth factors.
(239) Techniques for conjugating such therapeutic moiety to antibodies are well known, see, e.g., Arnon et al., “Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy”, in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp. 243-56 (Alan R. Liss, Inc. 1985); Hellstrom et al., “Antibodies For Drug Delivery”, in Controlled Drug Delivery (2nd Ed.), Robinson et al. (eds.), pp. 623-53 (Marcel Dekker, Inc. 1987); Thorpe, “Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review”, in Monoclonal Antibodies '84: Biological And Clinical Applications, Pinchera et al. (eds.), pp. 475-506 (1985); “Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy”, in Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), pp. 303-16 (Academic Press 1985), and Thorpe et al., “The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates”, Immunol. Rev., 62:119-58 (1982).
(240) Bispecific Molecules
(241) The presently disclosed subject matter provides for bispecific molecules comprising an anti-Foxp3 antibody or an antigen-binding portion thereof disclosed herein. An antibody or an antigen-binding portion thereof of the presently disclosed subject matter, can be derivatized or linked to another functional molecule, e.g., another peptide or protein (e.g., another antibody or ligand for a receptor) to generate a bispecific molecule that binds to at least two different binding sites or target molecules. The antibody of the presently disclosed subject matter can in fact be derivatized or linked to more than one other functional molecule to generate multispecific molecules that bind to more than two different binding sites and/or target molecules; such multispecific molecules are also intended to be encompassed by the term “bispecific molecule” as used herein. To create a bispecific molecule, a presently disclosed anti-Foxp3 antibody or an antigen-binding portion thereof can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other binding molecules, such as another antibody, antibody fragment, peptide or binding mimetic, such that a bispecific molecule results.
(242) The presently disclosed subject matter provides bispecific molecules comprising at least one first binding specificity for a first target epitope or antigen and a second binding specificity for a second target epitope or antigen. The second target epitope or antigen can be different from the first epitope or antigen. In certain embodiments, the bispecific molecule is multispecific, the molecule can further include a third binding specificity. Where a first portion of a bispecific antibody binds to an antigen on a tumor cell for example and a second portion of a bispecific antibody recognizes an antigen on the surface of a human immune effector cell, the antibody is capable of recruiting the activity of that effector cell by specifically binding to the effector antigen on the human immune effector cell. In certain embodiments, bispecific antibodies, therefore, are able to form a link between effector cells, for example, T cells and tumor cells, thereby enhancing effector function.
(243) The bispecific molecules of the presently disclosed subject matter can be prepared by conjugating the constituent binding specificities using methods known in the art. For example, each binding specificity of the bispecific molecule can be generated separately and then conjugated to one another. When the binding specificities are proteins or peptides, a variety of coupling or cross-linking agents can be used for covalent conjugation. Examples of cross-linking agents include protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5, 5′-dithiobis(2-nitrobenzoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N-succinimidyl-3-(2-pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N-maleimidomethyl) cyclohaxane-1-carboxylate (sulfo-SMCC) (see e.g., Karpovsky et al. (1984) J. Exp. Med. 160:1686; Liu, M A et al. (1985) Proc. Natl. Acad. Sci. USA 82:8648). Other methods include those described in Paulus (1985) Behring Ins. Mitt. No. 78, 118-132; Brennan et al. (1985) Science 229:81-83), and Glennie et al. (1987) J. Immunol. 139: 2367-2375). Preferred conjugating agents are SATA and sulfo-SMCC, both available from Pierce Chemical Co. (Rockford, Ill.).
(244) When the binding specificities are antibodies, they can be conjugated via sulfhydryl bonding of the C-terminus hinge regions of the two heavy chains. In one non-limiting embodiment, the hinge region is modified to contain an odd number of sulfhydryl residues, preferably one, prior to conjugation.
(245) Alternatively, both binding specificities can be encoded in the same vector and expressed and assembled in the same host cell. This method is particularly useful where the bispecific molecule is a mAb×mAb, mAb×Fab, Fab×F(ab′).sub.2 or ligand x Fab fusion protein.
(246) Binding of the bispecific molecules to their specific targets can be confirmed by, for example, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), FACS analysis, bioassay (e.g., growth inhibition), or Western Blot assay. Each of these assays generally detects the presence of protein-antibody complexes of particular interest by employing a labeled reagent (e.g., an antibody) specific for the complex of interest. Alternatively, the complexes can be detected using any of a variety of other immunoassays. For example, the antibody can be radioactively labeled and used in a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, March, 1986, which is incorporated by reference herein). The radioactive isotope can be detected by such means as the use of a γ counter or a scintillation counter or by autoradiography.
(247) In certain embodiments, the bispecific antibodies recognize both Foxp3/MHC complex and a cell surface protein on a T cell, a NK cell, a NK T cell, neutrophil, monocyte, or macrophage. Non-limiting examples of cell surface protein include CD3 and CD16. In certain embodiments, the bispecific antibodies recognize both Foxp3/MHC complex and CD3 on immune T cells as described (Yan, et al., J. Biol. Chem. 2010; 285: 19637-19646; Rossi, et al., Proc Natl Aca Sci USA 2006; 103:6841-6) with a human IgG1 Fc. Bispecific antibodies recruit and target cytotoxic T cells to Foxp3/MHC positive cancer cells, while maintaining Fc effector functions and long half life in vivo. Three mechanisms are involved in the specific killing of cancer cells mediated by bispecific antibodies: i) killing by activated T cells; ii) ADCC activity; iii) CDC activity. Other formats of bispecific antibodies can be constructed, such tandem scFv molecules (taFv), diabodies (db), or single chain diabodies (scDb), and fusion protein with human serum albumin (Ryutaro, et al., J Biol Chem 2011; 286: 1812-1818; Anja, et al., Blood 2000; 95(6): 2098-2103; Weiner, et al., J Immunology 1994; 152(5): 2385-2392; Dafne, et al., J Biol Chem 2007; 282: 12650-12660), but are devoid of Fc effector functions with distinct pharmacokinetic profiles.
(248) Engineered and Modified Antibodies
(249) An antibody of the presently disclosed subject matter further can be prepared using an antibody or an antigen-binding portion thereof having one or more of the V.sub.H and/or V.sub.L sequences disclosed herein as starting material to engineer a modified antibody, which modified antibody may have altered properties from the starting antibody. An antibody can be engineered by modifying one or more residues within one or both variable regions (i.e., V.sub.H and/or V.sub.L), for example within one or more CDR regions and/or within one or more framework regions. Additionally or alternatively, an antibody can be engineered by modifying residues within the constant region(s), for example to alter the effector function(s) of the antibody.
(250) One type of variable region engineering that can be performed is CDR grafting. Antibodies interact with target antigens predominantly through amino acid residues that are located in the six heavy and light chain CDRs. For this reason, the amino acid sequences within CDRs are more diverse between individual antibodies than sequences outside of CDRs. Because CDR sequences are responsible for most antibody-antigen interactions, it is possible to express recombinant antibodies that mimic the properties of specific naturally occurring antibodies by constructing expression vectors that include CDR sequences from the specific naturally occurring antibody grafted onto framework sequences from a different antibody with different properties (see, e.g., Riechmann, L. et al. (1998) Nature 332:323-327; Jones, P. et al. (1986) Nature 321:522-525; Queen, C. et al. (1989) Proc. Natl. Acad. See. U.S.A. 86:10029-10033; U.S. Pat. No. 5,225,539 to Winter, and U.S. Pat. Nos. 5,530,101; 5,585,089; 5,693,762 and 6,180,370 to Queen et al.)
(251) Framework sequences can be obtained from public DNA databases or published references that include germline antibody gene sequences. For example, germline DNA sequences for human heavy and light chain variable region genes can be found in the IMGT human germline sequence database (available on the Internet at imgt.org), as well as in Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Tomlinson, I. M., et al. (1992) “The Repertoire of Human Germline V.sub.H Sequences Reveals about Fifty Groups of V.sub.H Segments with Different Hypervariable Loops” J. Mol. Biol. 227:776-798; and Cox, J. P. L. et al. (1994) “A Directory of Human Germ-line V.sub.H Segments Reveals a Strong Bias in their Usage” Eur. J. Immunol. 24:827-836; the contents of each of which are expressly incorporated herein by reference. As another example, the germline DNA sequences for human heavy and light chain variable region genes can be found in the GenBank database.
(252) The V.sub.H CDR1, CDR2, and CDR3 sequences, and the V.sub.L CDR1, CDR2, and CDR3 sequences, can be grafted onto framework regions that have the identical sequence as that found in the germline immunoglobulin gene from which the framework sequence derive, or the CDR sequences can be grafted onto framework regions that contain one or more mutations as compared to the germline sequences. For example, it has been found that in certain instances it is beneficial to mutate residues within the framework regions to maintain or enhance the antigen binding ability of the antibody (see e.g., U.S. Pat. Nos. 5,530,101; 5,585,089; 5,693,762 and 6,180,370 to Queen et al).
(253) Another type of variable region modification is to mutate amino acid residues within the V.sub.H and/or V.sub.L CDR1, CDR2 and/or CDR3 regions to thereby improve one or more binding properties (e.g., affinity) of the antibody of interest. Site-directed mutagenesis or PCR-mediated mutagenesis can be performed to introduce the mutation(s) and the effect on antibody binding, or other functional property of interest, can be evaluated in in vitro or in vivo assays. Preferably conservative modifications (as discussed above) are introduced. The mutations may be amino acid substitutions, additions or deletions. For example, no more than one, two, three, four or five residues within a CDR region are altered.
(254) Accordingly, the presently disclosed subject matter provides for isolated anti-Foxp3 monoclonal antibodies or antigen-binding portions thereof comprising a heavy chain variable region comprising: (a) the V.sub.H CDR1 sequence of the antibodies and antigen-bindingn portions thereof (e.g., scFvs) disclosed herein (e.g., #9, #11, #17, #18, #20, #21, #26, #27, #28, #32, #53, #54, #6, #9, #12, #15, or #5), or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the V.sub.H CDR1 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein; (b) the V.sub.H CDR2 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the V.sub.H CDR2 of any one of the antibodies or antigen-binding portions thereof disclosed herein; (c) the V.sub.H CDR3 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the V.sub.H CDR3 of any one of the antibodies or antigen-binding portions thereof disclosed herein; (d) the V.sub.L CDR1 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the V.sub.L CDR1 of any one of the antibodies or antigen-binding portions thereof disclosed herein; (e) the V.sub.L CDR2 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the V.sub.L CDR2 of any one of the antibodies or antigen-binding portions thereof disclosed herein; and (f) the V.sub.L CDR3 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the V.sub.L CDR3 of any one of the antibodies or antigen-binding portions thereof disclosed herein.
(255) For example, the presently disclosed subject matter provides for isolated anti-Foxp3 monoclonal antibodies or antigen-binding portions thereof comprising a heavy chain variable region comprising: (a) a V.sub.H CDR1 region comprising the amino acid sequence set forth in SEQ ID NOS: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, or 87, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOS: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, or 87; (b) a V.sub.H CDR2 region comprising the amino acid sequence set forth in SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, or 88, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, or 88; (c) a V.sub.H CDR3 region comprising the amino acid sequence set forth in SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, 53, 59, 65, 71, 77, 83, or 89, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, 53, 59, 65, 71, 77, 83, or 89; (d) a V.sub.L CDR1 region comprising the amino acid sequence set forth in SEQ ID NOs: 12, 18, 24, 30, 36, 40, 42, 48, 54, 60, 66, 72, 78, 84, or 90, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 12, 18, 24, 30, 36, 40, 42, 48, 54, 60, 66, 72, 78, 84, or 90; (e) a V.sub.L CDR2 region comprising the amino acid sequence set forth in SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, 55, 61, 67, 73, 79, 85, or 91, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, 55, 61, 67, 73, 79, 85, or 91; and
(256) (f) a V.sub.L CDR3 region comprising the amino acid sequence set forth in SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, 56, 62, 68, 74, 80, 86, or 92, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, 56, 62, 68, 74, 80, 86, or 92.
(257) Engineered antibodies of the presently disclosed subject matter include those in which modifications are made to framework residues within V.sub.H and/or V.sub.K, e.g., to improve the properties of the antibody. Typically such framework modifications are made to decrease the immunogenicity of the antibody. For example, one approach is to “backmutate” one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived.
(258) Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Patent Publication No. 20030153043 by Carr et al.
(259) In addition or alternative to modifications made within the framework or CDR regions, anti-Foxp3 antibodies or antigen-binding portions thereof of the presently disclosed subject matter may be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity. Furthermore, a presently disclosed anti-Foxp3 antibody may be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody. The hinge region of CH1 may be modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425 by Bodmer et al. The number of cysteine residues in the hinge region of CH1 is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody. The Fc hinge region of an antibody may be mutated to decrease the biological half life of the antibody. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding. This approach is described in further detail in U.S. Pat. No. 6,165,745 by Ward et al. The antibody may be modified to increase its biological half life, e.g., the antibody may be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022 by Presta et al. Furthermore, the Fc region may be altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody. The Fc region may be modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody for an Fcγ receptor, e.g., as described in WO 00/42072 by Presta. In certain embodiments, a presently disclosed anti-Foxp3 antibody comprises an afucosylated Fc region. Removal of the fucose residue from the N-glycans of the Fc portion of immunoglobulin G (IgG) can result in a dramatic enhancement of ADCC through improved affinity for Fcγ receptor IIIc (FcγRIIIa).
(260) Additionally or alternatively, the glycosylation of an antibody may be modified. For example, an aglycoslated antibody can be made (i.e., the antibody lacks glycosylation). Glycosylation can be altered to, for example, increase the affinity of the antibody for antigen, see e.g., U.S. Pat. Nos. 5,714,350 and 6,350,861. Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence. For example, one or more amino acid substitution can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
(261) Additionally or alternatively, an antibody can be made that has an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures. Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies. Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery.
(262) Another modification of the antibodies may be pegylation. An antibody can be pegylated to, for example, increase the biological (e.g., serum) half life of the antibody. To pegylate an antibody, the antibody, or fragment thereof, typically is reacted with polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment. The pegylation may be carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer). As used herein, the term “polyethylene glycol” is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C.sub.1-C.sub.10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide. The antibody to be pegylated may be an aglycosylated antibody. Methods for pegylating proteins are known in the art and can be applied to the antibodies disclosed herein, see e.g., EP 0 154 316 and EP 0 401 384.
(263) III. Methods of Preparation
(264) 1. Identification of Peptides with High Predictive Binding to MHC Molecules
(265) The presently disclosed subject matter provides for a method for the generation of antibodies that specifically bind to MHC-restricted peptides, which, when presented as part of a peptide/MHC complex are able to elicit a specific cytotoxic T-cell response. HLA class I molecules present endogenous derived peptides of about 8-12 amino acids in length to CD8.sup.+ cytotoxic T lymphocytes. Peptides to be used in the presently disclosed method are generally about 6-22 amino acids in length, and in some embodiments, between about 9 and 20 amino acids (more specifically, between 8-12 amino acids, e.g., 9 amino acids or 10 amino acids) and comprise an amino acid sequence derived from a protein of interest, for example, human Foxp3 protein having an amino acid sequence set forth in SEQ ID NO: 1 (Genbank Accession No. ABQ15210.1, provided below) or an analog thereof.
(266) TABLE-US-00007 [SEQ ID NO: 1] 1 mpnprpgkps apslalgpsp gaspswraap kasdllgarg pggtfqgrdl rggahassss 61 lnpmppsqlq lptlplvmva psgarlgplp hlqallqdrp hfmhqlstvd ahartpvlqv 121 hplespamis ltppttatgv fslkarpglp pginvaslew vsrepallct fpnpsaprkd 181 stlsavpqss ypllangvck wpgcekvfee pedflkhcqa dhlldekgra qcllqremvq 241 sleqqlvlek eklsamqahl agkmaltkas svassdkgsc civaagsqgp vvpawsgpre 301 apdslfavrr hlwgshgnst fpeflhnmdy fkfhnmrppf tyatlirwai leapekqrtl 361 neiyhwftrm faffrnhpat wknairhnls lhkcfvrves ekgavwtvde lefrkkrsqr 421 psrcsnptpg p
(267) Peptides suitable for use in generating antibodies in accordance with the presently disclosed method can be determined based on the presence of MHC molecule (e.g., HLA molecule, more specifically, HLA class I molecule, more specifically, HLA-A, more specifically, HLA-A2, and more specifically, HLA-A*02:01) binding motifs and the cleavage sites for proteasomes and immune-proteasomes using computer prediction models known to those of skill in the art. For predicting MHC class I binding sites, such models include, but are not limited to, ProPred1 (described in more detail in Singh and Raghava, Bioinformatics 17(12):1236-1237 2001), SYFPEITHI (see Schuler et al. Immunoinformatics Methods in Molecular Biology, vol 409(1): 75-93 2007), Net MHC (cbs.dtu.dk), and BIMAS (bimas.cit.nih.gov).
(268) HLA-A*02:01 is expressed in 39-46% of all caucasians and therefore, represents a suitable choice of MHC antigen for use in the present method. For identification of one embodiment of a Foxp3 peptide antigen, amino acid sequences and predicted binding of putative Foxp3 epitopes to HLA-A*02:01 molecules were identified using the predictive algorithm of the SYFPEITHI database (syfpeithi.de; see Schuler (2007)). For identification of one embodiment of a Foxp3 peptide antigen, amino acid sequences and predicted binding of putative Foxp3 epitopes to HLA-A*02:01 molecules were identified using the predictive algorithm of the BIMAS (bimas.cit.nih.gov). For identification of one embodiment of a Foxp3 peptide antigen, amino acid sequences and predicted binding of putative Foxp3 epitopes to HLA-A*02:01 molecules were identified using the predictive algorithm of RANKPEP (bio.dfci.harvard.edu).
(269) Once appropriate peptides are identified, peptide synthesis can be done in accordance with protocols well known to those of ordinary skill in the art. Because of their relatively small size, the peptides of the presently disclosed subject matter can be directly synthesized in solution or on a solid support in accordance with conventional peptide synthesis techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. The synthesis of peptides in solution phase has become a well-established procedure for large-scale production of synthetic peptides and as such is a suitable alternative method for preparing the peptides of the invention. (See e.g., Stewart et al., Tetrahedron Letters Vol. 39, pages 1517-1520 1998.)
(270) Each of the peptides used in the protocols described herein was purchased and synthesized by Genemed Synthesis, Inc. (San Antonio, Tex.). The quality of the peptides was assessed by high-performance liquid chromatography analysis, and the expected molecular weight was observed using matrix-assisted laser desorption mass spectrometry. Peptides were sterile and 80% to >90% pure. The peptides were dissolved in DMSO and diluted in saline at 5 mg/mL and stored at -80 OC.
(271) Subsequent to peptide selection, binding activity of selected peptides is tested using the antigen-processing-deficient T2 cell line, which increases expression of HLA-A when stabilized by a peptide in the antigen-presenting groove. Briefly, T2 cells are pulsed with peptide for a time sufficient to induce HLA-A expression. HLA-A expression of T2 cells is then measured by immunostaining with a fluorescently labeled monoclonal antibody specific for HLA-A (for example, BB7.2) and flow cytometry. Fluorescence index (FI) is calculated as the mean fluorescence intensity (MFI) of HLA-A*02:01 on T2 cells as determined by fluorescence-activated cell-sorting analysis, using the formula FI=(MFI [T2 cells with peptide]/MFI [T2 cells without peptide]-1.
(272) Fully human T-cell receptor (TCR)-like antibodies to Foxp3 were produced using the method disclosed herein. TCR-like anti-Foxp3 antibodies generated by phage display technology are specific for a Foxp3 peptide/HLA complex similar to that which induces HLA-restricted cytotoxic CD8 T-cells.
(273) Once a suitable peptide has been identified, the target antigen to be used for phage display library screening, that is, a peptide/MHC complex (for example, Foxp3/HLA complex, e.g., Foxp3 peptide/HLA-A*02:01) is prepared by bringing the peptide and the histocompatibility antigen together in solution to form the complex.
(274) 2. Selecting a High Affinity scFv Against a Foxp3 Peptide
(275) The next step is the selection of phage that binds to the target antigen of interest with high affinity, from phage in a human phage display library that either does not bind or that binds with lower affinity. This is accomplished by iterative binding of phage to the antigen, which is bound to a solid support, for example, beads or mammalian cells followed by removal of non-bound phage and by elution of specifically bound phage. In certain embodiments, antigens are first biotinylated for immobilization to, for example, streptavidin-conjugated Dynabeads M-280. The phage library is incubated with the cells, beads or other solid support and non binding phage is removed by washing. Clones that bind are selected and tested.
(276) Once selected, positive scFv clones are tested for their binding to HLA-A2/peptide complexes on live T2 cell surfaces by indirect flow cytometry. Briefly, phage clones are incubated with T2 cells that have been pulsed with a Foxp3 peptide, or an irrelevant peptide (control). The cells are washed and then with a mouse anti-M13 coat protein mAb. Cells are washed again and labeled with a FITC-goat (Fab)2 anti-mouse Ig prior to flow cytometry.
(277) In other embodiments, the anti-Foxp3 antibodies may comprise one or more framework region amino acid substitutions designed to improve protein stability, antibody binding, expression levels or to introduce a site for conjugation of therapeutic agents. These scFv are then used to produce recombinant human monoclonal Igs in accordance with methods known to those of skill in the art.
(278) Methods for reducing the proliferation of leukemia cells is also included, comprising contacting leukemia cells with a presently disclosed Foxp3 antibody. In a related aspect, the presently disclosed antibodies can be used for the prevention or treatment of leukemia. Administration of therapeutic antibodies is known in the art.
IV. Chimeric Antigen Receptors
(279) Chimeric antigen receptors (CARs) are engineered receptors, which graft or confer a specificity of interest onto an immune effector cell. CARs can be used to graft the specificity of a monoclonal antibody onto a T cell; with transfer of their coding sequence facilitated by retroviral vectors.
(280) There are three generations of CARs. “First generation” CARs are typically composed of an extracellular antigen binding domain (e.g., a scFv fused to a transmembrane domain, fused to cytoplasmic/intracellular domain of the T cell receptor chain. “First generation” CARs typically have the intracellular domain from the CD3-chain, which is the primary transmitter of signals from endogenous TCRs. “First generation” CARs can provide de novo antigen recognition and cause activation of both CD4.sup.+ and CD8.sup.+ T cells through their CD3 chain signaling domain in a single fusion molecule, independent of HLA-mediated antigen presentation. “Second generation” CARs add intracellular domains from various co-stimulatory molecules (e.g., CD28, 4-1BB, ICOS, OX40) to the cytoplasmic tail of the CAR to provide additional signals to the T cell. “Second generation” CARs comprise those that provide both co-stimulation (e.g., CD28 or 4-1BB) and activation (CD3). Preclinical studies have indicated that “Second Generation” CARs can improve the anti-tumor activity of T cells. For example, robust efficacy of “Second Generation” CAR modified T cells was demonstrated in clinical trials targeting the CD19 molecule in patients with chronic lymphoblastic leukemia (CLL) and acute lymphoblastic leukemia (ALL). “Third generation” CARs comprise those that provide multiple co-stimulation (e.g., CD28 and 4-1BB) and activation (CD3).
(281) In accordance with the presently disclosed subject matter, the CARs comprise an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen-binding domain binds to a Foxp3 peptide bound to an MHC molecule (e.g., a HLA molecule, more specifically, a HLA class I molecule). In certain embodiments, the extracellular antigen-binding domain is a scFv. In certain embodiments, the scFv is a human scFv. Non-limiting example of scFv include EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55 EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, and EXT018-4.
(282) In certain embodiments, the extracellular antigen-binding domain is a Fab, which is optionally crosslinked. In a certain embodiments, the extracellular binding domain is a F(ab).sub.2. In certain embodiments, any of the foregoing molecules may be comprised in a fusion protein with a heterologous sequence to form the extracellular antigen-binding domain.
(283) In certain non-limiting embodiments, an extracellular antigen-binding domain of a presently disclosed CAR can comprise a linker connecting the heavy chain variable region and light chain variable region of the extracellular antigen-binding domain. As used herein, the term “linker” refers to a functional group (e.g., chemical or polypeptide) that covalently attaches two or more polypeptides or nucleic acids so that they are connected to one another. As used herein, a “peptide linker” refers to one or more amino acids used to couple two proteins together (e.g., to couple V.sub.H and V.sub.L domains). In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO: 135, which is provided below. In certain embodiments, the nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 135 is set forth in SEQ ID NO: 136, which is provided below.
(284) TABLE-US-00008 (SEQ ID NO: 135) SRGGGGSGGGGSGGGGSLEMA (SEQ ID NO: 136) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGG ATCCCTCGAGATGGCC
(285) In certain embodiments, the extracellular antigen-binding domain is a scFv, which comprises a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, or 119, or an amino acid sequence that is at least 80% homologous to SEQ ID NO: 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, or 119, and a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 94, 96, 98, 100, 102, 104, 106, and 108, 110, 112, 114, 116, 118, or 120, or an amino acid sequence that is at least 80% homologous to SEQ ID NO: 94, 96, 98, 100, 102, 104, 106, and 108, 110, 112, 114, 116, 118, or 120, and optionally a linker comprising the amino acid sequence set forth in SEQ ID NO: 135.
(286) In certain embodiments, the extracellular antigen-binding domain is a scFv, which comprises (a) a V.sub.H CDR1 region comprising the amino acid sequence set forth in SEQ ID NOS: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, or 87, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOS: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, or 87; (b) a V.sub.H CDR2 region comprising the amino acid sequence set forth in SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, or 88, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, or 88; (c) a V.sub.H CDR3 region comprising the amino acid sequence set forth in SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, 53, 59, 65, 71, 77, 83, or 89, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, 53, 59, 65, 71, 77, 83, or 89; (d) a V.sub.L CDR1 region comprising the amino acid sequence set forth in SEQ ID NOs: 12, 18, 24, 30, 36, 40, 42, 48, 54, 60, 66, 72, 78, 84, or 90, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 12, 18, 24, 30, 36, 40, 42, 48, 54, 60, 66, 72, 78, 84, or 90; (e) a V.sub.L CDR2 region comprising the amino acid sequence set forth in SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, 55, 61, 67, 73, 79, 85, or 91, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, 55, 61, 67, 73, 79, 85, or 91; and
(287) (f) a V.sub.L CDR3 region comprising the amino acid sequence set forth in SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, 56, 62, 68, 74, 80, 86, or 92, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, 56, 62, 68, 74, 80, 86, or 92, and optionally a linker comprising the amino acid sequence set forth in SEQ ID NO: 135. In certain embodiments, the scFv further comprises a His-tag and a HA-tag. In certain embodiments, the amino acid sequence of the His-tag and HA-tag comprises the amino acid sequence of SEQ ID NO: 141, as provided below. The nucleotide sequence encoding SEQ ID NO: 141 is SEQ ID NO: 142.
(288) TABLE-US-00009 [SEQ ID NO: 141] TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 142] CTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATAC CCGTACGACGTTCCGGACTACGCTTCT
(289) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, and 134.
(290) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 93 or an amino acid sequence that is at least 80% homolgous to SEQ ID NO: 93, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 94 or an amino acid sequence that is at least 80% homolgous to SEQ ID NO: 94, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 121.
(291) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 95 or an amino acid sequence that is at least 80% homolgous to SEQ ID NO: 95, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 96 or an amino acid sequence that is at least 80% homolgous to SEQ ID NO: 96, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 122.
(292) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 97 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 97, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 98 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 98, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 123.
(293) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 99 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 99, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 100 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 100, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 124.
(294) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 101 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 101, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 102 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 102, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 125.
(295) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 103 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 103, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 104 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 104, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 126.
(296) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 105 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 105, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 106 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 106, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 127.
(297) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 107 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 107, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 108 or an amino acid sequence that is at least 80% homolgous to SEQ ID NO: 108, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 128.
(298) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 109 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 109, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 110 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 110, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 129.
(299) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 111 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 111, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 112 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 112, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 130.
(300) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 113 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 113, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 114 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 114, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 131.
(301) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 115 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 115, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 116 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 116, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 132.
(302) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 117 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 117, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 118 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 118, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 133.
(303) In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a V.sub.H comprising the amino acid sequence set forth in SEQ ID NO: 119 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 119, a V.sub.L comprising the amino acid sequence set forth in SEQ ID NO: 120 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 120, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 134.
(304) In addition, the extracellular antigen-binding domain can comprise a leader or a signal peptide that directs the nascent protein into the endoplasmic reticulum. Signal peptide or leader can be essential if the CAR is to be glycosylated and anchored in the cell membrane. The signal sequence or leader can be a peptide sequence (about 5, about 10, about 15, about 20, about 25, or about 30 amino acids long) present at the N-terminus of newly synthesized proteins that directs their entry to the secretory pathway. In non-limiting examples, the signal peptide is covalently joined to the 5′ terminus of the extracellular antigen-binding domain.
(305) In certain non-limiting embodiments, the transmembrane domain of the CAR comprises a hydrophobic alpha helix that spans at least a portion of the membrane. Different transmembrane domains result in different receptor stability. After antigen recognition, receptors cluster and a signal is transmitted to the cell. In accordance with the presently disclosed subject matter, the transmembrane domain of the CAR can comprise a CD8 polypeptide, a CD28 polypeptide, a CD3 polypeptide, a CD4 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a CTLA-4 polypeptide, a PD-1 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof.
(306) In certain embodiments, the transmembrane domain of a presently disclosed CAR comprises a CD28 polypeptide. In certain embodiments, the transmembrane domain of a presently disclosed CAR comprises a CD8 polypeptide.
(307) In certain non-limiting embodiments, an intracellular domain of the CAR can comprise a CD3zeta (CD3) polypeptide, which can activate or stimulate a cell (e.g., a cell of the lymphoid lineage, e.g., a T cell). CD3 comprises 3 ITAMs, and transmits an activation signal to the cell (e.g., a cell of the lymphoid lineage, e.g., a T cell) after antigen is bound. The CD3 polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% homologous to the sequence having a NCBI Reference No: NP_932170 (SEQ ID No: 137), or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions. In non-limiting embodiments, the CD3ζ polypeptide can have an amino acid sequence that is a consecutive portion of SEQ ID NO: 137 which is at least 20, or at least 30, or at least 40, or at least 50, and up to 164 amino acids in length. Alternatively or additionally, in non-limiting various embodiments, the CD3ζ polypeptide has an amino acid sequence of amino acids 1 to 164, 1 to 50, 50 to 100, 100 to 150, or 150 to 164 of SEQ ID NO: 137. In certain embodiments, the CD3ζ polypeptide has an amino acid sequence of amino acids 52 to 121 of SEQ ID NO: 137.
(308) SEQ ID NO: 137 is provided below:
(309) TABLE-US-00010 [SEQ ID NO: 137] 1 MKWKALFTAA ILQAQLPITE AQSFGLLDPK LCYLLDGILF IYGVILTALF LRVKFSRSAD 61 APAYQQGQNQ LYNELNLGRR EEYDVLDKRR GRDPEMGGKP QRRKNPQEGL YNELQKDKMA 121 EAYSEIGMKG ERRRGKGHDG LYQGLSTATK DTYDALHMQA LPPR
(310) In certain embodiments, the CD3 polypeptide has the amino acid sequence set forth in SEQ ID NO: 138, which is provided below.
(311) TABLE-US-00011 [SEQ ID NO: 138] RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
(312) In certain non-limiting embodiments, an intracellular domain of the CAR further comprises at least one co-stimulatory signaling region comprising at least one co-stimulatory molecule, which can provide optimal lymphocyte activation. As used herein, “co-stimulatory molecules” refer to cell surface molecules other than antigen receptors or their ligands that are required for an efficient response of lymphocytes to antigen. The at least one co-stimulatory signaling region can include a CD28 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof. The co-stimulatory molecule can bind to a co-stimulatory ligand, which is a protein expressed on cell surface that upon binding to its receptor produces a co-stimulatory response, i.e., an intracellular response that effects the stimulation provided when an antigen binds to its CAR molecule. In certain embodiments, the intracellular domain of the CAR comprises a co-stimulatory signaling region that comprises a CD28 polypeptide. In one non-limiting embodiment, the CAR comprises a CD28 transmembrane domain and a CD28 co-stimulatory signaling domain, where CD28 polypeptide comprised in the transmembrane domain and the co-stimulatory signaling region has the amino acid sequence set forth in SEQ ID NO: 139, which is provided below.
(313) TABLE-US-00012 (SEQ ID NO: 139) IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVL ACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPR DFAAYRS
(314) In addition, the presently disclosed subject matter provides immunoresponsive cells expressing a presently disclosed CAR. The immunoresponsive cells can be transduced with a presently disclosed CAR such that the cells express the CAR. The presently disclosed subject matter also provides methods of using such cells for the treatment of a tumor or Foxp3-associated pathologic condition. The immunoresponsive cells of the presently disclosed subject matter can be cells of the lymphoid lineage. The lymphoid lineage, comprising B, T and natural killer (NK) cells, provides for the production of antibodies, regulation of the cellular immune system, detection of foreign agents in the blood, detection of cells foreign to the host, and the like. Non-limiting examples of immunoresponsive cells of the lymphoid lineage include T cells, Natural Killer (NK) cells, embryonic stem cells, and pluripotent stem cells (e.g., those from which lymphoid cells may be differentiated).
(315) In certain embodiments, the immunoresponsive cell is a T cell. T cells can be lymphocytes that mature in the thymus and are chiefly responsible for cell-mediated immunity. T cells are involved in the adaptive immune system. T cells of the presently disclosed subject matter can be any type of T cells, including, but not limited to, T helper cells, cytotoxic T cells, memory T cells (including central memory T cells, stem-cell-like memory T cells (or stem-like memory T cells), and two types of effector memory T cells: e.g., TEM cells and TEMRA cells), Regulatory T cells (also known as suppressor T cells), Natural killer T cells, Mucosal associated invariant T cells, and γδ T cells. Cytotoxic T cells (CTL or killer T cells) are a subset of T lymphocytes capable of inducing the death of infected somatic or tumor cells. In certain embodiments, the CAR-expressing T cells express Foxp3 to achieve and maintain a T regulatory phenotype.
(316) Natural killer (NK) cells can be lymphocytes that are part of cell-mediated immunity and act during the innate immune response. NK cells do not require prior activation in order to perform their cytotoxic effect on target cells.
(317) Genetic modification of immunoresponsive cells (e.g., T cells, NK cells) can be accomplished by transducing a substantially homogeneous cell composition with a recombinant DNA or RNA construct. The vector can be a retroviral vector (e.g., gamma retroviral), which is employed for the introduction of the DNA or RNA construct into the host cell genome. For example, a polynucleotide encoding a presently disclosed CAR can be cloned into a retroviral vector and expression can be driven from its endogenous promoter, from the retroviral long terminal repeat, or from an alternative internal promoter.
(318) Non-viral vectors or RNA may be used as well. Random chromosomal integration, or targeted integration (e.g., using a nuclease, transcription activator-like effector nucleases (TALENs), Zinc-finger nucleases (ZFNs), and/or clustered regularly interspaced short palindromic repeats (CRISPRs), or transgene expression (e.g., using a natural or chemically modified RNA) can be used.
(319) For initial genetic modification of the cells to provide cells expressing a presently disclosed CAR, a retroviral vector is generally employed for transduction, however any other suitable viral vector or non-viral delivery system can be used. For subsequent genetic modification of the cells to provide cells comprising an antigen presenting complex comprising at least two co-stimulatory ligands, retroviral gene transfer (transduction) likewise proves effective. Combinations of retroviral vector and an appropriate packaging line are also suitable, where the capsid proteins will be functional for infecting human cells. Various amphotropic virus-producing cell lines are known, including, but not limited to, PA12 (Miller, et al. (1985) Mol. Cell. Biol. 5:431-437); PA317 (Miller, et al. (1986)Mol. Cell. Biol. 6:2895-2902); and CRIP (Danos, et al. (1988) Proc. Natl. Acad. Sci. USA 85:6460-6464). Non-amphotropic particles are suitable too, e.g., particles pseudotyped with VSVG, RD114 or GALV envelope and any other known in the art.
(320) Possible methods of transduction also include direct co-culture of the cells with producer cells, e.g., by the method of Bregni, et al. (1992) Blood 80:1418-1422, or culturing with viral supernatant alone or concentrated vector stocks with or without appropriate growth factors and polycations, e.g., by the method of Xu, et al. (1994) Exp. Hemat. 22:223-230; and Hughes, et al. (1992) J Clin. Invest. 89:1817.
(321) Non-viral approaches can also be employed for the expression of a protein in cell. For example, a nucleic acid molecule can be introduced into a cell by administering the nucleic acid in the presence of lipofection (Feigner et al., Proc. Natl. Acad. Sci. U.S.A. 84:7413, 1987; Ono et al., Neuroscience Letters 17:259, 1990; Brigham et al., Am. J. Med. Sci. 298:278, 1989; Staubinger et al., Methods in Enzymology 101:512, 1983), asialoorosomucoid-polylysine conjugation (Wu et al., Journal of Biological Chemistry 263:14621, 1988; Wu et al., Journal of Biological Chemistry 264:16985, 1989), or by micro-injection under surgical conditions (Wolff et al., Science 247:1465, 1990). Other non-viral means for gene transfer include transfection in vitro using calcium phosphate, DEAE dextran, electroporation, and protoplast fusion. Liposomes can also be potentially beneficial for delivery of DNA into a cell. Transplantation of normal genes into the affected tissues of a subject can also be accomplished by transferring a normal nucleic acid into a cultivatable cell type ex vivo (e.g., an autologous or heterologous primary cell or progeny thereof), after which the cell (or its descendants) are injected into a targeted tissue or are injected systemically. Recombinant receptors can also be derived or obtained using transposases or targeted nucleases (e.g. Zinc finger nucleases, meganucleases, or TALE nucleases). Transient expression may be obtained by RNA electroporation.
(322) cDNA expression for use in polynucleotide therapy methods can be directed from any suitable promoter (e.g., the human cytomegalovirus (CMV), simian virus 40 (SV40), or metallothionein promoters), and regulated by any appropriate mammalian regulatory element or intron (e.g., the elongation factor 1a enhancer/promoter/intron structure). For example, if desired, enhancers known to preferentially direct gene expression in specific cell types can be used to direct the expression of a nucleic acid. The enhancers used can include, without limitation, those that are characterized as tissue- or cell-specific enhancers. Alternatively, if a genomic clone is used as a therapeutic construct, regulation can be mediated by the cognate regulatory sequences or, if desired, by regulatory sequences derived from a heterologous source, including any of the promoters or regulatory elements described above.
(323) The resulting cells can be grown under conditions similar to those for unmodified cells, whereby the modified cells can be expanded and used for a variety of purposes.
V. Pharmaceutical Compositions and Methods of Use
(324) Antibodies (including bispecific antibodies and engineered antibodies disclosed herein) and compositions comprising thereof, antigen binding proteins (including CARs) and compositions comprising thereof, and immunoconjugates and compositions comprising thereof of the presently disclosed subject matter can be used to kill Foxp3-expressing cells. Antibodies (including bispecific antibodies and engineered antibodies disclosed herein) and compositions comprising thereof, antigen binding proteins (including CARs) and compositions comprising thereof, and immunoconjugates and compositions comprising thereof of the presently disclosed subject matter can be used to induce an immune response in a subject. Furthermore, antibodies (including bispecific antibodies and engineered antibodies disclosed herein) and compositions comprising thereof, antigen binding proteins (including CARs) and compositions comprising thereof, and immunoconjugates and compositions comprising thereof of the presently disclosed subject matter can be used to selectively inhibit (e.g., inactivate, inhibit the proflieration of or kill) certain T cells, e.g., CD4.sup.+ T cells, CD127.sup.low T cells, CD25.sup.high T cells, Foxp3.sup.high T cells, and combinations thereof, e.g., regulatory T (Treg) cells. Foxp3 has been identified as a key player in Treg function, and is the most definitive marker of CD4.sup.+CD25.sup.+ Treg cells. The presently disclosed antibodies and antigen binding proteins specifically target Treg cells and selectively inhibit Treg cells. In certain embodiments, the methods comprise administering a presently disclosed antibody or antigen binding protein to a subject. Antibodies and antigen binding proteins of the presently disclosed subject matter can reduce number of T cells (e.g., Tregs), deplete T cells (e.g., Tregs), inhibit immunosuppressive activity of T cells (e.g., Tregs), block T cells (e.g., Tregs) trafficking into lymph nodes or tumors, inhibit (inactivat and/or kill T cells (e.g., Tregs); and/or induce death of cancer cells.
(325) Additionally, a presently disclosed antibody (including a bispecific antibody and an engineered antibody disclosed herein) or a composition comprising thereof, antigen binding protein (including CAR) or a composition comprising thereof, or immunoconjugate or a composition comprising thereof can be used to treat cancer. Most tumor-associated antigens are self-proteins, which elicit weak natural or induced T cell responses after immunotherapy. Treg cells have been shown to be able to recognize tumor-associated self-antigens and control T cell responses against various cancer antigens. In certain embodiments, the method comprise administering a presently disclosed antibody (including a bispecific antibody and an engineered antibody disclosed herein) or a composition comprising thereof, antigen binding protein (including CAR) or a composition comprising thereof, or immunoconjugate or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject. In certain embodiments, the cancer cell expresses Foxp3. In certain embodiments, a presently disclosed antibody (including a bispecific antibody and an engineered antibody disclosed herein) or a composition comprising thereof, antigen binding protein (including CAR) or a composition comprising thereof, or immunoconjugate or a composition comprising thereof is administered to the subject in an amount sufficient to prevent, inhibit, or reduce the progression of the cancer or tumor. Progression includes, e.g., the growth, invasiveness, metastases and/or recurrence of the cancer or tumor. Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's own immune system. Dosing schedules will also vary with the disease state and status of the patient, and will typically range from a single bolus dosage or continuous infusion to multiple administrations per day (e.g., every 4-6 hours), or as indicated by the treating physician and the patient's condition.
(326) The identification of medical conditions treatable by the antibodies (including bispecific antibodies and engineered antibodies disclosed herein) and compositions comprising thereof, antigen binding proteins (including CARs) and compositions comprising thereof, and immunoconjugates and compositions comprising thereof of the presently disclosed subject matter is well within the ability and knowledge of one skilled in the art. A clinician skilled in the art can readily determine, for example, by the use of clinical tests, physical examination and medical/family history, if an individual is a candidate for such treatment.
(327) Non-limiting examples of cancers include various solid tumors, including, but not limited to, melanoma, ovarian cancer, breast cancer, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, and sarcoma.
(328) Anticancer immunotherapies can be improved by concomitant Treg blockade. In certain embodiments, the cancer subject receives or has received one or more anticancer immunotherapy. Non-limiting examples of anticancer immunotherapy include antibody therapy, cellular therapy (T cells, NK cells, etc.), CAR therapy, bone marrow transplantation and donor leukocyte infusions, immune T cell regulatory therapies (immune checkpoint therapy, e. g., anti-PD-1 antibodies, anti-PD-L1 antibodies, anti-LAG3 antibodies, anti-CTLA-4 antibodies, and anti-CD47 antibodies), and vaccination-based drugs and variants thereof. In certain embodiments, the method comprises administering a presently disclosed Foxp3 antibody (including bispecific antibody and engineered antibody) or a composition comprising thereof, antigen binding protein (including a CAR) or a composition comprising thereof, or an immunoconjugate or a composition comprising thereof in combination with one or more other agents, including, but not limited to, anti-PD-1 antibodies, anti-PD-L1 antibodies, anti-LAG3 antibodies, anti-CTLA-4 antibodies, and anti-CD47 antibodies. For example, an embodiment of the presently disclosed subject matter provides a method of treating a medical condition by administering a presently disclosed antibody or antigen binding protein with an antineoplastic agent. Treg blockade may also benefit the therapeutic effects of a wide variety of other cancer therapies, including, but not limited to, chemotherapy, targeted therapy (e.g., a tyrosine kinase inhibitor), hormonal therapy, radiation therapy, surgery, hyperthermia, topical therapy, light-activated therapy, and therapies where an activated immune system may be needed to enhance killing, to reduce residual tumor or leukemia cells, or to act synergistically or additively with such therapies. The antibody can be chemically or biosynthetically linked to one or more of the antineoplastic agents to make an antibody drug conjugate as well.
(329) Any suitable method or route can be used to administer a presently disclosed antibody or antigen binding protein (e.g., a CAR), and optionally, to co-administer antineoplastic agents and/or antagonists of other receptors. Routes of administration include, for example, intravenous, intraperitoneal, intra arterial, subcutaneous, intrathecal, topical, or intramuscular administration. Co administered agents may be given by these routes and also orally. It should be emphasized, however, that the presently disclosed subject matter is not limited to any particular method or route of administration.
(330) It is noted that a presently disclosed antibody (including bispecific antibody and engineered antibody) or antigen binding protein (including a CAR) can be administered as a conjugate, which binds specifically to the receptor and delivers a toxic, lethal payload following ligand-toxin internalization.
(331) It is understood that antibodies (including bispecific antibodies and engineered antibodies), antigen binding proteins (including CARs) or immunoconjugates of the presently disclosed subject matter can be administered in the form of a composition, e.g., a pharmaceutical composition comprising a pharmaceutically acceptable carrier. Suitable pharmaceutically acceptable carriers include, for example, one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof. Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the binding proteins. The compositions of the injection may, as is well known in the art, be formulated so as to provide quick, sustained or delayed release of the active ingredient after administration to the mammal.
(332) Other aspects of the presently disclosed subject matter include without limitation, the use of antibodies and nucleic acids that encode them as research tools for the detection of Foxp3 in cells and tissues. The presently disclosed subject matter provides methods for detecting Foxp3 in a whole cell or tissue. In certain embodiments, the method comprises (a) contacting a cell or tissue with a presently disclosed antibody or antigen-binding portion thereof comprising a detectable label; and (b) determining the amount of the labeled antibody or antigen-binding portion thereof bound to the cell or tissue by measuring the amount of detectable label associated with the cell or tissue, wherein the amount of bound antibody or antigen-binding portion thereof indicates the amount of Foxp3 in the cell or tissue.
(333) Pharmaceutical compositions comprising the disclosed antibodies and nucleic acids are encompassed by the presently disclosed subject matter. Vectors comprising the nucleic acids of the presently disclosed subject matter for antibody-based treatment by vectored immunotherapy are also contemplated by the presently disclosed subject matter. Vectors include expression vectors which enable the expression and secretion of antibodies, as well as vectors which are directed to cell surface expression of the antigen-binding proteins, such as chimeric antigen receptors.
(334) Cells comprising the nucleic acids, for example cells that have been transfected with the vectors of the presently disclosed subject matter are also encompassed by the disclosure.
(335) For use in diagnostic and research applications, kits are also provided that contain a presently disclosed anti-Foxp3 antibody or nucleic acids of the presently disclosed subject matter, assay reagents, buffers, and the like.
VI. Kits
(336) The presently disclosed subject matter provides kits for the treatment or prevention of cancer. In certain embodiments, the kit comprises a therapeutic composition containing an effective amount of a presently disclosed antibody (including a bispecific antibody or an engineered antibody), antigen binding protein (including a CAR), or an immunoconjugate in unit dosage form. In certain embodiments, the kit comprises a sterile container which contains a therapeutic or prophylactic vaccine; such containers can be boxes, ampules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art. Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
(337) If desired, a presently disclosed antibody (including a bispecific antibody or an engineered antibody), antigen binding protein (including a CAR), or an immunoconjugate is provided together with instructions for administering the cell to a subject having or at risk of developing a cancer. The instructions will generally include information about the use of the composition for the treatment or prevention of cancer. In other embodiments, the instructions include at least one of the following: description of the therapeutic agent; dosage schedule and administration for treatment or prevention of cancer or symptoms thereof; precautions; warnings; indications; counter-indications; over-dosage information; adverse reactions; animal pharmacology; clinical studies; and/or references. The instructions may be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.
VII. Methods
(338) 1. Flow Cytometry Analysis.
(339) For cell surface staining, cells were incubated with appropriate mAbs for 30 minutes on ice, washed, and incubated with secondary antibody reagents when necessary. For #32-BITE staining, human T cells or cancer cells were incubated with different concentrations of #32-BITE or control BITE for 30 minutes on ice, washed, and incubated with secondary mAb against His-Tag. Flow cytometry data were collected on a FACS Calibur (Becton Dickinson) or LSRFortessa (BD Biosciences) and analyzed with FlowJo V8.7.1 and 9.4.8 software.
(340) 2. Selection and Characterization of scFv Specific for Foxp3 Peptide/HLA-A*02:01 Complexes.
(341) Well established phage display libraries and screening methods known to those of skill in the art were used to select scFv fragments highly specific for a Foxp3 peptide/HLA-A2 complex. In certain embodiments, a human scFv antibody phage display library was used for the selection of mAb clones. In order to reduce the conformational change of MHC1 complex introduces by immobilizing onto plastic surfaces, a solution panning method was used in place of conventional plate panning. In brief, biotinylated antigens were first mixed with the human scFv phage library, then the antigen-scFv antibody complexes were pulled down by streptavidin-conjugated Dynabeads M-280 through a magnetic rack.
(342) Bound clones were then eluted and were used to infect E. Coli XL1-Blue. The scFv phage clones expressed in the bacteria were purified (Yasmina, et al., Protein Science 2008; 17(8): 1326-1335; Roberts et al., Blood 2002: 99 (10): 3748-3755). Panning was performed for 3-4 cycles to enrich scFv phage clones binding to HLA-A*02:01/Foxp3 complex specifically. Positive clones were determined by standard ELISA method against biotinylated single chain HLA-A*02:01/Foxp3 peptide complexes. Positive clones were further tested for their binding to HLA-A2/peptide complexes on live cell surfaces by flow cytometry, using a TAP-deficient, HLA-A*02:01.sup.+ cell line, T2. T2 cells were pulsed with peptides (50 μg/ml) in the serum-free RPMI1640 medium, in the presence of 20 μg/ml 132 M overnight. The cells were washed, and the staining was performed as follows.
(343) The cells were first stained with purified scFv phage clones, and followed by staining with a mouse anti-M13 mAb, and finally the goat F(ab).sub.2 anti-mouse Ig's conjugate to FITC. Each step of the staining was done between 30-60 minutes on ice and the cells were washed twice between each step of the staining.
(344) 3. Engineering Full Length mAb Using the Selected ScFv Fragments.
(345) Phage display technology allows for the rapid selection and production of antigen-specific scFv and Fab fragments, which are useful in and of themselves, or which can be further developed to provide complete antibodies, antigen-binding proteins or antigen-binding portions thereof. Complete mAbs with Fc domains have a number of advantages over the scFv and Fab antibodies. First, only full length Abs exert immunological function such as CDC and ADCC mediated via Fc domain. Second, bivalent mAbs offer stronger antigen-binding affinity than monomeric Fab Abs. Third, plasma half-life and renal clearance will be different with the Fab and bivalent mAb. The particular features and advantages of each can be matched to the planned effector strategy. Fourth, bivalent mAb may be internalized at different rates than scFv and Fab, altering immune function or carrier function. Alpha emitters, for example, do not need to be internalized to kill the targets, but many drugs and toxins will benefit from internalization of the immune complex. In certain embodiments, therefore, once scFv clones specific for Foxp3/HLA-A2 were obtained from phage display libraries, a full length IgG mAb using the scFv fragments was produced.
(346) Full-length human IgG1 of the selected phage clones were produced in HEK293 and Chinese hamster ovary (CHO) cell lines, as described (Caron et al., J Exp Med 176:1191-1195. 1992). In brief, antibody variable regions were sub-cloned into mammalian expression vectors, with matching human lambda or kappa light chain constant region and human IgG1 subclass Fc. Molecular weight of the purified full length IgG antibodies were measured under both reducing and non-reducing conditions by electrophoresis.
(347) 4. Engineering Chimeric Antigen Receptors and Immune Effector Cells.
(348) Nucleic acids that encode antibodies and antigen-binding proteins identified herein can be used engineer recombinant immune effector cells. Methods and vectors to generate genetically modified T-cells, for example, are known in the art (See Brentjens et al., Safety and persistence of adoptively transferred autologous CD19-targeted T cells in patients with relapsed or chemotherapy refractory B-cell leukemias in Blood 118(18):4817-4828, November 2011).
(349) 5. Characterization of the Full-Length Human IgG1 for the Foxp3/A0201 Complex.
(350) Initially, specificities of the fully human IgG1 mAbs for the Foxp3 peptide/A0201 complex were determined by staining T2 cells pulsed with or without a Foxp3 peptide (e.g., Foxp3-7), or irrelevant EW or RHAMM-R3 control peptides, followed by secondary goat F(ab).sub.2 anti-human IgG mAb conjugate to PE or FITC, using indirect or direct staining. The fluorescence intensity was measured by flow cytometry.
(351) The same method was used to determine the binding of the mAbs to fresh tumor cells and cell lines.
Exemplary Embodiments
(352) 1. An isolated antibody, or an antigen-binding portion thereof, which binds to a Foxp3 peptide bound to a human major histocompatibility complex (MHC) molecule.
(353) 2. The antibody or antigen-binding portion thereof of embodiment 1, wherein the human MHC molecule is a human leukocyte antigen (HLA) molecule.
(354) 3. The antibody or antigen-binding portion thereof of embodiment 2, wherein the HLA molecule is a HLA class I molecule.
(355) 4. The antibody or antigen-binding portion thereof of embodiment 3, wherein the HLA class I molecule is HLA-A.
(356) 5. The antibody or antigen-binding portion thereof of embodiment 4, wherein the HLA-A is HLA-A2.
(357) 6. The antibody or antigen-binding portion thereof of embodiment 5, wherein the HLA-A2 is HLA-A*02:01.
(358) 7. The antibody or antigen-binding portion thereof of any one of embodiments 1-6, wherein the Foxp3 peptide is a portion of a human Foxp3 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1.
(359) 8. The antibody or antigen-binding portion thereof of any one of embodiments 1-7, wherein the Foxp3 peptide has a length of 8-12 amino acids.
(360) 9. The antibody or antigen-binding portion thereof of embodiment 8, wherein the Foxp3 peptide has a length of 9 amino acids.
(361) 10. The antibody or antigen-binding portion thereof of embodiment 8, wherein the Foxp3 peptide has a length of 10 amino acids.
(362) 11. The antibody or antigen-binding portion thereof of any one of embodiments 1-10, wherein the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof, Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof.
12. The antibody or antigen-binding portion thereof of embodiment 11, wherein the Foxp3 peptide is Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8.
13. The antibody or antigen-binding portion thereof of any one of embodiments 1-8, and 10-12, comprising a heavy chain variable region CDR3 sequence and a light chain variable region CDR3 sequence selected from the group consisting of:
(363) (a) a heavy chain variable region CDR3 sequence comprising amino acid sequence set forth in SEQ ID NO: 11 or a modification thereof, and a light chain variable region CDR3 sequence comprising amino acid sequence set forth in SEQ ID NO: 14 or a modification thereof.
(364) (b) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 17 or a modification thereof, and a light chain variable region CDR3 sequence comprising amino an acid sequence set forth in SEQ ID NO: 20 or a modification thereof.
(365) (c) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 23 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 26 or a modification thereof
(366) (d) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 29 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 32 or a modification thereof.
(367) (e) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 35 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 38 or a modification thereof.
(368) (f) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 41 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 44 or a modification thereof.
(369) (g) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 47 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 50 or a modification thereof and
(370) (h) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 53 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 56 or a modification thereof.
(371) 14. The antibody or antigen-binding portion thereof of any one of embodiments 1-8 and 10-13, comprising a heavy chain variable region CDR2 sequence and a light chain variable region CDR2 sequence selected from the group consisting of:
(372) (a) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 10 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 13 or a modification thereof.
(373) (b) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 16 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 19 or a modification thereof.
(374) (c) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 22 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 25 or a modification thereof.
(375) (d) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 28 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 31 or a modification thereof.
(376) (e) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 34 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 37 or a modification thereof.
(377) (f) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 40 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 43 or a modification thereof.
(378) (g) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 46 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 49 or a modification thereof and
(379) (h) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 52 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 55 or a modification thereof.
(380) 15. The antibody or antigen-binding portion thereof of any one of embodiments 1-8 and 10-14, comprising a heavy chain variable region CDR1 sequence and a light chain variable region CDR1 sequence selected from the group consisting of:
(381) (a) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 9 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 12 or a modification thereof.
(382) (b) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 15 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 18 or a modification thereof
(383) (c) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 21 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 24 or a modification thereof and
(384) (d) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 27 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 30 or a modification thereof.
(385) (e) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 33 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 36 or a modification thereof.
(386) (f) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 39 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 42 or a modification thereof.
(387) (g) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 45 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 48 or a modification thereof and
(388) (h) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 51 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 54 or a modification thereof.
(389) 16. The antibody or antigen-binding portion thereof of any one of embodiments 1-8 and 10-15, comprising:
(390) (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14;
(391) (b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20;
(392) (c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26;
(393) (d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32;
(394) (e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38;
(395) (f) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44;
(396) (g) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50; or
(397) (h) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56.
(398) 17. The antibody or antigen-binding portion thereof of embodiment 16, comprising: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44.
18. The antibody or antigen-binding portion thereof of any one of embodiments 1-8, and 10-16, comprising a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 93, 95, 97, 99, 101, 103, 105, and 107.
19. The antibody or antigen-binding portion thereof of embodiment 18, comprising a heavy chain variable region that comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 93, 95, 97, 99, 101, 103, 105, and 107.
20. The antibody or antigen-binding portion thereof of any one of embodiments 1-8, and 10-16, comprising a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 94, 96, 98, 100, 102, 104, 106, and 108.
21. The antibody or antigen-binding portion thereof of embodiment 20, comprising a light chain variable region that comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 94, 96, 98, 100, 102, 104, 106, and 108.
22. The antibody or antigen-binding portion thereof of any one of embodiments 18-21, comprising:
(399) (a) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 94;
(400) (b) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 96;
(401) (c) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 98;
(402) (d) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 100;
(403) (e) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 102;
(404) (f) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 104;
(405) (g) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 106; or
(406) (h) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 108.
(407) 23. The antibody or antigen-binding portion thereof of embodiment 22, comprising:
(408) (a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94;
(409) (b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(410) (c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(411) (d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100;
(412) (e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(413) (f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104;
(414) (g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106; or
(415) (h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108.
(416) 24. The antibody or antigen-binding portion thereof of embodiment 23, comprising: a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104.
25. The antibody or antigen-binding portion thereof of embodiment 11, wherein the Foxp3 peptide is Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3.
26. The antibody or antigen-binding portion thereof of embodiment 25, comprising a heavy chain variable region CDR3 sequence and a light chain variable region CDR3 sequence selected from the group consisting of:
(417) (a) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 59 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 62 or a modification thereof;
(418) (b) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 65 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 68 or a modification thereof;
(419) (c) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 71 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 74 or a modification thereof;
(420) (d) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 77 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 80 or a modification thereof and
(421) (e) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 83 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 86 or a modification thereof.
(422) 27. The antibody or antigen-binding portion thereof of embodiments 25 or 26, comprising a heavy chain variable region CDR2 sequence and a light chain variable region CDR2 sequence selected from the group consisting of:
(423) (a) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 58 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 61 or a modification thereof.
(424) (b) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 64 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 67 or a modification thereof.
(425) (c) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 70 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 73 or a modification thereof.
(426) (d) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 76 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 79 or a modification thereof and
(427) (e) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 82 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 85 or a modification thereof.
(428) 28. The antibody or antigen-binding portion thereof of embodiment 25, 26 or 27, comprising a heavy chain variable region CDR1 sequence and a light chain variable region CDR1 sequence selected from the group consisting of:
(429) (a) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 57 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 60 or a modification thereof;
(430) (b) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 63 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 66 or a modification thereof;
(431) (c) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 69 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 71 or a modification thereof;
(432) (d) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 75 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 78 or a modification thereof; and
(433) (e) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 81 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 84 or a modification thereof.
(434) 29. The antibody or antigen-binding portion thereof of any one of embodiments 25-28, comprising:
(435) (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62;
(436) (b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68;
(437) (c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74;
(438) (d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80; or
(439) (e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86.
(440) 30. The antibody or antigen-binding portion thereof of any one of embodiments 25-29, comprising a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 109, 111, 113, 115, and 117.
31. The antibody or antigen-binding portion thereof of embodiment 30, comprising a heavy chain variable region that comprises an amino acid sequence set forth in SEQ ID NO: 109, SEQ ID NO: 111, SEQ ID NO: 113, SEQ ID NO: 115, or SEQ ID NO: 117.
32. The antibody or antigen-binding portion thereof of any one of embodiments 25-31, comprising a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 110, 112, 114, 116, and 118.
33. The antibody or antigen-binding portion thereof of embodiment 32, comprising a light chain variable region that comprises an amino acid sequence set forth in SEQ ID NO: 110, SEQ ID NO: 112, SEQ ID NO: 114, SEQ ID NO: 116, or SEQ ID NO: 118.
34. The antibody or antigen-binding portion thereof of any one of embodiments 30-33, comprising:
(441) (a) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 110;
(442) (b) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence s that is at least about 80% homologous the amino acid sequence et forth in SEQ ID NO: 112;
(443) (c) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 114;
(444) (d) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 116; or
(445) (e) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 118.
(446) 35. The antibody or antigen-binding portion thereof of embodiment 34, comprising:
(447) (a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110;
(448) (b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112;
(449) (c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114;
(450) (d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116; or
(451) (e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118.
(452) 36. The antibody or antigen-binding portion thereof of embodiment 11, wherein the Foxp3 peptide is Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5.
(453) 37. The antibody or antigen-binding portion thereof of embodiment 36, comprising a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 89 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 92 or a modification thereof.
38. The antibody or antigen-binding portion thereof of embodiment 36 or 37, comprising a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 88 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 91 or a modification thereof.
39. The antibody or antigen-binding portion thereof of embodiment 36, 37 or 38, comprising a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 87 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 90 or a modification thereof.
40. The antibody or antigen-binding portion thereof of any one of embodiments 36-39, comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92.
41. The antibody or antigen-binding portion thereof of any one of embodiments 36-40, comprising a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 119.
42. The antibody or antigen-binding portion thereof of embodiment 41, comprising a heavy chain variable region that comprises an amino acid sequence set forth in SEQ ID NO: 119.
43. The antibody or antigen-binding portion thereof of any one of embodiments 36-42, comprising a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 120.
44. The antibody or antigen-binding portion thereof of embodiment 43, comprising a light chain variable region that comprises an amino acid sequence set forth in SEQ ID NO: 120.
45. The antibody or antigen-binding portion thereof of any one of embodiments 41-44, comprising a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 120.
46. The antibody or antigen-binding portion thereof of embodiment 45, comprising a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 120.
47. The antibody or antigen-binding portion thereof of any one of embodiments 13-15, 26-28 and 37-39, wherein the modification is selected from deletions, insertions, substitutions, and combinations thereof.
48. The antibody or antigen-binding portion thereof of any one of embodiments 13-15, 26-28 and 37-39, wherein the modification thereof consists of no more than 2, no more than 3, no more than 4, or no more than 5 modifications.
49. The antibody or antigen-binding portion thereof of any one of embodiments 1-48, which binds to the N-terminal of the Foxp3 peptide that is bound to the human MHC molecule.
50. The antibody or antigen-binding portion thereof of any one of embodiments 1-48, which binds to the C-terminal of the Foxp3 peptide that is bound to the human MHC molecule.
51. The antibody or antigen-binding portion thereof of any one of embodiments 1-50, which binds to the Foxp3 peptide/MHC complex with a binding affinity (KD) of about 1×10-7 M or less.
52. An isolated antibody, or an antigen-binding portion thereof, which cross-competes for binding to a Foxp3 peptide bound to a human MHC molecule with a reference antibody or antigen-binding portion comprising:
(454) (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14;
(455) (b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20;
(456) (c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26;
(457) (d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32;
(458) (e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38;
(459) (f) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44;
(460) (g) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50;
(461) (h) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56;
(462) (i) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62;
(463) (j) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68;
(464) (k) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74;
(465) (l) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80;
(466) (m) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86; or
(467) (n) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92, and
(468) wherein the cross-competing antibody or antigen-binding portion thereof specifically binds to the Foxp3 peptide/MHC complex with a binding affinity (KD) of about 5×10-7 M or less.
(469) 53. An isolated antibody, or an antigen-binding portion thereof, which binds to the same epitope on a Foxp3 peptide bound to an MHC molecule with a reference antibody or antigen-binding portion comprising:
(470) (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14;
(471) (b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20;
(472) (c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26;
(473) (d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32;
(474) (e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38;
(475) (f) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44;
(476) (g) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50;
(477) (h) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56;
(478) (i) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62;
(479) (j) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68;
(480) (k) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74;
(481) (l) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80;
(482) (m) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86; or
(483) (n) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92.
(484) 54. An isolated antibody, or an antigen-binding portion thereof, which cross-competes for binding to a Foxp3 peptide bound to an MHC molecule with a reference antibody or antigen-binding portion comprising:
(485) (a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94;
(486) (b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(487) (c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(488) (d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100;
(489) (e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(490) (f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104;
(491) (g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106;
(492) (h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108;
(493) (i) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110;
(494) (j) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112;
(495) (k) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114;
(496) (l) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116;
(497) (m) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118; or
(498) (n) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 120, and
(499) wherein the cross-competing antibody or antigen-binding portion thereof specifically binds to the Foxp3 peptide/MHC complex with a binding affinity (KD) of about 5×10-7 M or less.
(500) 55. An isolated antibody, or an antigen-binding portion thereof, which binds to the same epitope on a Foxp3 peptide bound to an MHC molecule with a reference antibody or antigen-binding portion comprising:
(501) (a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94;
(502) (b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(503) (c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(504) (d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100;
(505) (e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(506) (f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104;
(507) (g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106;
(508) (h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108;
(509) (i) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110;
(510) (j) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112;
(511) (k) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114;
(512) (l) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116;
(513) (m) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118; or
(514) (n) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 120.
(515) 56. The antibody or antigen-binding portion thereof of any one of embodiments 52-55, wherein the human MHC molecule is a HLA molecule.
(516) 57. The antibody or antigen-binding portion thereof of embodiment 56, wherein the HLA molecule is a HLA class I molecule.
(517) 58. The antibody or antigen-binding portion thereof of embodiment 57, wherein the HLA class I molecule is HLA-A.
(518) 59. The antibody or antigen-binding portion thereof of embodiment 58, wherein the HLA-A is HLA-A2.
(519) 60. The antibody or antigen-binding portion thereof of embodiment 59, wherein the HLA-A2 is HLA-A*02:01.
(520) 61. The antibody or antigen-binding portion thereof of any one of embodiments 52-60, wherein the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof; Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof.
62. The antibody or antigen-binding portion thereof of embodiment 61, wherein the Foxp3 peptide is Foxp3-7 or a portion thereof.
63. The antibody or antigen-binding portion thereof of any one of embodiments 52-62, wherein the reference antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104.
64. The antibody or antigen-binding portion thereof of embodiment 61, wherein the Foxp3 peptide is Foxp3-2 or a portion thereof.
65. The antibody or antigen-binding portion thereof of embodiment 61, wherein the Foxp3 peptide is Foxp3-4 or a portion thereof.
66. The antibody or antigen-binding portion thereof of any one of the preceding embodiments, wherein the antibody comprises a human variable region framework region.
67. The antibody or antigen-binding portion thereof of any one of the preceding embodiments, which is a fully human antibody or an antigen-binding portion thereof.
68. The antibody or antigen-binding portion thereof of any one of embodiments 1-66, which is a chimeric antibody or an antigen-binding portion thereof.
69. The antibody or antigen-binding portion thereof of any one of embodiments 1-66, which is a humanized antibody or an antigen-binding portion thereof.
70. The antibody or antigen-binding portion thereof of any one of the preceding embodiments, wherein the antigen-binding portion of the antibody is an Fab, Fab′, F(ab′)2, Fv or single chain Fv (scFv).
71. The antibody or antigen-binding portion thereof of any one of the preceding embodiments, which is of an IgG1, IgG2, IgG3, or IgG4 isotype.
72. The antibody or antigen-binding portion thereof of embodiment 71, which is of an IgG1 isotype.
73. The antibody or antigen-binding portion thereof of any one of the preceding embodiments, comprising one or more post-translational modifications.
74. The antibody or antigen-binding portion thereof of embodiment 73, wherein the one or more post-translational modifications comprise afucosylation.
75. The antibody or antigen-binding portion thereof of embodiment 74, comprising an afucosylated Fc region.
76. A composition comprising the antibody or antigen-binding portion thereof of any one of the preceding embodiments, and a pharmaceutically acceptable carrier.
77. An immunoconjugate comprising the antibody or antigen-binding portion thereof of any one of embodiments 1-75 linked to a therapeutic agent.
78. The immunoconjugate of embodiment 77, wherein said therapeutic agent is a drug, cytotoxin, or a radioactive isotope.
79. A composition comprising the immunoconjugate of embodiment 77 or 78 and a pharmaceutically acceptable carrier.
80. A bispecific molecule comprising the antibody or antigen-binding portion thereof of any one of embodiments 1-75, linked to a second functional moiety.
81. The bispecific molecule of embodiment 80, wherein the second functional moiety has a different binding specificity than said antibody or antigen binding portion thereof.
82. The bispecific molecule of embodiment 80 or 81, which recognizes a Foxp3 peptide bound to the MHC molecule and a cell surface protein.
83. The bispecific molecule of embodiment 82, wherein the cell surface protein is CD3 or CD16.
84. A composition comprising the bispecific molecule of any one of embodiments 80-83 and a pharmaceutically acceptable carrier.
85. An isolated nucleic acid that encodes an antibody or antigen-binding portion thereof of any one of embodiments 1-75.
86. An expression vector comprising the nucleic acid molecule of embodiment 85.
87. A host cell comprising the expression vector of embodiment 86.
88. A method for detecting Foxp3 in a whole cell or tissue, comprising:
(521) (a) contacting a cell or tissue with an antibody or an antigen-binding portion thereof that binds to a Foxp3 peptide that is bound to a human MHC molecule, wherein the antibody or antigen-binding portion thereof comprises a detectable label; and
(522) (b) determining the amount of the labeled antibody or antigen-binding portion thereof bound to the cell or tissue by measuring the amount of detectable label associated with the cell or tissue, wherein the amount of bound antibody or antigen-binding portion thereof indicates the amount of Foxp3 in the cell or tissue.
(523) 89. The method of embodiment 88, wherein the human MHC molecule is a HLA molecule.
(524) 90. The method of embodiment 89, wherein the HLA molecule is a HLA class I molecule.
(525) 91. The method of embodiment 90, wherein the HLA class I molecule is HLA-A.
(526) 92. The method of embodiment 91, wherein the HLA-A is HLA-A2.
(527) 93. The method of embodiment 92, wherein the HLA-A2 is HLA-A*02:01.
(528) 94. The method of any one of embodiments 88-93, wherein the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof; Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof.
95. The method of embodiment 94, wherein the Foxp3 peptide is Foxp3-7 or a portion thereof.
96. The method of embodiment 94, wherein the Foxp3 peptide is Foxp3-2 or a portion thereof.
97. The method of embodiment 94, wherein the Foxp3 peptide is Foxp3-4 or a portion thereof.
98. The method of any one of embodiments 88-97, wherein the antibody or antigen-binding portion thereof is the antibody or antigen-binding portion thereof of any one of embodiments 1-75.
99. A chimeric antigen receptor (CAR) specific for a Foxp3 peptide bound to a human MHC molecule.
100. The CAR of embodiment 99, wherein the human MHC molecule is a HLA molecule.
101. The CAR of embodiment 100, wherein the HLA molecule is a HLA class I molecule.
102. The CAR of embodiment 101, wherein the HLA class I molecule is HLA-A.
103. The CAR of embodiment 102, wherein the HLA-A is HLA-A2.
104. The CAR of embodiment 103, wherein the HLA-A2 is HLA-A*02:01.
105. The CAR of any one of embodiments 99-104, wherein the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof; Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof.
106. The CAR of embodiment 105, wherein the Foxp3 peptide is Foxp3-7 or a portion thereof.
107. The CAR of embodiment 105, wherein the Foxp3 peptide is Foxp3-2 or a portion thereof.
108. The CAR of embodiment 105, wherein the Foxp3 peptide is Foxp3-4 or a portion thereof.
109. The CAR of any one of embodiments 99-108, wherein the CAR comprises an antigen-binding portion comprising a heavy chain variable region and a light chain variable region.
110. The CAR of embodiment 109, wherein the CAR comprises a linker between the heavy chain variable region and the light chain variable region.
111. The CAR of embodiment 110, wherein the linker comprises the amino acid sequence set forth in SEQ ID NO: 135.
112. The CAR of any one of embodiments 99-111, wherein the CAR comprises the antigen-binding portion of any one of embodiments 1-75.
113. The CAR of any one of embodiments 109-112, wherein the antigen-binding portion comprises a single-chain variable fragment (scFv).
114. The CAR of embodiment 113, wherein the scFv is a human scFv.
115. The CAR of embodiment 114, wherein the human scFv comprises the amino acid sequence selected from the group consisting of SEQ ID NOS: 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, and 134.
116. The CAR of embodiment 115, wherein the human scFv comprises the amino acid sequence set forth in SEQ ID NO: 126.
117. The CAR of any one of embodiments 109-112, wherein the antigen-binding portion comprises a Fab, which is optionally crosslinked.
118. The CAR of any one of embodiments 109-112, wherein the antigen-binding portion comprises a F(ab)2.
119. An isolated nucleic acid encoding the CAR of any one of embodiments 99-118.
120. A vector comprising the isolated nucleic acid of embodiment 119.
121. A host cell comprising the nucleic acid of embodiment 119.
122. The host cell of embodiment 121, wherein the host cell is a T cell.
123. A method of killing a Foxp3-expressing cell, comprising contacting a Foxp3-expressing cell with the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof.
124. Use of the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof to kill a Foxp3-expressing cell.
125. The antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof for use in killing a Foxp3-expressing cell.
126. A method of killing a Foxp3-expressing cell, comprising contacting a Foxp3-expressing cell with the CAR of any one of embodiments 99-118 or a composition comprising thereof.
127. Use of the CAR of any one of embodiments 99-118 or a composition comprising thereof to kill a Foxp3-expressing cell.
128. The CAR of any one of embodiments 99-118 or a composition comprising thereof for use in killing a Foxp3-expressing cell.
129. A method of killing a Foxp3-expressing cell, comprising contacting a Foxp3-expressing cell with the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof.
130. Use of the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to kill a Foxp3-expressing cell.
131. The bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for use in killing a Foxp3-expressing cell.
132. A method of killing a Foxp3-expressing cell, comprising contacting a Foxp3-expressing cell with the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof.
133. Use of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to kill a Foxp3-expressing cell.
134. The immunoconjugate of embodiment 77 or 78 or a composition comprising thereof for use in killing a Foxp3-expressing cell.
135. The method of any one of embodiments 123, 126, 129, and 132, wherein the Foxp3-expressing cell is a T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3high T cells, and combinations thereof.
136. The use of any one of embodiments 124, 127, 130, and 133, wherein the Foxp3-expressing cell is a T cell selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3high T cells, and combinations thereof.
137. The antibody of embodiment 125, wherein the Foxp3-expressing cell is a T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3high T cells, and combinations thereof.
138. The bispecific antibody of embodiment 131, wherein the Foxp3-expressing cell is a T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3high T cells, and combinations thereof.
139. The immunoconjugate of embodiment 134, wherein the Foxp3-expressing cell is a T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3high T cells, and combinations thereof.
140. A method of inducing an immune response in a subject, comprising administering the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof to the subject.
141. Use of the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof to induce an immune response in a subject.
142. The antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof for use in inducing an immune response.
143. A method of inducing an immune response in a subject, comprising administering the CAR of any one of embodiments 99-118 or a composition comprising thereof to the subject.
144. Use of the CAR of any one of embodiments 99-118 or a composition comprising thereof to induce an immune response in a subject.
145. The CAR of any one of embodiments 99-118 or a composition comprising thereof for use in inducing an immune response.
146. A method of inducing an immune response in a subject, comprising administering the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to the subject.
147. Use of the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to induce an immune response in a subject.
148. The bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for use in inducing an immune response.
149. A method of inducing an immune response in a subject, comprising administering the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to the subject.
150. Use of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to induce an immune response in a subject.
151. The immunoconjugate of embodiment 77 or 78 or a composition comprising thereof for use in inducing an immune response.
152. A method of selectively inhibiting a T cell in a subject, comprising administering the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof to the subject, wherein the T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3high T cells, and combinations thereof.
153. Use of the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof to selectively inhibit a T cell in a subject, wherein the T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3high T cells, and combinations thereof.
154. The antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof for use in selective inhibition of a T cell, wherein the T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3high T cells, and combinations thereof.
155. A method of selectively inhibiting a T cell in a subject, comprising administering the CAR of any one of embodiments 99-118 or a composition comprising thereof to the subject, wherein the T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3high T cells, and combinations thereof.
156. Use of the CAR of any one of embodiments 99-118 or a composition comprising thereof to selectively inhibit a T cell in a subject, wherein the T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3.sup.high T cells, and combinations thereof.
157. The CAR of any one of embodiments 99-118 or a composition comprising thereof for use in selective inhibition of a T cell that is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3.sup.high T cells, and combinations thereof.
158. A method of selectively inhibiting a T cell in a subject, comprising administering the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to the subject.
159. Use of the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to selectively inhibit a T cell in a subject, wherein the T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3.sup.high T cells, and combinations thereof.
160. The bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for use in selective inhibition of a T cell that is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3.sup.high T cells, and combinations thereof.
161. A method of selectively inhibiting a T cell in a subject, comprising administering the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to the subject, wherein the T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3.sup.high T cells, and combinations thereof.
162. Use of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to selectively inhibit a T cell in a subject, wherein the T cell is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3.sup.high T cells, and combinations thereof.
163. The immunoconjugate of embodiment 77 or 78 or a composition comprising thereof for use in selective inhibition of a T cell that is selected from the group consisting of CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3.sup.high T cells, and combinations thereof.
164. The method of any one of embodiments 152, 155, 158, and 161, wherein the subject suffers from cancer.
165. The use of any one of embodiments 153, 154, 159, and 162, wherein the subject suffers from cancer.
166. The antibody or antigen-binding portion there of embodiment 154, wherein the subject suffers from cancer.
167. The CAR of embodiment 157, wherein the subject suffers from cancer.
168. The bispecific antibody of embodiment 160, wherein the subject suffers from cancer.
169. The immunoconjugate of embodiment 163, wherein the subject suffers from cancer.
170. The method of any one of embodiments 152, 155, 158, and 161, comprising one or more of the followings:
(i) reducing number of a T cell,
(ii) depleting the T cell,
(iii) inhibiting immunosuppressive activity of the T cell, and
(iv) blocking the T cell trafficking into lymph nodes.
171. The method of any one of embodiments 152, 155, 158, 161 and 170, wherein the T cell is a regulatory T cell.
172. The use of any one of embodiments 153, 156, 159, and 162, comprising one or more of the followings:
(529) (i) reducing number of the T cell,
(530) (ii) depleting the T cell,
(531) (iii) inhibiting immunosuppressive activity of the T cell, and
(532) (iv) blocking the T cell trafficking into lymph nodes.
(533) 173. The use of any one of embodiments 153, 156, 159, 162, and 172, wherein the T cell is a regulatory T cell.
(534) 174. The antibody or antigen-binding portion there of embodiment 154, which
(535) (i) reduces number of the T cell,
(536) (ii) depletes the T cell,
(537) (iii) inhibits immunosuppressive activity of the T cell, and/or
(538) (iv) blocks regulatory T cells trafficking into lymph nodes.
(539) 175. The antibody or antigen-binding portion there of embodiment 154 or 173, wherein the T cell is a regulatory T cell.
(540) 176. The CAR of embodiment 157, which
(541) (i) reduces number of the T cell,
(542) (ii) depletes the T cell,
(543) (iii) inhibiting immunosuppressive activity of the T cell, and/or
(544) (iv) blocking the T cell trafficking into lymph nodes.
(545) 177. The CAR of embodiment 157 or 176. wherein the T cell is a regulatory T cell.
(546) 178. The bispecific antibody of embodiment 160, which
(547) (i) reduces number of the T cell,
(548) (ii) depletes the T cell,
(549) (iii) inhibits immunosuppressive activity of the T cell, and/or
(550) (iv) blocks the T cell trafficking into lymph nodes.
(551) 179. The bispecific antibody of embodiment 160 or 178, wherein the T cell is a regulatory T cell.
(552) 180. The immunoconjugate of embodiment 163, which
(553) (i) reduces number of the T cell,
(554) (ii) depletes the T cell,
(555) (iii) inhibits immunosuppressive activity of the T cell, and/or
(556) (iv) blocks the T cell trafficking into lymph nodes.
(557) 181. The immunoconjugate of embodiment 163 or 179, wherein the T cell is a regulatory T cell.
(558) 182. A method of treating cancer, comprising administering an effective amount of the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject.
183. A method of treating cancer, comprising administering an effective amount of the CAR of any one of embodiments 99-118 or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject.
184. A method of treating cancer, comprising administering an effective amount of the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject.
185. A method of treating cancer, comprising administering an effective amount of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject.
186. A method of treating cancer, comprising administering an effective amount of the antibody or antigen-binding portion thereof of any one of embodiments 1-75, the CAR of any one of embodiments 99-118, the bispecific antibody of any one of embodiments 80-83, the immunoconjugate of embodiment 77 or 78, or a composition comprising thereof to a subject suffering from cancer, thereby inhibiting a T cell in the subject.
187. The method of embodiment 186, wherein the T cell that is inhibited is a T regulatory cell.
188. The method of embodiment 186 or 187, wherein the T cell that is inhibited is a CD4.sup.+ T cells, CD25.sup.high T cells, CD127.sup.low T cells, Foxp3.sup.high T cell, or a T cell exhibiting two or more of said markers.
189. The method of any one of embodiments 182-189, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
190. The method of any one of embodiments 182-189, wherein the subject is a human.
191. The method of any one of embodiments 182-190, wherein the subject receives an anticancer immunotherapy.
192. The method of any one of embodiments 182-191, wherein the cancer cell and/or the T cell expresses Foxp3.
193. Use of the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof for treating cancer.
194. Use of the CAR of any one of embodiments 99-118 or a composition comprising thereof for treating cancer.
195. Use of the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for treating cancer.
196. Use of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof for treating cancer.
197. The use of any one of embodiments 193-195, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
198. The use of any one of embodiments 193-197, wherein the subject is a human.
199. The use of any one of embodiments 193-198, wherein the subject receives an anticancer immunotherapy.
200. The use of any one of embodiments 193-199, wherein the cancer cell expresses Foxp3.
201. The antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof for use in treating cancer in a subject.
202. The antibody or antigen-binding portion thereof of embodiment 188, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
203. The antibody or antigen-binding portion thereof of embodiment 201 or 202, wherein the subject is a human.
204. The antibody or antigen-binding portion thereof of any one of embodiments 201-203, wherein the subject receives an anticancer immunotherapy.
205. The antibody or antigen-binding portion thereof of any one of embodiments 198-201, wherein the cancer cell expresses Foxp3.
206. The CAR of any one of embodiments 99-118 or a composition comprising thereof for use in treating cancer in a subject.
207. The CAR of embodiment 206, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
208. The CAR of embodiment 206 or 207, wherein the subject is a human.
209. The CAR of any one of embodiments 206-208, wherein the subject receives an anticancer immunotherapy.
210. The CAR of any one of embodiments 206-209, wherein the cancer cell expresses Foxp3.
211. The bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for use in treating cancer in a subject.
212. The bispecific antibody of embodiment 211, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
213. The bispecific antibody of embodiment 211 or 212, wherein the subject is a human.
214. The bispecific antibody of any one of embodiments 211-213, wherein the subject receives an anticancer immunotherapy.
215. The bispecific antibody of any one of embodiments 211-214, wherein the cancer cell expresses Foxp3.
216. The immunoconjugate of embodiment 77 or 78 or a composition comprising thereof for use in treating cancer in a subject.
217. The immunoconjugate of embodiment 216, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
218. The immunoconjugate of embodiment 216 or 217, wherein the subject is a human.
219. The immunoconjugate of any one of embodiments 216-218, wherein the subject receives an anticancer immunotherapy.
220. The immunoconjugate of any one of embodiments 216-219, wherein the cancer cell expresses Foxp3.
221. A kit for treating cancer, comprising the antibody or antigen-binding portion thereof of any one of embodiments 1-75.
222. A kit for treating cancer, comprising the CAR of any one of embodiments 99-118.
223. A kit for treating cancer, comprising the bispecific antibody of any one of embodiments 80-83.
224. A kit for treating cancer, comprising the immunoconjugate of embodiment 77 or 78.
225. The kit of any one of embodiments 221-224, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
EXAMPLES
(559) The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the antibodies, bispecific antibodies, compositions comprising thereof, screening, and therapeutic methods of the presently disclosed subject matter, and are not intended to limit the scope of what the inventors regard as their presently disclosed subject matter. It is understood that various other embodiments may be practiced, given the general description provided above.
Example 1—TCR-Mimic Monoclonal Antibodies Specific for Fox3p-Derived Epitopes Introduction
(560) Effector T cell checkpoint blockade therapy has emerged as an effective therapy for several cancers by activating dormant or exhausted T cells to kill cancer cells in patients. Regulatory T cells (Tregs) expressing CD4, CD25 and Foxp3 are found abundantly in tumor tissues and are considered powerful inhibitors of anti-tumor immunity and a critical barrier to successful immunotherapy. Decreased ratios of CD8.sup.+ T cells to Tregs in tumor-infiltrating lymphocytes (TILs) is an indicator of poor prognosis in various human cancers. Depletion of Tregs has been shown to enhance spontaneous and vaccine-induced anti-tumor immune responses in animal models and in cancer patients in some cases. These studies demonstrate a prominent tumor-promoting role of Tregs in cancer and provide an opportunity for cancer immunotherapy in which modulation of Treg function could activate effector T cells to kill cancer cells.
(561) Although depletion of Tregs in patients with cancer has received intense interest, effective applications have been hampered because Tregs do not express a specific cell surface molecule which can be targeted by a mAb nor a selectively druggable intracytoplasmic pathway. Various strategies have been attempted for depletion or interference with Treg function, which typically have focused on targeting CD25 (the IL-2 receptor) using mAbs specific for CD25 (Daclizumab) and Dennileukin difitox, a fusion protein of IL-2 and diphtheria toxin. In addition, elimination of Tregs by a mAb to glucorticoid-induced TNF-related protein (GITR) and suppression of Treg function by use of anti-CTLA4 antibodies, disruption of tumor homing by T-regs, or modulation of T cell plasticity, have also been attempted. Clinical studies with various cancers, in which Daclizumab and Dennileukin difitox were combined with vaccines, have demonstrated conflicting results. These data could be best explained because CD25 and GITR are both expressed not only in Tregs, but also in activated CD4 and CD8 effector T cells. A potential benefit of Treg depletion by targeting these molecules could be lost by concurrently elimination of activated effector lymphocytes. Therefore, there is no additional clinical evidence supports the broader applicability of these approaches. A recent in vitro study showed that a mAb specific for C—C chemokine receptor-4 (CCR4) could selectively deplete effector Tregs expressing a higher level of Foxp3 resulting in augmentation of CD8 T cell response specific for the NY-ESO-1 peptide. A defucosylated, humanized anti-CCR4 mAb, Mogamulizumab, has been in clinical trials for various cancers. While the results await more studies, there are some data that showed complex results.sup.8-10. In addition to Tregs, CCR4 is known to be expressed on activated T cells, T helper 2, NK cells, macrophages and dendritic cells and the effects of the mAb could be complicated. Cyclophosamide has been shown to selectively suppress Tregs but the mechanisms are unknown. Cyclophosamide is well-known for its cytotoxicity to tumor cells and therefore, the clinical effects are difficult to attribute to only Treg depletion. Clearly, there is a great need for more specific approaches targeting Tregs and eliminating their suppressive function.
(562) Foxp3 has been identified as a key player in Treg function, and is the most definitive marker of CD4.sup.+CD25.sup.+ Tregs. It is required for Treg cell lineage differentiation, maintenance and importantly suppressive function. Apart from naturally occurring Tregs that arise in the thymus, inducible Treg cells have been identified, with predominance in infection and cancer. Interestingly, in addition to the critical role of Foxp3 in Tregs, many cancer cells also express Foxp3. Foxp3-expressing pancreatic carcinoma cells and cutaneous T cell lymphoma cells have been shown to suppress T cell proliferation. These studies suggest that cancer cells may share suppressive effects with Tregs, and that mimicking Treg function may represent a new mechanism of immune evasion in cancer.
(563) As such, there are no selective drugs that can deplete Tregs. Foxp3 would be an ideal target except that it is no druggable by small molecules and it is an intracellular protein so antibody therapy is not feasible. Theoretically, peptides from Foxp3 protein that are degraded and processed for cell surface presentation can serve as a target of a TCR recognition. In a melanoma mouse model, Nair et al vaccinated mice with dendritic cells (DCs) electroporated with Foxp3-encoding mRNA. The vaccination elicited Foxp3-specific CTL response leading to preferential depletion of Foxp3.sup.+ Tregs in tumors. Simultaneously vaccinate mice with well-defined TRP2 melanoma antigen (Ag) and Foxp3 enhanced the vaccine-induced protection against highly metastatic B6/F10.9 melanoma. Although no Foxp3-derived epitopes were identified in this study, it demonstrated the possibility of using T cell approach to target Foxp3 protein. Encouragingly, a recent in vitro human study has shown the results of identifying Foxp3-derived epitopes by human CD8 T cells in the context of HLA-A0201 molecule. Thus, a TCR-mimic mAb specific for Foxp3-derived epitopes should be able to specifically and directly deplete both Tregs and tumor cells expressing Foxp3 with double sword effects. Using a TCRm mAb, it was demonstrated that a TCRm mAb specific for human Foxp3, #32, can specifically binds and kill Foxp3-expressing Tregs and tumor cells. The depletion of Tregs should greatly unleash anti-tumor immunity by removing immunosuppression caused by both Tregs and tumor cells.
(564) Methods and Materials
(565) 1. Peptide Synthesis
(566) All peptides were purchased and synthesized by Genemed Synthesis, Inc. (San Antonio, Tex.). Peptides were sterile and 80% to >90% pure. The peptides were dissolved in DMSO and diluted in saline at 5 mg/mL and stored at −80° C. Control peptides used for HLA-A*02:01: Ewing sarcoma-derived peptide EW (QLQNPSYDK [SEQ ID NO:140]). Biotinylated single chain Foxp3p/HLA-A0201 complexes were synthesized by refolding the peptides with recombinant HLA-A*02 and beta2 microglobulin (β2M) at Eureka Therapeutics Inc. (Berkely, Calif.).
(567) 2. Cytokines, Antibodies and Cell Lines
(568) Human granulocyte-macrophage colony-stimulating factor (GM-CSF), interleukin (IL)-1β, IL-4, IL-6, IL-15, tumor necrosis factor (TNF)-α and prostaglandin E2 (PGE2) were purchased from R&D Systems (Minneapolis, Minn.). Beta 2-microglobulin (β2-m) and human IFN-γ were purchased from Sigma (St. Louis, Mo.). Cell isolation kits for CD14 and CD3 were purchased from Miltenyi Biotec. (Bergisch Gladbach, Germany). Human IL-2 and TGF-β were purchased from R&D Systems. Human Treg isolation kit was purchased from Stem cell Technology (Canada). Foxp-3.sup.+ and HLA-A*0201.sup.+ cutaneous T lymphoma cell lines MAC-1 and MAC-2A were kindly provided by Dr. Mad H. Anderson, at University of Denmark. TAP-deficient T2 cells, T leukemia cell line JURKAT, and tumor cells were HLA typed by the Laboratory of Cellular Immunology at Memorial Sloan-Kettering Cancer Center. The cell lines were cultured in RPMI 1640 supplemented with 5% to 10% FCS, penicillin, streptomycin, 2 mmol/1 glutamine, and 2-mercaptoethanol at 37 C/5% CO2. Cells were checked regularly for mycoplasma. Cell identities were confirmed by phenotype or genotype.
(569) Foxp3-#32 Fc-enhanced human IgG1, mouse IgG1, or BITE formats and their respect controls were produced by Eureka Therapeutics Inc. APC conjugation to mouse IgG1 form of #32 and its control was done by using lightening-link APC antibody labeling kit according to the instructions of the manufacturer (Novus Biologicals). Mabs against human HLA A*02 (clone BB7.2), its isotype control mouse IgG2b (clone MPC-11), human CD3 (clone HIT3A and OKT3), CD4 (clone RPA-T4), CD8 (clone RPA-T8). CD19 (clone HIB19), CD25 (clone 2A3), CD33 (clone WM53), CD45RA (clone HI100), mouse anti-His tag mAb (clone F24-796) conjugated to FITC or PE, were purchased from BD Biosciences, (San Diego, Calif.). Mabs specific for human Foxp3 clone PCH101, its isotype control rat IgG2a kappa, clone 236A/E7 and its isotype control mouse IgG1 kappa, CD4 (clone OKT4), CD14 (clone 61D3), CD127 (clone HIL-7R-M21), were purchased from eBioscience. Fixation and permeabilization kit for intracellular staining was also purchased from eBioscience. Luciferase substrate luciferine was purchased from Promega (Madison, Mich.).
(570) 3. In Vitro Stimulation and Human T-Cell Cultures
(571) While many sequences can be predicted by the algorithms, these models do not predict binding to MHC when tested on live cells in 30% of cases, so in vitro testing is necessary. In addition, even if binding is demonstrated, a cytotoxic T cell response may not occur, requiring additional in vitro study.
(572) After informed consent on Memorial Sloan-Kettering Cancer Center Institutional Review Board approved protocols, peripheral blood mononuclear cells (PBMC) from HLA-A*24:02 healthy donors were obtained by Ficoll density centrifugation. CD14.sup.+ monocytes were isolated by positive selection using mAb to human CD14 coupled with magnetic beads and were used for the first stimulation of T cells. The CD14.sup.− fraction of PBMC was used for isolation of CD3, by negative immunomagnetic cell separation using a pan T cell isolation kit. The purity of the cells was always more than 98%. T cells were stimulated for 7 days in the presence of RPMI 1640 supplemented with 5% autologous plasma (AP), 20 ug/mL synthetic peptides, 2 ug/mL (32-m, and 5-10 ng/mL IL-15. Monocyte-derived dendritic cells (DCs) were generated from CD14.sup.+ cells, by culturing the cells in RPMI 1640 medium supplemented with 1% AP, 500 units/mL recombinant IL-4, and 1,000 units/mL GM-CSF. On days 2 and 4 of incubation, fresh medium with IL-4 and GM-CSF was either added or replaced half of the culture medium. On day 5, 20 ug/mL class II peptide was added to the immature DCs. On day 6, maturation cytokine cocktail was added (IL-4, GM-CSF, 500 IU/mL IL-1, 1,000 IU/mL IL-6, 10 ng/ml TNF-α, and 1 ug/mL PGE-2). On day 7 or 8, T cells were re-stimulated with mature DCs at a 30:1, T:APC ratio, with IL-15. T cells were stimulated 3 to 5 times in the same manner, using either autologous DCs or CD14.sup.+ cells as antigen-presenting cells (APCs). A week after final stimulation, the peptide-specific T cell response was examined by IFN-γ enzyme-linked immunospot (ELISPOT) assay.
(573) 4. IFN-γ ELISPOT Assay Measuring Peptide-Specific T Cell Response
(574) HA-Multiscreen plates (Millipore) were coated with 100 uL of mouse anti-human IFN-γ antibody (10 μg/mL; clone 1-D1K; Mabtech) in PBS, incubated overnight at 4° C., washed with PBS to remove unbound antibody, and blocked with RPMI 1640/10% autologous plasma (AP) for 2 h at 37° C. CD3.sup.+ T cells were plated with either autologous CD14.sup.+ (10:1 E: APC ratio) or autologous DCs (30:1 E: APC ratio). Various test peptides were added to the wells at 20 μg/mL. Negative control wells contained APCs and T cells without peptides or with irrelevant peptides. Positive control wells contained T cells plus APCs plus 20 ug/ml phytohemagglutinin (PHA, Sigma). All conditions were done in triplicates. Microtiter plates were incubated for 20 h at 37° C. and then extensively washed with PBS/0.05% Tween® (polyoxyethylenesorbitan monolaurate) and 100 μl/well biotinylated detection antibody against human IFN-γ (2 μg/mL; clone 7-B6-1; Mabtech) was added. Plates were incubated for an additional 2 h at 37° C. and spot development was done as described (12, 13). Spot numbers were automatically determined with the use of a computer-assisted video image analyzer with KS ELISPOT 4.0 software (Carl Zeiss Vision).
(575) 5. .sup.51Chromium Release Assay.
(576) The presence of specific CTLs was measured in a standard chromium release assay as described (12, 13). Briefly, target cells alone, or pulsed with 50 μg/mL of synthetic peptides for 2 hours (in some cases for over night) at 37° C., are labeled with 50 uCi/million cells of Na.sub.2.sup.51CrO.sub.4 (NEN Life Science Products, Inc.). After extensive washing, target cells are incubated with T cells at various E: T ratios. All conditions were done in triplicates. Plates were incubated for 4-5 hrs at 37° C. in 5% CO2. Supernatant fluids were harvested and radioactivity was measured in a gamma counter. Percentage specific lysis was determined from the following formula: [(experimental release−spontaneous release)/(maximum release−spontaneous release)]×100%. Maximum release was determined by lysis of radiolabeled targets in 1% SDS.sup.12,13.
(577) 6. Treg Generation.
(578) CD4.sup.+ T cells or CD4.sup.+CD25.sup.+ T cells were purified from PBMCs by FACS sorting, and were stimulated with allo-PBMCs as stimulator/feeder cells at ratios of effector: stimulator (E:S) 10-20:1, in the presence of recombinant human IL-1 (100 unit) and TGF-β (long/ml) for a week and the same stimulation was repeated in a weekly basis to maintain the Treg cells. The phenotype of Treg was determined by surface staining of the cells with mAbs to CD4, CD25.sup.+ and intracellular staining with foxp3. In certain embodiments, the mAb #32 (EXT017-32) was conjugated to APC and the specific recognition of the Treg cells was determined by binding of the mAb to the CD4.sup.+CD25.sup.+ Foxp3.sup.+ cell population.
(579) 7. Phage Screening, Selection and Characterization of scFv Specific for Foxp3 Derived Epitopes
(580) A human ScFv antibody phage display library (7×1010 clones) was used for the selection of mAb clones as described previously.sup.18. In brief, biotinylated irrelevant peptide/HLA-A0201 complexes were used to remove any clones that potentially bind to HLA-A0201. Remaining clones were screened for the Foxp3p/HLA-A0201 complex. The selected clones were enriched by 3-4 rounds of panning processes. Positive clones were determined by standard ELISA method against biotinylated single chain Foxp3/HLA-A*0201 complexes.
(581) The positive scFv clones were further tested for their binding to HLA-A2/peptide complexes on live cell surfaces by indirect flow cytometry on: (i) a TAP deficient HLA-A*02:01.sup.+ cell line, T2, that are defective in presentation of endogenous HLA-associated peptides. T2 cells were pulsed with Foxp3 peptides or irrelevant peptide; (ii) Foxp3.sup.+ HLA-A*02:01.sup.+ cell lines such as MAC-1, MAC-2A and control cell lines Jurkat (HLA-A02.sup.−), without pulsing with the peptide. The latter determine the recognition and binding affinity of the scFv to the naturally processed Foxp3-7p/A2 complex on tumor cells.
(582) A total of 21 phage clones for Foxp3-7, 8 phage clones for Foxp3-2 and 3 phage clones for Foxp3-4 were screened for their ability to produce mAb specific for their respective Foxp3 peptide/A2 complex. The recognition of the Foxp3/A2 complex on live cells was measured by the binding of the phage scFv to T2 cells pulsed with the Foxp3 peptides and the other HLA-A2-binding peptides (50 ug/ml) in the serum-free RPMI1640 medium, in the presence of 20 ug/ml 132M overnight. These include: T2 cells alone; T2 cells pulsed with Foxp3-7, -2 or -3 peptides; T2 cells pulsed with HLA-A2-binding irrelevant EW or RHAMM 3(R3) peptide. The cells in the above groups were washed, then stained with 3 steps:
(583) Step 1: Phage staining: T2 cell suspensions (10 μl) were incubated with puried scFv phage clones, 90 μl, on ice, 60 minutes, followed by a wash.
(584) Step 2: Mouse mAb against M13 coat protein (1 mg/ml) at 1:100 dilution, on ice, 30 minutes, then washed.
(585) Step 3: Goat (Fab)2 anti-mouse Ig conjugated to FITC or PE (1:100 dilution), on ice, 30 minutes, then wash.
(586) The cells were washed twice between each step of the staining. Controls for flow cytometry included: Unstained cells and cells stained with only goat anti-mouse Ig (Fab)/FITC or PE.
(587) 8. Construction, Expression and Purification of Foxp3-BITE
(588) Foxp3-#32 BITE was engineered as previously described.sup.19. N-terminal end of mAb #32 scFv was linked to the C-terminal end of an anti-human CD3E scFv of a mouse monoclonal antibody by a flexible linker. The DNA fragments encoding for the scFv of two mAbs were synthesized by GeneArt (InVitrogen) and subcloned into Eureka's mammalian expression vector pGSN-Hyg using standard DNA technology. A hexahistamine (His) tag (SEQ ID NO: 143) was inserted downstream of the #32 BITE at the C-terminal end for the detection and purification of the BITE.
(589) Chinese hamster ovary (CHO) cells were transfected with the Foxp3-BITE expression vector and stable expression was achieved by standard drug selection with methionine sulfoximine (MSX), a glutamine synthetase (GS)-based method. CHO cell supernatants containing secreted Foxp3-BITE molecules were collected. Foxp3-#32BITE was purified using HisTrap HP column (GE healthcare) by FPLC AKTA system. Briefly, CHO cell culture was clarified and loaded onto the column with low imidazole concentration (20 mM), and then an isocratic high imidazole concentration elution buffer (500 mM) was used to elute the bound Foxp3-BITE protein. A negative control BITE antibody, was constructed from an irrelevant human IgG1 antibody (Cat #ET901, Eureka Therapeutics,) replacing Fox3-#32 scFv.
(590) 9. Treg Generation, Phenotypic Analysis and Foxp3-#32 mAb Binding
(591) CD4.sup.+ T cells were purified from PBMCs of healthy HLA-A*0201 positive donors by FACS sorting, and were stimulated with allo-PBMCs (HLA-A*0201 negative) as stimulator/feeder cells at ratios of effector: stimulator (E:S) 1:5-10, or with tumor cells in the presence of recombinant human IL-2 (100 unit) and TGF-β (10 ng/ml) for one to two weeks and the same stimulation was repeated to maintain the Treg cells.sup.15-17. The phenotype of Tregs was determined by surface staining of the cells with mAbs to CD4, CD25.sup.+, CD127, Foxp3 mAb #32 conjugated to APC, for 30 minutes on ice, washed. Foxp3 expression was measured by intracellular protein staining using mAb to human Foxp3 and Cytofix/CytoPerm kit (eBiosciences), according to the instructions of the manufacture. Analysis was done by flow cytometry on a Beckman Dickinson Fortesa.
(592) 10. SvFv Bi-Specific Antibody (BsAb) Constructs Mediated T Cell Cytotoxicity Against and Treg Cells in the Context of HLA-A*0201
(593) Two methods were used to measure the killing of Tregs by Foxp3 #32 BITE. Since natural Tregs only represent a few percentage of CD4.sup.+ T cells, and therefore, in order to obtain sufficient readout on Treg killing, in vitro-generated Tregs were used as targets and the killing of Tregs was determined by reduction of Treg population by flow cytometry. In brief, purified CD3 T cells by negative selection from HLA-A*02:01 negative donor (effectors) were incubated with Treg cells from HLA-A*02:01.sup.+ donor at an E: T ratio 5:1, in the presence or absence of specific BsAb (also referred to as “BITE”) construct (1 ug/ml) (e.g., BsAb-#32) or its control BsAb overnight. The cells were washed and stained with mAbs to CD4, CD25, foxp3 and HLA-A02. HLA-A2.sup.+ cells were gated (Tregs as target) and the killing of Tregs was determined by the reduction of percentage of CD4.sup.+CD25.sup.+ Foxp3.sup.+ cells in the HLA-A*0201.sup.+ cells, compared to control cultures with effectors alone or with effectors plus control BITE. In addition, Treg-like T lymphoma cell lines MAC-1 and MAC-2A (Foxp3.sup.+/HLAA*0201.sup.+) were used as targets in ADCC assay by a standard .sup.51Cr-release assay.
(594) 11. Antibody-Dependent Cellular Cytotoxicity (ADCC)
(595) Target cells used for ADCC were T2 cells pulsed with or without Foxp3-TLI peptide or EW control peptide, and Foxp3.sup.+ MAC-1 and MAC2A cell lines without peptide pulsing (see list in above “Cytokines, antibodies and cell lines” section). The Foxp3 #32 Fc-enhanced IgG1 or its isotype control, at various concentrations were incubated with target cells and fresh PBMCs at different effector: target (E:T) ratio for 4-5 hrs. Cytotoxicity was measured by standard .sup.51Cr-release assay.
(596) Results
(597) The present study targets Foxp3 positive cells selectively by use of a T cell receptor mimic (TCRm) mAb, named mAb #32, which recognizes a human Foxp3-derived CD8 T cell epitope, presented by HLA-A*0201 molecules on the cell surface. The results show that mAb #32 specifically bound to CD4.sup.+CD25.sup.highCD127.sup.1′Foxp3.sup.+ Treg cells from HLA-A*0201 positive donors, and tumor cell lines co-expressing Foxp3 and HLA-A*0201. Both afucosylated Fc enhanced human IgG1 and bispecific T cell engager formats of the Foxp3 mAb are able to kill in vitro generated Treg clones from HLA-A0201.sup.+ donos and “Treg-like” cutaneous lymphoma cells (HLA-A*02:01.sup.+) that have a high level expression of CD4, CD25 and Fox3.sup.+. This TCRm mAb may allow another approach to immunotherapy of human cancers or for other settings in which selective immune-stimulation is warranted. In addition, Fox3-targeting antibodies could be a novel approach in cancer immunotherapy by overcoming immunosuppresion caused by T-regs and tumor cells expressing Foxp3.
(598) 1. Selection of Foxp3-Derived Epitopes in the Context of HLA-A*0201
(599) Unlike other well-defined epitopes derived from tumor antigens such as WT1, there has been little information on the epitopes derived from Foxp-3 that induces T cell responses. Therefore, the immunogenic epitopes that can generate cytotoxic CD8 T cells against Foxp3 were first identified. The entire human Foxp3 protein sequence was screened using three computer-based predictive algorithms BIMAS (bimas.cit.nih.gov), SYFPEITHI (syfpeithi.de) and RANKPEP (bio.dfci.harvard.edu). The potential epitopes derived from human Foxp3 for CD8 T cells in the context of HLA-A*02:01 molecule (Foxp3-1 having an amino acid sequence set forth in SEQ ID NO:2, Foxp3-2 having an amino acid sequence set forth in SEQ ID NO:3, Foxp3-3 having an amino acid sequence set forth in SEQ ID NO:4, Foxp3-4 having an amino acid sequence set forth in SEQ ID NO:5, Foxp3-5 having an amino acid sequence set forth in SEQ ID NO:6, Foxp3-6 having an amino acid sequence set forth in SEQ ID NO:7, and Foxp3-7 having an amino acid sequence set forth in SEQ ID NO: 8) were selected to test if these peptides are able to induce specific CD8 T cell response from HLA-A*02:01.sup.+ donors. Importantly, all the selected HLA-A*0201-binding peptides were predicted to be cleaved at C-terminal, suggesting a higher probability of being processed by proteosomes.
(600) 2. Peptide-Specific T Cell Response in the Context of HLA-A*02:01 Molecule
(601) While many sequences can be predicted by the algorithms, these models do not predict binding to MHC when tested on live cells in some cases, so in vitro testing is necessary. In addition, even if binding is demonstrated, a cytotoxic T cell response may not occur, requiring additional in vitro study. A number of Foxp-3-derived peptides were selected to test if they were able to stimulate CD8 T cell response from HLA-HLA-A*0201.sup.+ donors. After testing T cell responses from multiple donors with multiple peptides derived from human Foxp3, Foxp3-7 (amino acid sequence set forth in SEQ ID NO: 8) was selected for further study. Interestingly, this peptide has also been shown to induce strong peptide-specific CD8 T cellresponse which recognizes Foxp3.sup.+/HLA-A*0201.sup.+ cutaneous T lymphoma cells .sup.14.
(602) CD3 T cells from multiple donors were stimulated with Foxp3-derived peptides for 3-5 rounds and the peptide-specific T cell response was measured by IFN-γ elispot assay and .sup.51Cr-release assays. All the peptides, except for Foxp3-3 peptide, induced peptide-specific T cell response in multiple HAL-A*02:01.sup.+ donors.
(603) T cells stimulated with Foxp3-1 to 6 peptides elicited peptide-specific response against only the stimulating peptides, but not other peptides, nor the controls including CD14.sup.+ antigen-presenting cells (APCs) or APCs pulsed with irrelevant peptide EW without Peptides (
(604) To test if the peptide-induced T cells can recognize naturally processed Foxp3 epitopes, T cell lymphoma cell lines MAC-1 and MAC2A that are Foxp3 and HLA-A*02:01.sup.+ (
(605) Peptide-specific T cell cytotoxicity of Foxp3-derived peptides Foxp3-1, -2, -4, -5, -6 and -7 was also studied. CD3 T cells from a HLA-A*02:01.sup.+ donor were stimulated with Foxp3-derived peptides Foxp3-1, -2, -4, -5, -6 or -7 and the cytotoxicity against the stimulating peptides on T2 cells was measured by .sup.51Cr-release assay. As shown in
(606) Additional experiments on Foxp3-7 (also denoted as TLI peptide or Foxp3-TLI peptide) shows that after four rounds of stimulation, T cells only recognize autologous CD14.sup.+ monocytes pulsed with TLI peptide, but not CD14.sup.+ APC alone or pulsed with an irrelevant HLA-A*0201-binding peptide EW, by IFN-γ elispot assay (
(607) 3. Generation of TCR-Mimic mAbs for the Foxp3 Peptides in the Context of HLA-A*02: 01 Molecule Using Phage Display Technology
(608) A total of 21 phage clones for Foxp3-7, 8 phage clones for Foxp3-2 (
(609) In particular, for Foxp3-7, by confirming that Foxp3-TLI peptide is able to induce epitope-specific T cell response which recognizes tumor cells expressing Foxp3 protein, a TCRm mAb specific for the TLI/HLA-A*0201 complex was generated, by using phage display technology as previously described.sup.18. In brief, single phage clones specific for the TLIp/A2 complex selected by screening of a phage library were further validated by ELISA. The selected clones were tested for their binding to live cells using T2 cells. Any clones that showed binding to T2 cells without the TLI peptide or with HLA-A*0201-binding irrelevant peptides were removed. After 5 rounds of screening, based on binding specificity to T2 cells pulsed with TLI peptide and live cells that express foxp3 and HLA-A*0201, eight scFv clones were selected for engineering into either full-length human IgG1 or bispecific T cell-engager mAb (T-BITE) for further characterization. For Foxp3-7: Clone #32, 17, 28, 54, 18, 53, 27, 20
4. Characterization of BsAbs Specific for Foxp3-7/HLA-A*02:01 Complex
(610) Mab killing functions can be enhanced in multiple ways. As a strategy to bring T cell cytotoxicity to the targets, eight bi-specific T cell engager constructs of the mAbs specific for the Foxp3-7 peptide/HLA-A2 complex were generated. The binding of the 8 BsAb (also referred to as “BITE”) constructs specific for the Foxp3-7/HLA-A2 complex was tested on T2 cells pulsed with or without Foxp3-7 or irrelevant peptide and also on unpulsed T lymphoma cells MAC-1, MAC-2A and Jurkat cells.
(611) As shown in
(612) The specificity of the Foxp3-#32 mAb was further analyzed by use of binding of Foxp3-#32 BITE to T2 cells containing analog TLI peptides. TLI peptide was substituted with alanine at positionl, 2, 3, 4, 5, 7 and 8, or with glycine at position 10. Position 6 was already alanine and it was left intact. The mutant peptides were loaded onto T2 cells and tested for Foxp3-BITE binding. Alanine or glycine substitution at position 2, 8, 9 or 10 reduced the binding of foxp3-BITE, as compared to the native TLI peptide (
(613) 5. Recognition of Foxp3-#32 mAb of Human Tregs and Tumor Cells Expressing Foxp3 and HLA-A*0201.
(614) Although the Foxp3 mAb has demonstrated excellent specificity of binding to T2 cells pulsed with TLI peptide, it is crucial to test if the TLI epitope is processed and presented by HLA-A*0201 molecule in naturally occurring Tregs and induciable Tregs. A comparison was done on Foxp3 #32 mAb binding to Trges from HLA-A*0201 positive or negative PBMCs from healthy donors. CD4.sup.+ T cells were gated on CD25 high and CD127.sup.low population, a characteristics of natural Tregs. Mab-#32 mAb showed a significant shift on this population compared to its isotype control in HLA-A*0201.sup.+ donor (
(615) Next, to test if the #32 mAb also recognize inducible Tregs, Treg cell lines were generated by stimulating purified CD4.sup.+T cells from a HLA-A0201.sup.+ donors with either allo-PBMCs (HLA-A*0201 negative) or tumor cells MAC-2A in the presence of IL-2 and TGF-β.sup.15-17. A typical staining pattern is shown in
(616) It has been shown that may types of human cancer cells express Foxp3, which is associated with poor prognosis and distant metastasis. Therefor, the Foxp3 mAb could also directly attack tumor cells, expressing Foxp3.
(617) 6. Mab-#32 BITE-Mediated T Cell Cytotoxicity Against Foxp3.sup.+ Tregs and Tumor Cells in the Context of HLA-A*0201
(618) Experiments were done to test whether mAb-#32 BITE was able to mediate T cell killing against Foxp3 TLI epitope in the context of HLA-A*0201 molecule. PBMCs were used as effectors and the cytotoxicity was measured by standard .sup.51Cr-release assay, in the presence or absence of the #32 BsAb and isotype-derived control BsAb. T2 cells were pulsed with TLI or control HLA-A0*201-binding peptide CT, and PBMCs were used as effectors, in the presence or absence of the mAb #32-BITE or isotype-derived control BITE. Mab-#32 BITE mediated a specific and strong killing activity against T2 cells pulsed with TLI peptide, but not T2 cells alone or pulsed with control peptide (
(619) Since Treg population in healthy PBMCs might be too low to measure the cytotoxicity mediated by the BITE, Treg clones were generated from HLA-A0201.sup.+ donor by allo-stimulation, followed by limiting dilution. Two different Treg clones were incubated with PBMCs from HLA-A*02-negative donor, in the presence or absence of Foxp3-BITE or control BITE for overnight. Then the percentage of Foxp3.sup.+ cells in HLA-A*0201 T cells population (only from Treg clones) was measured by flow cytometry. Reduction of the HLA-A*02.sup.+ Foxp3.sup.+ cells indicates the Foxp3-BITE-mediated T cell killing.
(620) These results demonstrated that the #32-BITE is able to recognize and mediates T cell cytotoxicity against Tregs in the context of HLA-A*0201 molecule.
(621) 7. Binding Affinity of the EXT017 Antibodies to Foxp3 Peptide/HLA-A*02:01 Complex
(622) The 8 EXT017-BsAbs were evaluated for binding affinity to EXT017 peptide/HLA-A*02:01 complex using biolayer interferometry (BLI), and the results are shown in Table 5.
(623) TABLE-US-00013 TABLE 5 Error in Antibody k.sub.d [1/s] k.sub.d [1/s] k.sub.a [1/Ms] K.sub.D [nM] EXT-017-17 BsAb 2.63E−3 5.46E−5 1.84E7 144 EXT-017-18 BsAb 1.88E−3 6.79E−5 5.31E7 35.4 EXT-017-20 BsAb 1.75E−3 4.84E−5 7.90E6 221 EXT-017-27 BsAb 2.08E−3 7.06E−5 4.28E7 48.5 EXT-017-28 BsAb 1.89E−3 6.79E−5 1.00E7 188 EXT-017-32 BsAb 2.27E−3 6.26E−5 3.15E7 72.2 EXT-017-53 BsAb 2.35E−3 6.98E−5 4.84E7 48.6 EXT-017-54 BsAb 1.05E−3 9.41E−5 3.19E7 32.9
(624) The binding affinity of the EXT017-32-hIgG1 and mIgG1 to EXT017 peptide/HLA-A*02:01 complex was measured using surface plasmon resonance (SPR), and the results are shown in Table 6.
(625) TABLE-US-00014 TABLE 6 Antibody k.sub.d [1/s] k.sub.a [1/Ms] K.sub.D [nM] EXT017-32 mIgG 1.12E.sup.+07 0.005167 0.462 EXT017-32 hIgG 5.97E.sup.+07 0.01222 0.205
DISCUSSION
(626) Development of therapeutic strategies to deplete or interfere with the function of Tregs, without compromising anti-tumor immunity has been challenging, because there is no Treg-specific surface marker. One of the obstacle for specific depletion of Tregs is that both Tregs and effector T cells exhibit an activated phenotype, especially in expression patterns of cell surface molecules; both are high in CD25, cytotoxic T lymphocyte-associated antigens (CTLA)-4, OX40 and glucocorticoid-induced tumor necrosis factor receptor-related protein (GITR) expression. Depletion of Tregs alone or in combination of vaccination by anti-CD25 mAb has been shown to contribute to improved anti-tumor immune response in various animal models. However, clinically, targeting CD25 by using dacizumab (anti-CD25 mAb) or Denileukin diftitox, a recombinant protein composed of IL-2 and the active domain of diphtheria toxin, has shown less promising outcome. Although Tregs express CTLA-4, results from clinical studies suggest that the effects of anti-CTLA-4 treatment is due to increased activation of effector T cells, or there is a Treg-depletion effect early after initial administration which permits the optimal induction of effector cell responses. Most recently, Sakaguchi group has shown that C—C chemokine receptor 4 (CCR4) is predominantly expressed in effector Tregs (eTregs; CD45RA-Foxp3.sup.hi CD4.sup.+) in TILs in melanoma patients. In vitro depletion of this population using anti-CCR4 mAb enhanced T cell responses when stimulated with NY-ESO-1 peptides. When the mAb was administered to a patient with T cell leukemia-lymphoma, the eTreg fraction is reduced and NY-ESO-1-specific CD8 T cell response is augmented. CCR-4 is the cognate receptor for CC chemokines CCL17 and CC122, and is expressed on functionally distinct subsets of immune cells. In addition to Tregs, it is also expressed in activated T cells, Th2 cells, platelets, NK cells, macrophages and dendritic cells (DCs). Similarly, targeting GITR using cognate ligand or agonistic mAb has been shown to be effective in anti-tumor response in murine models. However, the clinical efficacy of such strategy remains to be investigated in human trials.
(627) Foxp3 is a transcription factor in the forkhead/winged-helix family and is predominantly found in CD4.sup.+CD25.sup.+ Treg cells, consisting of 2% to 5% of the total
(628) CD4.sup.+ T cell population, but significantly enriched in the tumor mass, peripheral blood or ascites in cancer patients. Tumor cells not only recruit Tregs to tumor sites but also play a crucial role in the conversion of naïve and or effector T cells into Tregs by providing antigenic stimulation and cytokines directly or indirectly through tumor-infiltrating lymphocytes (TILs). In TILs, the ratio of effector T cells to Tregs determines disease outcome. There exists a strong correlation between tumor progress and Tregs, with increased numbers or frequency of Tregs associated with poor prognosis in a variety of cancers, including ovarian, breast, non-small cell lung, hepatocellular, renal cell, pancreatic and gastric carcinomas.sup.1-7. Although the precise mechanisms of Treg-mediated immune suppression is not fully understood, Tregs can act in part by secreting immunosuppressive cytokines and suppressing the activation and proliferation of T cells in a cell contact-dependent mechanism. In Tregs, the most important function of Foxp3 is that its ectopic expression in normal T cells can convert them to Treg-like cells functionally and phenotypically. Therefore, Foxp3 has been considered to be a master regulatory gene for lineage-commitment and developmental differentiation of Tregs.
(629) Interestingly, immunosuppressive function of Foxp3 is not only limited in Tregs. Hinz et al have reported that Foxp3 expression was detected in majority of pancreatic cancer patients. Ectopic expression of Foxp3 in pancreatic adenocarcinoma cells induced complete inhibition of T cell proliferation in vitro, and this effect was partially abrogated by silencing Foxp3 gene expression using siRNA. The authors suggested that pancreatic cancer cells expressing Foxp3 mimic Treg function, which may represent a new mechanism of immune evasion in cancer patients. Immune suppressive function of Foxp3 has also been suggested in adult T leukemia (ATL) patients who are characterized by constitutive expression of CD4 and CD25 in leukemic cells and marked immune-deficient state. Subsequently, there have been numerous reports that many types of cancer cells express Foxp3, further support the important role of Foxp3 in tumor suppressive microenvironment.
(630) Foxp3 has long been considered the most definitive marker for Tregs, and is an attractive target. However, there are no drugs or mAbs that inhibit Foxp3, because the protein is intracellular, inaccessible to traditional antibody therapy. While it is intracellular, certain proteasome-processed FOXp3 peptides can be expressed on the cell surface when presented by MHC class I molecules, to be recognized by CD8 T cells. Indeed, Anderson group has demonstrated that Foxp3-specific cytotoxic CD8 T cells are present in human PBMCs, especially in cancer patients. Such CTLs are able to recognize Tregs and kill malignant Treg-like cutaneous T lymphoma cells in a HLA-A*0201-restricted manner. The study has thus demonstrated the possibility of targeting intracellular Foxp3 by an approach of using peptide-specific CTLs. A novel approach in the instant application has been taken to develop a T cell receptor mimic mAb (TCRm), specific for the Foxp3 peptide in the context of HLA-A*02:01. A number of peptides were identified from Fopx3 protein that could induce specific CD8 T cell response in the context of HLA-A*0201 molecule. Because Foxp3 is a member of the large forkhead protein family, to avoid potential off targets, the peptide TLI was selected for mAb engineering, which has a minimal homology with other Foxp family members, such as Foxp1, 2 and 4. The mAb was successfully generated and is able to specifically bind to and kill Foxp3 positive cancer cell lines and Treg cells.
(631) It is known that activated conventional T cells can transiently express Foxp3. However, activated CD4.sup.+CD25.sup.+ T cells and Tregs, can be distinguished by the expression of CD127, the alpha chain of IL-7 receptor. Tregs express low CD127 but activated T cells express high CD127. The TCRm Foxp3-#32 only bound to CD127 low CD25 high, Foxp3 high population of CD4.sup.+ T cells in HLA-A*0201.sup.+ healthy donors. When in vitro-induced Tregs were tested, the Foxp3 mAb only bound to CD4.sup.+CD25hi population but not to CD25lo/negative population. In general, TCRm mAb recognizes a low density peptide/HLA complex, and low expression of either targeted proteins or HLA would be difficult for such a mAb to have effective recognition. Therefore, a Foxp3 TCRm mAb would only bind to the cells highly expressing Foxp3. In addition, in tumor microenvironment, T cells are profoundly in an inactivated state and CD25hiFoxp3hiCD4 T cells are most likely Tregs. This opens a therapeutic window of designing an effective combination therapies by depleting Treg first using the Foxp3-#32 mAb, followed by strategies that expand effector T cells or augment their effector activity, using approaches such as vaccination or check point blockade. Such strategy could avoid cocominatant depletion of Tregs and activated T cells, whereby achieving selective and more effective therapeutic outcome.
Example 2-Peptide Epitope Mapping for Foxp3-7 Top Phage Clones
(632) Epitope mapping of the 8 EXT017 antibodies against Foxp3-7 peptide was performed to determine the epitope necessary for antibody binding. Briefly, mutant EXT017 peptides were generated with alanine substitutions at positions 1-9 and these were individually pulsed onto the surface of T2 cells. Peptide-loaded T2 cells were stained with EXT017-phage and binding was measured by flow cytometry. Table 7 lists the mutant EXT017 amino acid sequences used in the experiment. Table 8 summarizes the Mean Fluorescence Intensity (MFI) values of EXT017-phage FACS staining towards T2 cells loaded with the panel of alanine mutants shown in Table 7. As shown in Table 8, EXT017-mut2 was for anchor position. The histograms of the 8 EXT017-phage binding to T2 cells loaded with the panel of alanine mutants are shown in
(633) TABLE-US-00015 TABLE 7 EXT017: TLIRWAILEA 017-mut1: ALIRWAILEA 017-mut2: TAIRWAILEA 017-mut3: TLARWAILEA 017-mut4: TLIAWAILEA 017-mut5: TLIRAAILEA 017-mut7: TLIRWAALEA 017-mut8: TLIRWAIAEA 017-mut9: TLIRWAILAA G10: TLIRWAILEG
(634) TABLE-US-00016 TABLE 8 Phage 017- 017- 017- 017- 017- 017- 017- 017- Sensitive Clone T2 EXT017 mut1 mut2 mut3 mut4 mut5 mut7 mut8 mut9 Position EXT017- 92.9 2.36E+04 7884 99.8* 741 103* 98.1* 97.8* 3587 94.7* 4, 5, 7, 9 17 EXT017- 90.6 2.59E+04 143* 97.3* 5152 99.1* 95.8* 95.4* 6603 386* 1, 4, 5, 7, 9 18 EXT017- 91.3 1.71E+04 4074 96* 96.4* 93.7* 95* 94.9* 1.11E+04 95.6* 3, 4, 5, 7, 9 20 EXT017- 90.4 2.12E+04 222* 98.2* 2257 99* 95.4* 96.3* 6405 131* 1, 4, 5, 7, 9 27 EXT017- 93.9 3.95E+04 2.01E+04 102* 1.34E+04 108* 107* 96.4* 2.75E+04 5891 4, 5, 7 28 EXT017- 91.8 2.75E+04 1.51E+04 103* 2.10E+04 2.08E+04 2713 99.6* 96.7* 93.6* 7, 8, 9 32 EXT017- 89.5 2.58E+04 1102 95.3* 5779 95.8* 98.5* 98.9* 1.21E+04 149* 4, 5, 7, 9 53 EXT017- 89.9 3.04E+04 2.35E+04 94.7* 7776 374* 91.2 91.1* 5846 3535 4, 5, 7 54
(635) Positions affecting antibody binding (binding MFI<20% of the wildtype peptide) are marked with *.
Example 3—CAR T Cell Targeting Foxp3
(636) Adoptive transfer of CAR T cells has emerged as an effective therapy for B-cell ALL and other hematopoietic cancers. However, greater potency and mechanisms to defeat the immunosuppressive tumor microenvironment are still needed for many cancer types. One approach is to overcome tumor resistance by modifying CAR T cells to constitutively express a therapeutic TCRm CAR that can kill Treg cells, preferentially in the vicinity of the antigen directed CAR T cells. A T-cell receptor-mimic (TCRm) CAR that is reactive to a peptide fragment of Foxp3 is generated, that can kill Foxp3 expressed on the surface of the Treg cells and tumor cells in the context of HLA-A*02:01. T cells are modified to express this Foxp3-targeted CAR.
(637) Generation of Retroviral Constructs and Transduction
(638) A presently disclosed Foxp3 scFv sequence is used to generate a second generation CAR targeting Foxp3. The variable heavy and light chains (connected with a (Gly.sub.4Ser).sub.3 linker) and a c-myc tag are added to allow detect CAR expression by flow cytometry. The CAR is optimized to include a spacer domain upstream of the CD28 transmembrane domain if required. This is cloned into the SFG retroviral vector containing the CD28 and CD3 zeta or 4-1BB or other similar signaling CAR forms that are well known in the art, e.g., Park (2016). Stable 293 viral producing cell lines are generated, and used to transduce primary human T cells as described previously (Rafiq (2017)). Following transduction, CAR expression is verified by flow cytometry, staining for the c-myc tag incorporated into the Foxp3-CAR. Retroviral transduction of primary human T cells has been previously described (Koneru (2015)).
(639) Characterizing the Specificity and Activity of the Foxp3 CAR In Vitro and In Vivo.
(640) The ability of the Foxp3-CAR to redirect T cell function is analyzed in vitro by detecting the Foxp3-specific cytotoxicity, cytokine secretion and proliferative function of PR20-transduced T cells, as previously described (Rafiq (2017)). Specific cytotoxicity is measured using a standard .sup.51Chromium release assay against Tregs from HLA-A0201.sup.+ donors or Foxp3.sup.+ HLA-A*0201 positive or negative tumor cell lines. Specific cytokine secretion is measured by collecting supernatant from 24 hr cocultures of Foxp3T cells and Foxp3.sup.+ or Foxp3.sup.− cells. The presence of cytokines is analyzed using Luminex technology. The ability of the foxp3 CAR to stimulate T cell proliferation is analyzed by coculturing transduced T cells with Foxp3.sup.+ tumor cells and monitoring T cell expansion with flow cytometry using enumeration beads. T cells transduced to express a CAR targeted to an irrelevant antigen will be used as a control, as published previously (Rafiq (2017)).
(641) Characterizing the Anti-Tumor Efficacy of the Foxp3 CAR In Vivo.
(642) The ability of Foxp3-CAR T cells to eradicate Foxp3.sup.+ tumor in vivo is assessed using preclinical xenogeneic murine models. SCID-Beige or NSG mice is inoculated (either systemically for hematological malignancies, or intraperitoneally for solid tumors) with tumor cells modified to express FireFly Luciferace (FFLuc) to allow bioluminescent imaging (Rafiq (2017)). Mice are subsequently treated with systemic infusion of foxp3− or control CAR T cells (expressing a CAR targeted to an irrelevant antigen). Disease progression is monitored both clinically and with bioluminescent imaging as described previously (Rafiq (2017)). Persistence of CART cells is determined by collecting peripheral blood from treated mice and flow cytometry to detect CAR.sup.+ T cells. CAR function over time is determined by detection of cytokines in the serum of treated mice using Luminex technology.
(643) Various patents and publications are cited herein, the contents of which are hereby incorporated by reference in their entireties.
REFERENCES
(644) 1. Wolf A M, Wolf D, Steurer M et al. Increase of regulatory T cells in the peripheral blood of cancer patients. Clin. Cancer. Res. 9: 606, 2003. 2. Liyanage U K, Moore T T, Joo H G et al. Prevalence of regulatory T cells is increased in peripheral blood and tumor microenvironment of patients with pancreas or breast adenocarcinoma. J. Immunol. 169: 2756, 2002. 3. Curiel T J, Coukos G, Zou L et al. Specific recruitment of regulatory T cells in ovarian carcinoma fosters immune privilege and predicts reduced survival. Nat. Med. 10: 942, 2004. 4. Baumgartner J, Wilson C, Palmer B et al. Melanoma induces immunosuppression by up-regulating Foxp3.sup.+ regulatory T cells. I Surg. Res. 141: 72, 2007. 5. Dannull J. Su Z, Rizzieri D et al. Enhancement of vaccine-mediated antitumor immunity in cancer patients after depletion of regulator T cells. J. Clin. Invest. 115 (12): 3623 6. Bos P D, Plitas G. Rudra D et al. Transient regulatory T cell ablation deters oncogene-driven breast cancer and enhances radiotherapy. J Exp. Med. 210 (11): 2435, 2013. 7. Nair S, Boczkowski, Fassnacht M et al. Vaccination against the forkhead family transcription factor Foxp3 enhances tumor immunity. Cancer Res. 67 (1): 371, 2007. 8. Sugiyama D, Nishikawa H, Maeda Y et al. Anti-CCR4 mAb selectively depletes effector-type Foxp3.sup.+CD4.sup.+ regulator T cells, evoking antitumor immune responses in humans. PNAS. 110 (44): 17945, 2013. 9. Rech A J, Mick R, Martin S et al. CD25 blockade depletes and selectively reprogram regulatory T cells in concert with immunotherapy in cancer patients. Sci. Transl. Med. 4 (134): 134rd62, 2012. 10. Litzinger M T, Fermando R, Curiel T J et al. IL-2 immunotoxin denileukin diftitox reduces regulator T cells and enhances vaccine-mediated T-cell immunity. Blood 110 (9): 3192-201. 2007. 11. Heid J B, Schmidt A, Oberle N et al. Foxp3.sup.+CD25-tumor cells with regulatory function in sezary syndrome. J. Invest. Dermatol. 129: 2875-2885, 2009. 12. Rena May, Tao Dao, Javier Pinilla-Ibarz et al. CD4.sup.+ peptide epitopes from the WT1 oncoprotein stimulate CD4.sup.+ and CD8.sup.+ T cells that recognize and kill human malignant mesothelioma tumor cells. Clin. Cancer Res. 13: 4547-4555, 2007. 13. Tao Dao, Tatyana Koronsvit, Victoria Zakhaleva et al. Identification of a human cyclin D1-derived peptide that induces human cytotoxic CD4 T cells. Plos One 4 (8): e6730, 2009. 14. Larsen S K, Munir S, Woetmann A et al. Functional characterization of Foxp3-specific spontaneous immune responses. Leukemia 27: 2332-2340, 2013. 15. Lu L, Zhou X, Wang J etal. Characterization of protective human CD4.sup.+CD25.sup.+ Foxp3.sup.+ regulatory T cells generated with IL-2, TGF-b and retinoic acid. PLoSONE5(12): e15150. doi:10.1371/journal.pone.0015150, 2010. 16. Godfrey W R, Ge Y G, Spoden D J et al. In vitro-expanded human CD4.sup.+CD25.sup.+ regulatory T cells can markedly inhibit allogenic dendritic cell-stimulated MLR cultures. Blood 104: 453-461, 2004. 17. Levings M K, Sangregorio R, Sartirana C et al. Human CD4.sup.+CD25.sup.+ T suppressor cells clones produce transforming growth factor b, but not interleukin 10, and are distinct from type 1 T regulator cells. J Exp Med. 196 (10): 1335-1346, 2002. 18. Tao Dao, Su Yan, Nicholas Veomett, Dmitry Pankov, Liang Zhou, Tatyana Krontsvit, Andrew Scott, Joseph Witten, Peter Maslak, Emily Casey, Taochao Tan, Hong Liu, Victoria Zakhaleva, Michael Curcio, Ekaterina Doubrovina, Richard R. O'Reilly, Cheng Liu and David A. Scheinberg. Targeting the intracellular WT1 oncogene product with a therapeutic human antibody. Sci Transl Med. 5 (176) 176ra33, 2013. 19. Tao Dao, Dmitry Pankov, Andrew Scott, Tatyana Korontsvit, Victoriya Zakhaleva, Yiyang Xu, Jingyi Xiang, Su Yan, Manuel Direito de Morais Guerreiro, Nicholas Veomett, Leonid Dubrovsky, Michael Curcio, Ekaterina Doubrovina, Vladimir Ponomarev, Cheng Liu, Richard J O'Reilly & David A Scheinberg. Therapeutic bispecific T-cell engager antibody targeting the intracellular oncoprotein WT1. Nat. Bio. Tech. doi:10.1038/nbt.3349, 2015. 20. Koneru M, Purdon T J, Spriggs D, Koneru S, Brentjens R J. IL-12 secreting tumor-targeted chimeric antigen receptor T cells eradicate ovarian tumors. Oncoimmunology 2015; 4: e994446. 21. Rafiq S, Purdon T J, Daniyan A F et al. Optimized T-cell receptor-mimic chimeric antigen receptor T cells directed toward the intracellular Wilms tumor 1 antigen. Leukemia, doi: 10.1038/1eu.2016.373. 2017. 22. Park R I, Geyer M B, Brentjens R J. Blood. 2016 Jun. 30; 127(26):3312-20. doi: 10.1182/blood-2016-02-629063.
(645) TABLE-US-00017 APPENDIX A Linker (underlined) His tag .sup.+ HA tag (italicized) #17 Lv(lamda) DNA sequence cagtctgtgttgacgcagccgccctcagtgtctggggccccagggcagagggtcaccatctcctgcactgg gagcagctccaacatcggggcaggttatgatgtacactggtaccagcagcttccaggaacagcccccaaac tcctcatctatggtaacagcaatcggccctcaggggtccctgaccgattctctggctccaagtctggcacctc agcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagcag cctgagtggttatgtcttcggaactgggaccaaggtcaccgtcctaggt (SEQ ID NO: 153) AA sequence QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPK LLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYD SSLSGYVFGTGTKVTVLG [SEQ ID NO: 94] Hv DNA sequence gaagtgcagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaagg cttctggagacaccttcagcaggtatgctatcagctgggtgcgacaggcccctggacaagggcttgagtgg atgggaaggatcatccctatctttggtacaccaaactacgcacagaagttccagggcagagtcacgattacc gcggacgaattcacgagcacagcctacatggagctgagcagcctgagatctgaggacaccgccatgtatta ctgtgcgcgctctatctaccgttactctgaatacgatcattggggtcaaggtactctggtgaccgtctcctca (SEQ ID NO: 154) AA sequence EVQLVQSGAEVKKPGSSVKVSCKASGDTFSRYAISWVRQAPGQGLE WMGRIIPIFGTPNYAQKFQGRVTITADEFTSTAYMELSSLRSEDTAM YYCARSIYRYSEYDHWGQGTLVTVSS [SEQ ID NO: 93] Full-length AA sequence QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPK LLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYD SSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQ SGAEVKKPGSSVKVSCKASGDTFSRYAISWVRQAPGQGLEWMGRII PIFGTPNYAQKFQGRVTITADEFTSTAYMELSSLRSEDTAMYYCARS IYRYSEYDHWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 121] Full-length DNA sequence cagtctgtgttgacgcagccgccctcagtgtctggggccccagggcagagggtcaccatctcctgcactgg gagcagctccaacatcggggcaggttatgatgtacactggtaccagcagcttccaggaacagcccccaaac tcctcatctatggtaacagcaatcggccctcaggggtccctgaccgattctctggctccaagtctggcacctc agcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagcag cctgagtggttatgtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtggtggtggtagcgg cggcggcggctctggtggtggtggatccctcgagatggccgaagtgcagctggtgcagtctggggctgag gtgaagaagcctgggtcctcggtgaaggtctcctgcaaggcttctggagacaccttcagcaggtatgctatc agctgggtgcgacaggcccctggacaagggcttgagtggatgggaaggatcatccctatctttggtacacc aaactacgcacagaagttccagggcagagtcacgattaccgcggacgaattcacgagcacagcctacatg gagctgagcagcctgagatctgaggacaccgccatgtattactgtgcgcgctctatctaccgttactctgaata cgatcattggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatcacc atcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 155) #18 Lv(lamda) DNA sequence caggctgtgctgactcagccaccctcagcgtctgggacccgcgggcagagggtcaccatctcttgttctgga agcagctccaacatcggaagtaatactgtaaactggtaccagcagctcccaggaacggcccccaaactcct catctatagtaataatcagcggccctcaggggtccctgaccgattctctggctccaagtctggcacctcagcc tccctggccatcagtgggctccagtctgaagatgaggctgattattactgtgcagcatgggatgacagcctga atggtcagggggtcttcggaactgggaccaaggtcaccgtcctaggt (SEQ ID NO: 156) AA sequence QAVLTQPPSASGTRGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKL LIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDD SLNGQGVFGTGTKVTVLG [SEQ ID NO: 96] Hv DNA sequence gaggtccagctggtgcagtctggggctgaggtgaagaagcctgggacctcagtgaaggtttcctgcaagg catctggatacaccttcagcaactactatatacactgggtgcgacaggcccctggacaagggcttgagtgga tgggagcgatcaaccctagtgttggtaccacaacctacgcacagaactttcagggcagagtcaccatgacc agtgacacgtccacgagcacagtctacatggagttgagcagcctgacatctgaggacacggccgtgtatta ctgtgcgcgcgactggtggggtcagatgatgtacgatggttggggtcaaggtactctggtgaccgtctcctca (SEQ ID NO: 157) AA sequence EVQLVQSGAEVKKPGTSVKVSCKASGYTFSNYYIHWVRQAPGQGL EWMGAINPSVGTTTYAQNFQGRVTMTSDTSTSTVYMELSSLTSEDT AVYYCARDWWGQMMYDGWGQGTLVTVSS [SEQ ID NO: 95] Full-length AA sequence QAVLTQPPSASGTRGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKL LIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDD SLNGQGVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQ SGAEVKKPGTSVKVSCKASGYTFSNYYIHWVRQAPGQGLEWMGAI NPSVGTTTYAQNFQGRVTMTSDTSTSTVYMELSSLTSEDTAVYYCA RDWWGQMMYDGWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVP DYAS [SEQ ID NO: 122] Full-length DNA sequence CAGGCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCGCGG GCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGCTCCAACATCGG AAGTAATActgtaaactggtaccagcagctcccaggaacggcccccaaactcctcatctatagtaat aatcagcggccctcaggggtccctgaccgattctctggctccaagtctggcacctcagcctccctggccatc agtgggctccagtctgaagatgaggctgattattactgtgcagcatgggatgacagcctgaatggtcagggg gtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtggtggtggtagcggcggcggcggctc tggtggtggtggatccctcgagatggccgaggtccagctggtgcagtctggggctgaggtgaagaagcct gggacctcagtgaaggtttcctgcaaggcatctggatacaccttcagcaactactatatacactgggtgcgac aggcccctggacaagggcttgagtggatgggagcgatcaaccctagtgttggtaccacaacctacgcaca gaactttcagggcagagtcaccatgaccagtgacacgtccacgagcacagtctacatggagttgagcagcc tgacatctgaggacacggccgtgtattactgtgcgcgcgactggtggggtcagatgatgtacgatggttggg gtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatcaccatcaccatgg cgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 158) #20 Lv(lamda) DNA sequence cagtctgtcgtgacgcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctgg aagcagctccaacatcggggcaggttatgatgtacactggtaccagcagcttccaggaacagcccccaaac tcctcatctatggtaacagcaatcggccctcaggggtccctgaccgattctctggctccaagtctggcacctc agcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagcag cctgagtggttcggtgttcggcggagggaccaagctgaccgtcctaggt (SEQ ID NO: 159) AA sequence QSVVTQPPSVSAAPGQKVTISCSGSSSNIGAGYDVHWYQQLPGTAP KLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSY DSSLSGSVFGGGTKLTVLG [SEQ ID NO: 98] Hv DNA sequence gaggtccagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaagg cttctggaggcaccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttgagtgg atgggagggatcatccctatctttggtacagcaaactacgcacagaagttccagggcagagtcacgattacc gcggacgaatccacgagcacagcctacatggagctgagcagcctgagatctgaggacacggccgtgtatt actgtgcgcgctactcttacaaatacggtgaactggatacttggggtcaaggtactctggtgaccgtctcctca (SEQ ID NO: 160) AA sequence EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLE WMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAV YYCARYSYKYGELDTWGQGTLVTVSS [SEQ ID NO: 97] Full-length AA sequence QSVVTQPPSVSAAPGQKVTISCSGSSSNIGAGYDVHWYQQLPGTAP KLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSY DSSLSGSVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAEVQLV QSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGI IPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR YSYKYGELDTWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 123] Full-length DNA sequence cagtctgtcgtgacgcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctgg aagcagctccaacatcggggcaggttatgatgtacactggtaccagcagcttccaggaacagcccccaaac tcctcatctatggtaacagcaatcggccctcaggggtccctgaccgattctctggctccaagtctggcacctc agcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagcag cctgagtggttcggtgttcggcggagggaccaagctgaccgtcctaggttctagaggtggtggtggtagcg gcggcggcggctctggtggtggtggatccctcgagatggccgaggtccagctggtgcagtctggggctga ggtgaagaagcctgggtcctcggtgaaggtctcctgcaaggcttctggaggcaccttcagcagctatgctat cagctgggtgcgacaggcccctggacaagggcttgagtggatgggagggatcatccctatctttggtacag caaactacgcacagaagttccagggcagagtcacgattaccgcggacgaatccacgagcacagcctacat ggagctgagcagcctgagatctgaggacacggccgtgtattactgtgcgcgctactcttacaaatacggtga actggatacttggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatc accatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 161) #27 Lv(lamda) DNA sequence caggctgtgctgactcagccaccctcggtgtcagtggccccaggaaagacggccagacttacctgtgggg gaaacaacattggaagtgaaagtgtacattggtaccagcagaagccaggccaggcccctttactggtcgtct atgatgatgacgaccggccctccgggatccctgagcgattctctggctccaactctgggaacacggccacc ctgaccatcagcagggtcgaggccggcgatgaggccgactattactgtcaggtgtgggatcgaagtagtga tcattggtttttcggcggagggaccaagctgaccgtcctaggt (SEQ ID NO: 162) AA sequence QAVLTQPPSVSVAPGKTARLTCGGNNIGSESVHWYQQKPGQAPLLV VYDDDDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDR SSDHWFFGGGTKLTVLG[SEQ ID NO: 100] Hv DNA sequence caggtgcagctggtgcaatctggggctgaggtgaagaagcctggggcctctgtgaaggtttcctgcaaggc atctggatacaccttcaccaattactatattcactgggtgcgacaggcccccggacaagggcttgagtggatg ggaataatcagacctagtggtggtatcacaaactacgcacagaagttccagggcagggtcagcatgaccag ggacacgtccacgagcacagtctacatggagctgagcagcctgagatctgaggacactgccgtgtattact gtgcgcgctcttgggactacttcgcttctaacgatttctggggtcaaggtactctggtgaccgtctcctca (SEQ ID NO: 163) AA sequence QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGQGL EWMGIIRPSGGITNYAQKFQGRVSMTRDTSTSTVYMELSSLRSEDTA VYYCARSWDYFASNDFWGQGTLVTVSS [SEQ ID NO: 99] Full-length AA sequence QAVLTQPPSVSVAPGKTARLTCGGNNIGSESVHWYQQKPGQAPLLV VYDDDDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDR SSDHWFFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQVQLVQS GAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGQGLEWMGIIR PSGGITNYAQKFQGRVSMTRDTSTSTVYMELSSLRSEDTAVYYCAR SWDYFASNDFWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 124] Full-length DNA sequence caggctgtgctgactcagccaccctcggtgtcagtggccccaggaaagacggccagacttacctgtgggg gaaacaacattggaagtgaaagtgtacattggtaccagcagaagccaggccaggcccctttactggtcgtct atgatgatgacgaccggccctccgggatccctgagcgattctctggctccaactctgggaacacggccacc ctgaccatcagcagggtcgaggccggcgatgaggccgactattactgtcaggtgtgggatcgaagtagtga tcattggtttttcggcggagggaccaagctgaccgtcctaggttctagaggtggtggtggtagcggcggcgg cggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcaatctggggctgaggtgaag aagcctggggcctctgtgaaggtttcctgcaaggcatctggatacaccttcaccaattactatattcactgggt gcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtggtatcacaaactac gcacagaagttccagggcagggtcagcatgaccagggacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacactgccgtgtattactgtgcgcgctcttgggactacttcgcttctaacgatttc tggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatcaccatcacc atggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 164) #28 Lv(lamda) DNA sequence cagtctgtgctgacgcagccgccctcagtgtctggggccccagggcagagggtcaccatctcctgcactgg gagcagctccaacatcggggcaggttatgatgtgcactggtaccagcagcttccaggaacagcccccaaa ctcctcatctatggtaacagcgatcggccctccggggtccctgaccgattctctggctccaagtctggcacct cagcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagca gcctgagtggttatgtcttcggaactgggaccaaggtcaccgtcctaggt tctagaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcc (SEQ ID NO: 165) AA sequence QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPK LLIYGNSDRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYD SSLSGYVFGTGTKVTVLG [SEQ ID NO: 102] Hv DNA sequence cagatgcagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaagg cttctggaggcaccttcagcacctacgctatcagctgggtgcgacaggcccctggacaagggcttgagtgg atgggagggatcatccctatatttgggacagcaaactacgcacagaagttccagggcagggtcacgattac cgcggacaaatccacgagcacagcctacatggaggtgaggaacctgagatctgaggacacggccgtgtat tactgtgcgcgcgctgaatacgtttacggtgaatacgatcagtggggtcaaggtactctggtgaccgtctcct ca (SEQ ID NO: 166) AA sequence QMQLVQSGAEVKKPGSSVKVSCKASGGTFSTYAISWVRQAPGQGL EWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMEVRNLRSEDTA VYYCARAEYVYGEYDQWGQGTLVTVSS [SEQ ID NO: 101] Full-length AA sequence QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPK LLIYGNSDRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYD SSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAQMQLVQ SGAEVKKPGSSVKVSCKASGGTFSTYAISWVRQAPGQGLEWMGGII PIFGTANYAQKFQGRVTITADKSTSTAYMEVRNLRSEDTAVYYCAR AEYVYGEYDQWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYA S [SEQ ID NO: 125] Full-length DNA sequence cagtctgtgctgacgcagccgccctcagtgtctggggccccagggcagagggtcaccatctcctgcactgg gagcagctccaacatcggggcaggttatgatgtgcactggtaccagcagcttccaggaacagcccccaaa ctcctcatctatggtaacagcgatcggccctccggggtccctgaccgattctctggctccaagtctggcacct cagcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagca gcctgagtggttatgtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtggtggtggtagca gcggcggcggctctggtggtggtggatccctcgagatggcccagatgcagctggtgcagtctggggctga ggtgaagaagcctgggtcctcggtgaaggtctcctgcaaggcttctggaggcaccttcagcacctacgctat cagctgggtgcgacaggcccctggacaagggcttgagtggatgggagggatcatccctatatttgggaca gcaaactacgcacagaagttccagggcagggtcacgattaccgcggacaaatccacgagcacagcctaca tggaggtgaggaacctgagatctgaggacacggccgtgtattactgtgcgcgcgctgaatacgtttacggtg aatacgatcagtggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccat caccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 167) #32 Lv(lamda) DNA sequence cagtctgtgttgactcagccaccctcagtgtcagtggccccaggaaagacggccaggattacctgtggggg aaacaacattggaagtaaaagtgtgcactggtaccagcagaagccaggccaggcccctgtgctggtcatct attatgatagcgaccggccctcagggatccctgagcgattctctggctccaactctgggaacacggccaccc tgaccatcagcagggtcgaagccggggatgaggccgactattactgtcaggtgtgggatagtagtagtgat cattatgtcttcggaactgggaccaaggtcaccgtcctaggt (SEQ ID NO: 168) AA sequence QSVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVI YYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSS DHYVFGTGTKVTVLG [SEQ ID NO: 104] Hv DNA sequence gaggtgcagctggtggagtccgggggaggcgtggtccagcctgggaggtccctgagactctcctgtgcag cctctgggttcaccttcaataatcatgctatgcactgggtccgccaggctccaggcaaggggctggagtggg tggcagttatatcatttgatggagacgataaattctacgcagactccgtgaagggccgattcaccatctccaga gacaattccaggaacacactgtttctgcaaatgaacaacctgagacctgaggacacggctgtgtattactgtt cgagagatccatatcactttgcctcggggagttattcctactttgactactggggccagggaaccctggtcac cgtctcctca (SEQ ID NO: 169) AA sequence EVQLVESGGGVVQPGRSLRLSCAASGFTFNNHAMHWVRQAPGKGL EWVAVISFDGDDKFYADSVKGRFTISRDNSRNTLFLQMNNLRPEDT AVYYCSRDPYHFASGSYSYFDYWGQGTLVTVSS [SEQ ID NO: 103] Full-length AA sequence QSVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVI YYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSS DHYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVESGG GVVQPGRSLRLSCAASGFTFNNHAMHWVRQAPGKGLEWVAVISFD GDDKFYADSVKGRFTISRDNSRNTLFLQMNNLRPEDTAVYYCSRDP YHFASGSYSYFDYWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPD YAS [SEQ ID NO: 126] Full-length DNA sequence cagtctgtgttgactcagccaccctcagtgtcagtggccccaggaaagacggccaggattacctgtggggg aaacaacattggaagtaaaagtgtgcactggtaccagcagaagccaggccaggcccctgtgctggtcatct attatgatagcgaccggccctcagggatccctgagcgattctctggctccaactctgggaacacggccaccc tgaccatcagcagggtcgaagccggggatgaggccgactattactgtcaggtgtgggatagtagtagtgat cattatgtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtggtggtggtagcggcggcggc ggctctggtggtggtggatccctcgagatggccgaggtgcagctggtggagtccgggggaggcgtggtcc agcctgggaggtccctgagactctcctgtgcagcctctgggttcaccttcaataatcatgctatgcactgggtc cgccaggctccaggcaaggggctggagtgggtggcagttatatcatttgatggagacgataaattctacgca gactccgtgaagggccgattcaccatctccagagacaattccaggaacacactgtttctgcaaatgaacaac ctgagacctgaggacacggctgtgtattactgttcgagagatccatatcactttgcctcggggagttattcctac tttgactactggggccagggaaccctggtcaccgtctcctcaactagtggccaggccggccagcaccatc accatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 170) #53 Lv(lamda) DNA sequence aattttatgctgactcagccccactctgtgtcggagtctccggggaagacggtgaccatctcctgcacccgca gcagtggcagcattgccagccactatgtgcagtggtaccagcagcgcccgggcagttcccccaccactgtg atctatgagaataaccaaagaccctctggggtccctgatcggttctctggctccatcgacagttcctccaactc tgcctccctcaccatctctggactgaagactgaggacgaggctgactactactgtcaatcttatgatcgcagc aatcatgtggtattcggcggagggaccaagctgaccgtcctaggt (SEQ ID NO: 171) AA sequence NFMLTQPHSVSESPGKTVTISCTRSSGSIASHYVQWYQQRPGSSPTT VIYENNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYD RSNHVVFGGGTKLTVLG [SEQ ID NO: 106] Hv DNA sequence caggtgcagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaagg catctggatacaccttcaccaactactatatccactgggtgcgacaggcccctggagaagggcttgagtgga tgggaataatcagacctagtggcggtaacacaaactacgcacagaagttccagggcagagtcaccatgacc agggacacgtccacgcgcacggtctatatggagttgagtagcctgagatctgaggacacggccgtgtatta ctgtgcgcgctcttggaactctcgtgacgttgattcttggggtcaaggtactctggtgaccgtctcctca (SEQ ID NO: 172) AA sequence QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGEGL EWMGIIRPSGGNTNYAQKFQGRVTMTRDTSTRTVYMELSSLRSEDT AVYYCARSWNSRDVDSWGQGTLVTVSS [SEQ ID NO: 105] Full-length AA sequence NFMLTQPHSVSESPGKTVTISCTRSSGSIASHYVQWYQQRPGSSPTT VIYENNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYD RSNHVVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQVQLVQS GAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGEGLEWMGIIRP SGGNTNYAQKFQGRVTMTRDTSTRTVYMELSSLRSEDTAVYYCAR SWNSRDVDSWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 127] Full-length DNA sequence aattttatgctgactcagccccactctgtgtcggagtctccggggaagacggtgaccatctcctgcacccgca gcagtggcagcattgccagccactatgtgcagtggtaccagcagcgcccgggcagttcccccaccactgtg atctatgagaataaccaaagaccctctggggtccctgatcggttctctggctccatcgacagttcctccaactc tgcctccctcaccatctctggactgaagactgaggacgaggctgactactactgtcaatcttatgatcgcagc aatcatgtggtattcggcggagggaccaagctgaccgtcctaggttctagaggtggtggtggtagcggcgg cggcggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcagtctggggctgaggtg aagaagcctggggcctcagtgaaggtctcctgcaaggcatctggatacaccttcaccaactactatatccact gggtgcgacaggcccctggagaagggcttgagtggatgggaataatcagacctagtggcggtaacacaaa ctacgcacagaagttccagggcagagtcaccatgaccagggacacgtccacgcgcacggtctatatggag ttgagtagcctgagatctgaggacacggccgtgtattactgtgcgcgctcttggaactctcgtgacgttgattc ttggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatcaccatcac catggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 173) #54 Lv(lamda) DNA sequence caggctgtgctgactcagccaccctcgctgtctggaggccccaggcagagggtcaccatctcctgttctgga agcacctccaacatcggaaaaaatggtgtgagctggtaccagcagctcccaggaaaggctcccaaactcct catctataatgatcatctgttgtcctcaggggtctctgaccgcttttctggctccaagtctggcacgtcagcctcc ctggccatcagtggactccagtctgacgatgaagctgattattactgtgcgacatgggacgacactttggatct tccgctattcggcggagggaccaaggtcaccgtcctaggt (SEQ ID NO: 174) AA sequence QAVLTQPPSLSGGPRQRVTISCSGSTSNIGKNGVSWYQQLPGKAPKL LIYNDHLLSSGVSDRFSGSKSGTSASLAISGLQSDDEADYYCATWDD TLDLPLFGGGTKVTVLG [SEQ ID NO: 108] Hv DNA sequence cagatgcagctggtgcagtctggggctgaggtggagaagcctggggcctcagtgaagctctcctgcaagg cttctggaggcaccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttgagtgg atgggagggatcatccctatctttggtacagcaaactacgcacagaagttccagggcagagtcacgattacc gcggacgaatccacgagcacagcctacatggagctgagcagcctgagatctgaggacacggccgtgtatt actgtgcgcgcccgtcttactactctatcaaatctgcttgggatcattggggtcaaggtactctggtgaccgtct cctca (SEQ ID NO: 175) AA sequence QMQLVQSGAEVEKPGASVKLSCKASGGTFSSYAISWVRQAPGQGLE WMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAV YYCARPSYYSIKSAWDHWGQGTLVTVSS [SEQ ID NO: 107] Full-length AA sequence QAVLTQPPSLSGGPRQRVTISCSGSTSNIGKNGVSWYQQLPGKAPKL LIYNDHLLSSGVSDRFSGSKSGTSASLAISGLQSDDEADYYCATWDD TLDLPLFGGGTKVTVLGSRGGGGSGGGGSGGGGSLEMAQMQLVQS GAEVEKPGASVKLSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPI FGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARPS YYSIKSAWDHWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 128] Full-length DNA sequence Caggctgtgctgactcagccaccctcgctgtctggaggccccaggcagagggtcaccatctcctgttctgg aagcacctccaacatcggaaaaaatggtgtgagctggtaccagcagctcccaggaaaggctcccaaactc ctcatctataatgatcatctgttgtcctcaggggtctctgaccgcttttctggctccaagtctggcacgtcagcct ccctggccatcagtggactccagtctgacgatgaagctgattattactgtgcgacatgggacgacactttgga tcttccgctattcggcggagggaccaaggtcaccgtcctaggttctagaggtggtggtggtagcggcggcg gcggctctggtggtggtggatccctcgagatggcccagatgcagctggtgcagtctggggctgaggtgga gaagcctggggcctcagtgaagctctcctgcaaggcttctggaggcaccttcagcagctatgctatcagctg ggtgcgacaggcccctggacaagggcttgagtggatgggagggatcatccctatctttggtacagcaaact acgcacagaagttccagggcagagtcacgattaccgcggacgaatccacgagcacagcctacatggagct gagcagcctgagatctgaggacacggccgtgtattactgtgcgcgcccgtcttactactctatcaaatctgctt gggatcattggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatca ccatcaccatggcgcatacccgtacgacgttccggactacgcttc (SEQ ID NO: 176)
(646) TABLE-US-00018 APPENDIX B Clone no. HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 #5 RYTFTN INPSGG ARGWSGYDPGDF SSDVGGYNY EVS SSYAGSNTHVV YY (SEQ ST (SEQ (SEQ ID NO: (SEQ ID (SEQ ID (SEQ ID NO: 218) ID NO: ID NO: 191) NO: 203) NO: 177) 185) 211) #9 RYTFTN INPSGG ARGWSGYDPGDF SSDVGGYNY EVS SSYAGSNNVV YY (SEQ ST (SEQ (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: ID NO: 191) 203) NO: 219) 177) 185) 211) #10 GYSFTS IDPSDS VRHGFSNSPRLW SSNIGVNP ANY STWDDSLNAWL YY (SEQ YT (SEQ FDT (SEQ ID (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: ID NO: NO: 192) 204) NO: 220) 178) 186) 212) #11 GYTFNN INPSGG ARSFDKQDIDY SGSIASNY EDN QSYDTNNYGVI YY (SEQ ST (SEQ (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: ID NO: 193) 205) NO: 221) 179) 185) 213) #21 GYTFTNT IRPSGGIT ARSWMSDSYYDG NIGSKS DDS QVWDSSSDHVI YY (SEQ (SEQ (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: ID NO: 194) 42) NO: 222) 180) 28) 214) #23 GYTFTN ISPYNG ARYWDSGYAYDE NIGSKS DDS QVWDSSSDRWV YG (SEQ NT (SEQ (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: ID NO: 195) 66) NO: 223) 181) 187) 214) #24 GYTFTN IRPSGGIT ARSWSNKLSWY SSNIGNNY DNN GTWDSSLNAVV YY (SEQ (SEQ NDG (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: ID NO: (SEQ ID NO: 206) NO: 224) 182) 28) 196) 215) #25 GYTFTN INPSGG ARSWSKTEGSDR SSNIGNNY DNN GTWDNSLSAAV YY (SEQ ST (SEQ (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: ID NO: 197) 206) NO: 225) 182) 185) 215) #26 GYTFTN IRPSGG ARSWDTFSDE DIRRKT DDS QVWDNDNDHYV YY (SEQ NT (SEQ (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: ID NO: 198) 207) NO: 226) 182) 46) 214) #29 GYTFTN INPSIGST ARSFGDSDGADS SSNIGNNY DDN GTWDSSLSAVV YY (SEQ (SEQ ID (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: NO: 199) 206) NO: 227) 182) 188) 216) #30 GYTFTN IRPSGGIT ARSWHENSGVDS NLGSKS DDS QVWHSSSDHYV YY (SEQ (SEQ ID (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: NO: 200) 208) NO: 228) 182) 28) 214) #34 GGTFSS IIPILGIA ARGGDYVESWF SSDVGAYNY EVS SSYAGSNNFV YA (SEQ (SEQ ID DP (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: NO: (SEQ ID NO: 209) NO: 229) 183) 189) 201) 211) #55 GYTFDN INTYDG ARSVPHQISYGDL TSDFNDYLF DVT GSKTGRTTYV FG (SEQ YT (SEQ (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: ID NO: ID NO: 202) 210) NO: 230) 184) 190) 217)
(647) TABLE-US-00019 APPENDIX C Linker (underlined) His tag .sup.+ HA tag (italicized) #5 DNA Sequence: caatctgccctgactcagcctccctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtggttataactatgtctcctggtaccaacagcacccaggcaaagcccccaaactcatgatttatgaggtcagtaagcggc cctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatg aggctgattattactgcagctcatatgcaggcagcaacacccatgtggtattcggcggagggaccaagctgaccgtcctaggtt ctagaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggccgaagtgcagctggtgcagtc tggggctgaggtgaagaagcctggggcctcagtgaaaatttcctgcaaggcatctagatacaccttcaccaactactatatacac tgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaacctacccacaga acttccagggcagactcaccatgaccagggacacgtccacgagcacagtctacatggagctgagcagcctgagatctgagga cacggccatgtattactgtgcgagaggttggagtggctacgatccaggggacttctggggccagggaaccctggtcaccgtct cctcaactagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 231) Amino Acid Sequence: QSALTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVS KRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNTHVVFGGGTKL TVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGASVKISCKASRYT FTNYYIHWVRQAPGQGLEWMGIINPSGGSTTYPQNFQGRLTMTRDTSTSTVYME LSSLRSEDTAMYYCARGWSGYDPGDFWGQGTLVTVSSTSGQAGQHHHHHHGA YPYDVPDYAS (SEQ ID NO: 232) Light chain DNA Sequence: caatctgccctgactcagcctccctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtggttataactatgtctcctggtaccaacagcacccaggcaaagcccccaaactcatgatttatgaggtcagtaagcggc cctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatg aggctgattattactgcagctcatatgcaggcagcaacacccatgtggtattcggcggagggaccaagctgaccgtcctaggt (SEQ ID NO: 233) Light Chain Amino Acid Sequence: QSALTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVS KRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNTHVVFGGGTKL TVLG (SEQ ID NO: 234) Heavy Chain DNA Sequence: gaagtgcagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtgaaaatttcctgcaaggcatctagatacac cttcaccaactactatatacactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtgg tagcacaacctacccacagaacttccagggcagactcaccatgaccagggacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacacggccatgtattactgtgcgagaggttggagtggctacgatccaggggacttctggggcca gggaaccctggtcaccgtctcctca (SEQ ID NO: 235) Heavy Chain Amino Acid Sequience: EVQLVQSGAEVKKPGASVKISCKASRYTFTNYYIHWVRQAPGQGLEWMGIINPS GGSTTYPQNFQGRLTMTRDTSTSTVYMELSSLRSEDTAMYYCARGWSGYDPGD FWGQGTLVTVSS (SEQ ID NO: 236) #9 DNA Sequence: caatctgccctgactcagcctgcctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtggttataactatgtctcctggtaccaacagcacccaggcaaagcccccaaactcatgatttatgaggtcagtaagcggc cctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatg aggctgattattactgcagctcatatgcaggcagcaacaatgtggtattcggcggagggaccaagctgaccgtcctaggttctag aggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggccgaggtccagctggtgcagtctggg gctgaggtgaagaagcctggggcctcagtgaaaatttcctgcaaggcatctagatacaccttcaccaactactatatacactggg tgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaacctacccacagaacttc cagggcagactcaccatgaccagggacacgtccacgagcacagtctacatggagctgagcagcctgagatctgaggacacg gccatgtattactgtgcgagaggttggagtggctacgatccaggggacttctggggccagggaaccctggtcaccgtctcctca actagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 237) Amino Acid Sequence: QSALTQPASASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVS KRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNNVVFGGGTKLT VLG SRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGASVKISCKASRYTFTNY YIHWVRQAPGQGLEWMGIINPSGGSTTYPQNFQGRLTMTRDTSTSTVYMELSSL RSEDTAMYYCARGWSGYDPGDFWGQGTLVTVSSTSGQAGQHHHHHHGAYPYD VPDYAS (SEQ ID NO: 238) Light Chain DNA Sequence: caatctgccctgactcagcctgcctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtggttataactatgtctcctggtaccaacagcacccaggcaaagcccccaaactcatgatttatgaggtcagtaagcggc cctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatg aggctgattattactgcagctcatatgcaggcagcaacaatgtggtattcggcggagggaccaagctgaccgtcctaggt (SEQ ID NO: 239) Light Chain Amino Acid Sequence: QSALTQPASASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVS KRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNNVVFGGGTKLT VLG (SEQ ID NO: 240) Heavy Chain DNA Sequence: gaggtccagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtgaaaatttcctgcaaggcatctagatacac cttcaccaactactatatacactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtgg tagcacaacctacccacagaacttccagggcagactcaccatgaccagggacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacacggccatgtattactgtgcgagaggttggagtggctacgatccaggggacttctggggcca gggaaccctggtcaccgtctcctca (SEQ ID NO: 241) Heavy Chain Amino Acid Sequence: EVQLVQSGAEVKKPGASVKISCKASRYTFTNYYIHWVRQAPGQGLEWMGIINPS GGSTTYPQNFQGRLTMTRDTSTSTVYMELSSLRSEDTAMYYCARGWSGYDPGD FWGQGTLVTVSS (SEQ ID NO: 242) #10 DNA Sequence: caggctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgttctggaggcagctccaa catcggagttaatcctgtaaactggtaccagcaactcccaggaacggcccccaaactcctcatctttgctaattatcagcggccct caggggtccctgaccgattctctggctccaagtctggcacctcagcctccctggccatcagtggactccagtctgatgatgagg ctcattattattgttcgacatgggatgacagcctgaatgcttggctgttcggcggagggaccaagctgaccgtcctaggttctaga ggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggccgaggtgcagctggtgcagtctgga gcagaggtgaaaaagccgggggactctctgaggatctcctgtcagggttctggatacagctttaccagttactacatcagctgg gtgcgccagatgcccgggaaaggcctggagtggatggggaacattgatcctagtgactcttacaccaactacagcccgtccttc caaggccacgtcaccatgtcagttgacaagtccatcagcactgcctacctgcagtggagcagcctgaaggcctcggacatcgc catatattactgtgtgagacatgggtttagcaactcgcctagattgtggttcgacacctggggccagggaaccctggtcaccgtct cctcaactagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 243) Amino Acid Sequence: QAVLTQPPSASGTPGQRVTISCSGGSSNIGVNPVNWYQQLPGTAPKLLIFANYQR PSGVPDRFSGSKSGTSASLAISGLQSDDEAHYYCSTWDDSLNAWLFGGGTKLTV LG SRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGDSLRISCQGSGYSFTSY YISWVRQMPGKGLEWMGNIDPSDSYTNYSPSFQGHVTMSVDKSISTAYLQWSS LKASDIAIYYCVRHGFSNSPRLWFDTWGQGTLVTVSSTSGQAGQHHHHHHGAYP YDVPDYAS (SEQ ID NO: 244) Light Chain DNA Sequence: caggctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgttctggaggcagctccaa catcggagttaatcctgtaaactggtaccagcaactcccaggaacggcccccaaactcctcatctttgctaattatcagcggccct caggggtccctgaccgattctctggctccaagtctggcacctcagcctccctggccatcagtggactccagtctgatgatgagg ctcattattattgttcgacatgggatgacagcctgaatgcttggctgttcggcggagggaccaagctgaccgtcctaggt (SEQ ID NO: 245) Light Chain Amino Acid Sequence: QAVLTQPPSASGTPGQRVTISCSGGSSNIGVNPVNWYQQLPGTAPKLLIFANYQR PSGVPDRFSGSKSGTSASLAISGLQSDDEAHYYCSTWDDSLNAWLFGGGTKLTV LG (SEQ ID NO: 246) Heavy Chain DNA Sequence: gaggtgcagctggtgcagtctggagcagaggtgaaaaagccgggggactctctgaggatctcctgtcagggttctggatacag ctttaccagttactacatcagctgggtgcgccagatgcccgggaaaggcctggagtggatggggaacattgatcctagtgactc ttacaccaactacagcccgtccttccaaggccacgtcaccatgtcagttgacaagtccatcagcactgcctacctgcagtggagc agcctgaaggcctcggacatcgccatatattactgtgtgagacatgggtttagcaactcgcctagattgtggttcgacacctggg gccagggaaccctggtcaccgtctcctca (SEQ ID NO: 247) Heavy Chain Amino Acid Sequence: EVQLVQSGAEVKKPGDSLRISCQGSGYSFTSYYISWVRQMPGKGLEWMGNIDPS DSYTNYSPSFQGHVTMSVDKSISTAYLQWSSLKASDIAIYYCVRHGFSNSPRLWF DTWGQGTLVTVSS (SEQ ID NO: 248) #11 DNA Sequence: aattttatgctgactcagccccactctgtgtcggagtctccggggaagacggtaaccatctcctgcacccgcagcagtggcagc attgccagcaactatgtgcagtggtaccagcagcgcccgggcagtgcccccaccactgtgatctatgaggataaccaaagacc ctctggggtccctgatcggttctctggctccatcgacagctcctccaactctgcctccctcaccatctctggactgaagactgagg acgaggctgattactactgtcagtcttatgataccaacaattatggggttatattcggcggagggaccaagctgaccgtcctaggt tctagaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccagatgcagctggtgcagt ctggggctgaggtgaagaagcctggggcctcagtgaaggtttcctgcaagacatctggatacaccttcaacaactactatatgc actgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaaactacgcaca gaagttccagggcagagtcaccatgaccagggacacgtccacgagcacagtctacatggagctgagcagcctgagatctgag gacactgccgtgtattactgtgcgcgctctttcgacaaacaggacatcgattactggggtcaaggtactctggtgaccgtctcctc aactagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 249) Amino Acid Sequence: NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQR PSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDTNNYGVIFGGGTKLTV LGSRGGGGSGGGGSGGGGSLEMAQMQLVQSGAEVKKPGASVKVSCKTSGYTF NNYYMHWVRQAPGQGLEWMGIINPSGGSTNYAQKFQGRVTMTRDTSTSTVYM ELSSLRSEDTAVYYCARSFDKQDIDYWGQGTLVTVSSTSGQAGQHHHHHHGAYP YDVPDYAS (SEQ ID NO: 250) Light Chain DNA Sequence: aattttatgctgactcagccccactctgtgtcggagtctccggggaagacggtaaccatctcctgcacccgcagcagtggcagc attgccagcaactatgtgcagtggtaccagcagcgcccgggcagtgcccccaccactgtgatctatgaggataaccaaagacc ctctggggtccctgatcggttctctggctccatcgacagctcctccaactctgcctccctcaccatctctggactgaagactgagg acgaggctgattactactgtcagtcttatgataccaacaattatggggttatattcggcggagggaccaagctgaccgtcctaggt (SEQ ID NO: 251) Light Chain Amino Acid Sequence: NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQR PSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDTNNYGVIFGGGTKLTV LG (SEQ ID NO: 252) Heavy Chain DNA Sequence: cagatgcagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtgaaggtttcctgcaagacatctggatacac cttcaacaactactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtgg tagcacaaactacgcacagaagttccagggcagagtcaccatgaccagggacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacactgccgtgtattactgtgcgcgctctttcgacaaacaggacatcgattactggggtcaaggta ctctggtgaccgtctcctca (SEQ ID NO: 253) Heavy Chain Amino Acid Sequence: QMQLVQSGAEVKKPGASVKVSCKTSGYTFNNYYMHWVRQAPGQGLEWMGIIN PSGGSTNYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSFDKQDID YWGQGTLVTVSS (SEQ ID NO: 254) #21 DNA Sequence: tcctatgagctgactcagccaccctcggtgtcagtggccccaggacagacggccagcatgacctgtgggggaaacaacattg gaagtaaaagtgtgcactggtaccagcagaagccaagccaggcccctgtgatggtcgtccatgatgatagcgagcggccctc agggatccctgagcgaatctctggctccaagtctgggaacacggccaccctgaccatcagcagggtcgaagccggggatga ggccgactattactgtcaggtgtgggatagtagtagtgatcatgtgatattcggcggagggaccaagctgaccgtcctaggttct agaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcaatctg gggctgaggtgaagaagccgggggcctctgtgaaggtttcctgcaaggcatctggatacaccttcaccaactactatattcactg ggtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtggtatcacaaactacgcacagaag ttccagggcagggtcagcatgaccagagacacgtccacgagcacagtctacatggagctgagcagcctgagatctgaggaca cggccgtgtattactgtgcgcgctcttggatgtctgactcttactacgatggttggggtcaaggtactctggtgaccgtctcctcaa ctagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 255) Amino Acid Sequence: SYELTQPPSVSVAPGQTASMTCGGNNIGSKSVHWYQQKPSQAPVMVVHDDSER PSGIPERISGSKSGNTATLTISRVEAGDEADYYCQVWDSSSDHVIFGGGTKLTVL GSRGGGGSGGGGSGGGGSLEMAQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYYIHWVRQAPGQGLEWMGIIRPSGGITNYAQKFQGRVSMTRDTSTSTVYMEL SSLRSEDTAVYYCARSWMSDSYYDGWGQGTLVTVSSTSGQAGQHHHHHHGAY PYDVPDYAS (SEQ ID NO: 256) Light Chain DNA Sequence: tcctatgagctgactcagccaccctcggtgtcagtggccccaggacagacggccagcatgacctgtgggggaaacaacattg gaagtaaaagtgtgcactggtaccagcagaagccaagccaggcccctgtgatggtcgtccatgatgatagcgagcggccctc agggatccctgagcgaatctctggctccaagtctgggaacacggccaccctgaccatcagcagggtcgaagccggggatga ggccgactattactgtcaggtgtgggatagtagtagtgatcatgtgatattcggcggagggaccaagctgaccgtcctaggt (SEQ ID NO: 257) Light Chain Amino Acid Sequence: SYELTQPPSVSVAPGQTASMTCGGNNIGSKSVHWYQQKPSQAPVMVVHDDSER PSGIPERISGSKSGNTATLTISRVEAGDEADYYCQVWDSSSDHVIFGGGTKLTVLG (SEQ ID NO: 258) Heavy Chain DNA Sequence: caggtgcagctggtgcaatctggggctgaggtgaagaagccgggggcctctgtgaaggtttcctgcaaggcatctggatacac cttcaccaactactatattcactgggtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtgg tatcacaaactacgcacagaagttccagggcagggtcagcatgaccagagacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacacggccgtgtattactgtgcgcgctcttggatgtctgactcttactacgatggttggggtcaag gtactctggtgaccgtctcctca (SEQ ID NO: 259) Heavy Chain Amino Acid Sequence: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGQGLEWMGIIRP SGGITNYAQKFQGRVSMTRDTSTSTVYMELSSLRSEDTAVYYCARSWMSDSYY DGWGQGTLVTVSS (SEQ ID NO: 260) #23 DNA Sequence: tcctatgagctgactcagccaccctcggtgtcagtggctccaggacagacggcctggattacctgtgggggaaacaacattgg aagtaaaagtgtgcactggtaccagcagaagccaggccaggcccctatactggtcgtctatgatgatagcgaccggccctcag ggatccctgagagagtctctggctccaactctgggaacacggccaccctgaccatcagcagggtcgaagccggggatgagg ccgactattactgtcaggtgtgggatagtagtagtgatcgttgggtgttcggcggagggaccaagctgaccgtcctaggttctag aggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccagatgcagctggtgcagtctgga gctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggcttctggttacacctttaccaactatggtatcagctggg tgcgacaggcccctggacaagggcttgagtggatgggatggatcagcccttacaatggtaacacaaactacgcacagaagct ccagggcagagtcaccatgaccacagacacatccacgagcacagcctacatggagctgaggaacctgagatctgacgacac tgccgtgtattactgtgcgcgctactgggactctggttacgcttacgatgaatggggtcaaggtactctggtgaccgtctcctcaa ctagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 261) Amino Acid Sequence: SYELTQPPSVSVAPGQTAWITCGGNNIGSKSVHWYQQKPGQAPILVVYDDSDRP SGIPERVSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDRWVFGGGTKLTVL GSRGGGGSGGGGSGGGGSLEMAQMQLVQSGAEVKKPGASVKVSCKASGYTFT NYGISWVRQAPGQGLEWMGWISPYNGNTNYAQKLQGRVTMTTDTSTSTAYME LRNLRSDDTAVYYCARYWDSGYAYDEWGQGTLVTVSSTSGQAGQHHHHHHGA YPYDVPDYAS (SEQ ID NO: 262) Light Chain DNA Sequence: tcctatgagctgactcagccaccctcggtgtcagtggctccaggacagacggcctggattacctgtgggggaaacaacattgg aagtaaaagtgtgcactggtaccagcagaagccaggccaggcccctatactggtcgtctatgatgatagcgaccggccctcag ggatccctgagagagtctctggctccaactctgggaacacggccaccctgaccatcagcagggtcgaagccggggatgagg ccgactattactgtcaggtgtgggatagtagtagtgatcgttgggtgttcggcggagggaccaagctgaccgtcctaggt (SEQ ID NO: 263) Light Chain Amino Acid Sequence: SYELTQPPSVSVAPGQTAWITCGGNNIGSKSVHWYQQKPGQAPILVVYDDSDRP SGIPERVSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDRWVFGGGTKLTVLG (SEQ ID NO: 264) Heavy Chain DNA Sequence: cagatgcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggcttctggttacac ctttaccaactatggtatcagctgggtgcgacaggcccctggacaagggcttgagtggatgggatggatcagcccttacaatgg taacacaaactacgcacagaagctccagggcagagtcaccatgaccacagacacatccacgagcacagcctacatggagct gaggaacctgagatctgacgacactgccgtgtattactgtgcgcgctactgggactctggttacgcttacgatgaatggggtcaa ggtactctggtgaccgtctcctca (SEQ ID NO: 265) Heavy Chain Amino Acid Sequence: QMQLVQSGAEVKKPGASVKVSCKASGYTFTNYGISWVRQAPGQGLEWMGWIS PYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRNLRSDDTAVYYCARYWDSGY AYDEWGQGTLVTVSS (SEQ ID NO: 266) #24 DNA Sequence: caggctgtgctgactcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctggaagcagctccaa cattgggaataattatgtatcctggtaccagcagctcccaggaacagcccccaaactcctcatttatgacaataataagcgaccct ccggtcttcctgaccgattctctggctccaagtctggcacgtcagccaccctgggcatcaccggactccagactggggacgag gccgattattactgcggaacatgggatagcagcctgaatgccgtggtattcggcggagggacccagctcaccgttttaagttcta gaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcagtctgg ggctgaggtgaagaagccgggggcctctgtgaaggtttcctgcaaggcatctggatacaccttcaccaactactatattcactgg gtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtggtatcacaaactacgcacagaagtt ccagggcagggtcaccatgaccagagacacgtccacgagcacagtctacatggagctgagcagcctgagatctgaggacac ggccgtgtattactgtgcgcgctcttggtctaacaaactgtcttggtacaacgatggttggggtcaaggtactctggtgaccgtctc ctcaactagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 267) Amino Acid Sequence: QAVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKR PSGLPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLNAVVFGGGTQLTV LSSRGGGGSGGGGSGGGGSLEMAQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYYIHWVRQAPGQGLEWMGIIRPSGGITNYAQKFQGRVTMTRDTSTSTVYMEL SSLRSEDTAVYYCARSWSNKLSWYNDGWGQGTLVTVSSTSGQAGQHHHHHHG AYPYDVPDYAS (SEQ ID NO: 268) Light Chain DNA Sequence: caggctgtgctgactcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctggaagcagctccaa cattgggaataattatgtatcctggtaccagcagctcccaggaacagcccccaaactcctcatttatgacaataataagcgaccct ccggtcttcctgaccgattctctggctccaagtctggcacgtcagccaccctgggcatcaccggactccagactggggacgag gccgattattactgcggaacatgggatagcagcctgaatgccgtggtattcggcggagggacccagctcaccgttttaagt (SEQ ID NO: 269) Light Chain Amino Acid Sequence: QAVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKR PSGLPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLNAVVFGGGTQLTV LS (SEQ ID NO: 270) Heavy Chain DNA Sequence: caggtgcagctggtgcagtctggggctgaggtgaagaagccgggggcctctgtgaaggtttcctgcaaggcatctggatacac cttcaccaactactatattcactgggtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtgg tatcacaaactacgcacagaagttccagggcagggtcaccatgaccagagacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacacggccgtgtattactgtgcgcgctcttggtctaacaaactgtcttggtacaacgatggttggg gtcaaggtactctggtgaccgtctcctca (SEQ ID NO: 271) Heavy Chain Amino Acid Sequence: QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGQGLEWMGIIRP SGGITNYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSWSNKLSW YNDGWGQGTLVTVSS (SEQ ID NO: 272) #25 DNA Sequence: cagtctgtgttgacgcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctggaagcagctccaa cattgggaataattatgtatcctggtaccagttcctcccaggaacagcccccaaacttctcatttatgacaataatcagcgaccctc aggcattcctgaccgattctctggcttcaagtctggcacgtcagccaccctggacatcaccggactccagactggggacgagg ccgattattactgcggaacatgggataacagcctgagtgctgcagtgttcggcagagggaccaagctgaccgtcctaggttcta gaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccagatgcagctggtgcagtctgg gactgaggtgaagagggctggggcctcagtgaaggtttcctgcaaggcatctggatacaccttcaccaactactatatgcactg ggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaacctacgcacagaag ttccagggcagagtcaccatgaccagggacacgtccacgagcacagtctatatggagctgagcgacctgggatctgaggaca cggccgtgtattactgtgcgcgctcttggtctaaaactgaaggttctgatcgttggggtcaaggtactctggtgaccgtctcctcaa ctagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 273) Amino Acid Sequence: QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQFLPGTAPKLLIYDNNQR PSGIPDRFSGFKSGTSATLDITGLQTGDEADYYCGTWDNSLSAAVFGRGTKLTVLG SRGGGGSGGGGSGGGGSLEMAQMQLVQSGTEVKRAGASVKVSCKASGYTFTN YYMHWVRQAPGQGLEWMGIINPSGGSTTYAQKFQGRVTMTRDTSTSTVYMEL SDLGSEDTAVYYCARSWSKTEGSDRWGQGTLVTVSSTSGQAGQHHHHHHGAYP YDVPDYAS (SEQ ID NO: 274) Light Chain DNA Sequence: cagtctgtgttgacgcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctggaagcagctccaa cattgggaataattatgtatcctggtaccagttcctcccaggaacagcccccaaacttctcatttatgacaataatcagcgaccctc aggcattcctgaccgattctctggcttcaagtctggcacgtcagccaccctggacatcaccggactccagactggggacgagg ccgattattactgcggaacatgggataacagcctgagtgctgcagtgttcggcagagggaccaagctgaccgtcctaggt (SEQ ID NO: 275) Light Chain Amino Acid Sequence: QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQFLPGTAPKLLIYDNNQR PSGIPDRFSGFKSGTSATLDITGLQTGDEADYYCGTWDNSLSAAVFGRGTKLTVLG (SEQ ID NO: 276) Heavy Chain DNA Sequence: cagatgcagctggtgcagtctgggactgaggtgaagagggctggggcctcagtgaaggtttcctgcaaggcatctggatacac cttcaccaactactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtgg tagcacaacctacgcacagaagttccagggcagagtcaccatgaccagggacacgtccacgagcacagtctatatggagctg agcgacctgggatctgaggacacggccgtgtattactgtgcgcgctcttggtctaaaactgaaggttctgatcgttggggtcaag gtactctggtgaccgtctcctca (SEQ ID NO: 277) Heavy Chain Amino Acid Sequence: QMQLVQSGTEVKRAGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGIIN PSGGSTTYAQKFQGRVTMTRDTSTSTVYMELSDLGSEDTAVYYCARSWSKTEG SDRWGQGTLVTVSS (SEQ ID NO: 278) #26 DNA Sequence: tcctatgtgctgactcagccaccctcggtgtcagtggccccaggacagacggccaggatcacctgtgggggaaccgacatca gacgtaaaactgtccactggtaccagcagaagccaggcctggcccctgtgctggtcctctatgatgatagcgaccggccctca gggatccctgagcgattctctggctccaactctggtaacacggccaccctgaccatcagcagggtcgaaggcggggatgagg ccgactattactgtcaggtgtgggataacgataatgatcattatgtctttggacctgggaccaaggtcaccgtcctaggttctagag gtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggccgaggtccagctggtgcagtctggggc tgaggtgaagaagcctggggcctcagtaaaggtctcctgcaaggcatctggatacaccttcaccaactactatatccactgggtg cgacagacccctggagaagggcttgagtggatgggaataatcagacctagtggcggtaacacaaactacgcacagaagttcc agggcagagtcaccatgaccagggacacgtccacgcgcacggtctatatggagttgagtagcctgagatctgaggacacggc cgtgtattactgtgcgcgctcttgggacactttctctgatgaatggggtcaaggtactctggtgaccgtctcctcaactagtggcca ggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 279) Amino Acid Sequence: SYVLTQPPSVSVAPGQTARITCGGTDIRRKTVHWYQQKPGLAPVLVLYDDSDRP SGIPERFSGSNSGNTATLTISRVEGGDEADYYCQVWDNDNDHYVFGPGTKVTVL GSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGASVKVSCKASGYTFT NYYIHWVRQTPGEGLEWMGIIRPSGGNTNYAQKFQGRVTMTRDTSTRTVYMEL SSLRSEDTAVYYCARSWDTFSDEWGQGTLVTVSSTSGQAGQHHHHHHGAYPYD VPDYAS (SEQ ID NO: 280) Light Chain DNA Sequence: tcctatgtgctgactcagccaccctcggtgtcagtggccccaggacagacggccaggatcacctgtgggggaaccgacatca gacgtaaaactgtccactggtaccagcagaagccaggcctggcccctgtgctggtcctctatgatgatagcgaccggccctca gggatccctgagcgattctctggctccaactctggtaacacggccaccctgaccatcagcagggtcgaaggcggggatgagg ccgactattactgtcaggtgtgggataacgataatgatcattatgtctttggacctgggaccaaggtcaccgtcctaggt (SEQ ID NO: 281) Light Chain Amino Acid Sequence: SYVLTQPPSVSVAPGQTARITCGGTDIRRKTVHWYQQKPGLAPVLVLYDDSDRP SGIPERFSGSNSGNTATLTISRVEGGDEADYYCQVWDNDNDHYVFGPGTKVTVLG (SEQ ID NO: 282) Heavy Chain DNA Sequence: gaggtccagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtaaaggtctcctgcaaggcatctggataca ccttcaccaactactatatccactgggtgcgacagacccctggagaagggcttgagtggatgggaataatcagacctagtggcg gtaacacaaactacgcacagaagttccagggcagagtcaccatgaccagggacacgtccacgcgcacggtctatatggagtt gagtagcctgagatctgaggacacggccgtgtattactgtgcgcgctcttgggacactttctctgatgaatggggtcaaggtact ctggtgaccgtctcctca (SEQ ID NO: 283) Heavy Chain Amino Acid Sequence: EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVRQTPGEGLEWMGIIRPS GGNTNYAQKFQGRVTMTRDTSTRTVYMELSSLRSEDTAVYYCARSWDTFSDE WGQGTLVTVSS (SEQ ID NO: 284) #29 DNA Sequence: cagtctgtgttgacgcagccgccctcagtgtctgcggccccaagacagaaggtcaccatctcctgctctggaagcagctccaac attgggaataattatgtatcctggtaccagcagctcccaggaacagcccccaaactcctcatttatgacgataataagcgaccctc agggattcctgaccgattctctggctccaagtctggcacgtcagccaccctgggcatcaccggactccagactggggacgagg ccgattattactgcggaacatgggatagcagcctgagtgctgtggtattcggcggagggaccaagctgaccgtcctaggttcta gaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcagtctgg gactgaggtgaagagggctggggcctcagtgaaggtttcctgcaaggcatctggatacaccttcaccaactactatatgcactg ggtgcgacaggcccctggacaagggctggaatggatgggaataatcaaccctagtattggtagcacaaactacgcacagaag ttccagggcagagtcaccatgaccagagacacgtccacgagcacagtcttcatggaactgagcagcctcagatctgacgacac ggccgtgtattactgtgcgcgctctttcggtgactctgacggtgctgattcttggggtcaaggtactctggtgaccgtctcctcaac tagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 285) Amino Acid Sequence: QSVLTQPPSVSAAPRQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDDNKR PSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAVVFGGGTKLTVLG SRGGGGSGGGGSGGGGSLEMA QVQLVQSGTEVKRAGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGIIN PSIGSTNYAQKFQGRVTMTRDTSTSTVFMELSSLRSDDTAVYYCARSFGDSDGA DSWGQGTLVTVSS TSGQAGQHHHHHHGAYPYDVPDYAS (SEQ ID NO: 286) Light Chain DNA Sequence: cagtctgtgttgacgcagccgccctcagtgtctgcggccccaagacagaaggtcaccatctcctgctctggaagcagctccaac attgggaataattatgtatcctggtaccagcagctcccaggaacagcccccaaactcctcatttatgacgataataagcgaccctc agggattcctgaccgattctctggctccaagtctggcacgtcagccaccctgggcatcaccggactccagactggggacgagg ccgattattactgcggaacatgggatagcagcctgagtgctgtggtattcggcggagggaccaagctgaccgtcctaggt (SEQ ID NO: 287) Light Chain Amino Acid Sequence: QSVLTQPPSVSAAPRQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDDNKR PSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAVVFGGGTKLTVLG (SEQ ID NO: 288) Heavy Chain DNA Sequence: caggtgcagctggtgcagtctgggactgaggtgaagagggctggggcctcagtgaaggtttcctgcaaggcatctggatacac cttcaccaactactatatgcactgggtgcgacaggcccctggacaagggctggaatggatgggaataatcaaccctagtattgg tagcacaaactacgcacagaagttccagggcagagtcaccatgaccagagacacgtccacgagcacagtcttcatggaactg agcagcctcagatctgacgacacggccgtgtattactgtgcgcgctctttcggtgactctgacggtgctgattcttggggtcaag gtactctggtgaccgtctcctca (SEQ ID NO: 289) Heavy Chain Amino Acid Sequence: QVQLVQSGTEVKRAGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGIIN PSIGSTNYAQKFQGRVTMTRDTSTSTVFMELSSLRSDDTAVYYCARSFGDSDGA DSWGQGTLVTVSS (SEQ ID NO: 290) #30 DNA Sequence: tcctatgtgctgactcagccaccctcggtgtcagtggccccaggacagacggccaggatgacctgtgaaggaagcaaccttgg aagtaaaagtgtgcattggtaccagcagaagccaggccaggcccctgtgctggtcgtccatgatgatagcgaccggccctcag ggatccctgaccgattctctggctccaagtctgggaacacggccaccctgaccatcagcagggtcgaagccggggatgaggc cgactattactgtcaggtgtggcatagtagtagtgatcattatgtcttcggaactgcgaccaaggtcaccgtcctaggt tctagaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcc caggtgcagctggtgcaatctggggctgaggtgaagaagcctggggcctctgtgaaggtttcctgcaaggcatctggatacac cttcaccaattactatattcactgggtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtggt atcacaaactacgcacagaagttccagggcagggtcagcatgaccagggacacgtccacgagcacagtctacatggagctga gcagcctgagatctgaggacactgccgtgtattactgtgcgcgctcttggcatgaaaactctggtgttgattcttggggtcaaggt actctggtgaccgtctcctca actagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 291) Amino Acid Sequence: QSVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRP SGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHYVFGTGTKVTVL GSRGGGGSGGGGSGGGGSLEMAEVQLVESGGGVVQPGRSLRLSCAASGFTFNN HAMHWVRQAPGKGLEWVAVISFDGDDKFYADSVKGRFTISRDNSRNTLFLQM NNLRPEDTAVYYCSRDPYHFASGSYSYFDYWGQGTLVTVSSTSGQAGQHHHHH HGAYPYDVPDYAS (SEQ ID NO: 292) Light Chain DNA Sequence: tcctatgtgctgactcagccaccctcggtgtcagtggccccaggacagacggccaggatgacctgtgaaggaagcaaccttgg aagtaaaagtgtgcattggtaccagcagaagccaggccaggcccctgtgctggtcgtccatgatgatagcgaccggccctcag ggatccctgaccgattctctggctccaagtctgggaacacggccaccctgaccatcagcagggtcgaagccggggatgaggc cgactattactgtcaggtgtggcatagtagtagtgatcattatgtcttcggaactgcgaccaaggtcaccgtcctaggt (SEQ ID NO: 293) Light Chain Amino Acid Sequence: QSVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRP SGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHYVFGTGTKVTVLG (SEQ ID NO: 294) Heavy Chain DNA Sequence: caggtgcagctggtgcaatctggggctgaggtgaagaagcctggggcctctgtgaaggtttcctgcaaggcatctggatacac cttcaccaattactatattcactgggtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtggt atcacaaactacgcacagaagttccagggcagggtcagcatgaccagggacacgtccacgagcacagtctacatggagctga gcagcctgagatctgaggacactgccgtgtattactgtgcgcgctcttggcatgaaaactctggtgttgattcttggggtcaaggt actctggtgaccgtctcctca (SEQ ID NO: 295) Heavy Chain Amino Acid Sequence: EVQLVESGGGVVQPGRSLRLSCAASGFTFNNHAMHWVRQAPGKGLEWVAVISF DGDDKFYADSVKGRFTISRDNSRNTLFLQMNNLRPEDTAVYYCSRDPYHFASGS YSYFDYWGQGTLVTVSS (SEQ ID NO: 296) #34 DNA Sequence: caatctgccctgactcagcctccctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtgcttataactatgtctcctggtaccaacactacccaggcaaagcccccaaactcatgatttatgaggtcagtgagcggcc ctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatga ggctgattatttctgcagctcatatgcgggcagcaacaattttgtcttcggaactgggaccaaggtcaccgtcctaggttctagag gtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggccgaggtccagctggtgcagtctggggc tgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaaggcttctggaggcaccttcagcagctatgctatcagctgggt gcgacaggcccctggacaagggcttgagtggatgggaaggatcatccctatccttggtatagcaaactacgcacagaagttcc agggcagagtcacgattaccgcggacaaatcctcgagcacagcctacatggcgctgagcagcctgacatctgaggacacgg ccgtgtattactgtgcgagagggggtgactacgtcgagtcctggttcgacccctggggccagggaaccctggtcaccgtctcct caactagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 297) Amino Acid Sequence: QSALTQPPSASGSPGQSVTISCTGTSSDVGAYNYVSWYQHYPGKAPKLMIYEVS ERPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYFCSSYAGSNNFVFGTGTKVT VLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGSSVKVSCKASGGTF SSYAISWVRQAPGQGLEWMGRIIPILGIANYAQKFQGRVTITADKSSSTAYMALS SLTSEDTAVYYCARGGDYVESWFDPWGQGTLVTVSSTSGQAGQHHHHHHGAYP YDVPDYAS (SEQ ID NO: 298) Light Chain DNA Sequence: caatctgccctgactcagcctccctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtgcttataactatgtctcctggtaccaacactacccaggcaaagcccccaaactcatgatttatgaggtcagtgagcggcc ctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatga ggctgattatttctgcagctcatatgcgggcagcaacaattttgtcttcggaactgggaccaaggtcaccgtcctaggt (SEQ ID NO: 299) Light Chain Amino Acid Sequence: QSALTQPPSASGSPGQSVTISCTGTSSDVGAYNYVSWYQHYPGKAPKLMIYEVS ERPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYFCSSYAGSNNFVFGTGTKVT VLG (SEQ ID NO: 300) Heavy Chain DNA Sequence: gaggtccagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaaggcttctggaggca ccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttgagtggatgggaaggatcatccctatccttg gtatagcaaactacgcacagaagttccagggcagagtcacgattaccgcggacaaatcctcgagcacagcctacatggcgct gagcagcctgacatctgaggacacggccgtgtattactgtgcgagagggggtgactacgtcgagtcctggttcgacccctggg gccagggaaccctggtcaccgtctcctca (SEQ ID NO: 301) Heavy Chain Amino Acid Sequence: EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGRIIPI LGIANYAQKFQGRVTITADKSSSTAYMALSSLTSEDTAVYYCARGGDYVESWF DPWGQGTLVTVSS (SEQ ID NO: 302) #55 DNA Sequence: caatctgccctgactcagcctgcctccgtgtctgggtctcctggacagtcgatcaccatctcctgcactggacccaccagtgactt taatgattatctctttgtctcctggtaccaacaacacccaggcaaagcccccaaactcatcctttatgatgtcactcatcggccctca ggggtttctggtcgcttctctggctccaagtctgccagcacggcctccctgaccatctctgggctccaggctgaggacgaggct gattatttctgcggctcaaaaacaggcaggaccacttatgtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtg gtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcaatctggagctga ggtgaagaagcctggggcctcagtaaaggtctcctgcaaggcttctggttacacctttgacaactttggtatcagctgggtgcga caggcccctggacaagggcttgagtggatgggatggatcaacacttacgatggttacacaaactatgtagagaaactccaggg cagagtcaccatgaccacagacacatccacgggcacagcctacatggagctgaggggcctgagatctgacgacacggccgt gtattactgtgcgcgctctgttccgcatcagatctcttacggtgatctgtggggtcaaggtactctggtgaccgtctcctcaactagt ggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct (SEQ ID NO: 303) Amino Acid Sequence: QSALTQPASVSGSPGQSITISCTGPTSDFNDYLFVSWYQQHPGKAPKLILYDVTH RPSGVSGRFSGSKSASTASLTISGLQAEDEADYFCGSKTGRTTYVFGTGTKVTVL GSRGGGGSGGGGSGGGGSLEMAQVQLVQSGAEVKKPGASVKVSCKASGYTFD NFGISWVRQAPGQGLEWMGWINTYDGYTNYVEKLQGRVTMTTDTSTGTAYME LRGLRSDDTAVYYCARSVPHQISYGDLWGQGTLVTVSSTSGQAGQHHHHHHGA YPYDVPDYAS (SEQ ID NO: 304) Light Chain DNA Sequence: caatctgccctgactcagcctgcctccgtgtctgggtctcctggacagtcgatcaccatctcctgcactggacccaccagtgactt taatgattatctctttgtctcctggtaccaacaacacccaggcaaagcccccaaactcatcctttatgatgtcactcatcggccctca ggggtttctggtcgcttctctggctccaagtctgccagcacggcctccctgaccatctctgggctccaggctgaggacgaggct gattatttctgcggctcaaaaacaggcaggaccacttatgtcttcggaactgggaccaaggtcaccgtcctaggt (SEQ ID NO: 305) Light Chain Amino Acid Sequence: QSALTQPASVSGSPGQSITISCTGPTSDFNDYLFVSWYQQHPGKAPKLILYDVTH RPSGVSGRFSGSKSASTASLTISGLQAEDEADYFCGSKTGRTTYVFGTGTKVTVLG (SEQ ID NO: 306) Heavy Chain DNA Sequence: caggtgcagctggtgcaatctggagctgaggtgaagaagcctggggcctcagtaaaggtctcctgcaaggcttctggttacac ctttgacaactttggtatcagctgggtgcgacaggcccctggacaagggcttgagtggatgggatggatcaacacttacgatggt tacacaaactatgtagagaaactccagggcagagtcaccatgaccacagacacatccacgggcacagcctacatggagctga ggggcctgagatctgacgacacggccgtgtattactgtgcgcgctctgttccgcatcagatctcttacggtgatctgtggggtca aggtactctggtgaccgtctcctca (SEQ ID NO: 307) Heavy Chain Amino Acid Sequence: QVQLVQSGAEVKKPGASVKVSCKASGYTFDNFGISWVRQAPGQGLEWMGWIN TYDGYTNYVEKLQGRVTMTTDTSTGTAYMELRGLRSDDTAVYYCARSVPHQIS YGDLWGQGTLVTVSS (SEQ ID NO: 308)
(648) TABLE-US-00020 APPENDIX D EXT019-04 DNA Sequence (SEQ ID NO: 309) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) CAGCCTGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACA ACATTGGAAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGATAGTAGTAGTGATCATCCGGTATTCGGCGGAGG GACCAAGCTGACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCTTCT GGAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGG ATCATCCCTATCTTTGGTACAGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCCAC GAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGCGCTCTTCTTAC TGGTGGACTTCTGATCGTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (SEQ ID NO: 310) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) QPVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEA GDEADYYCQVWDSSSDHPVFGGGTKLTVLG (light chain variable region) SRGGGGSGGGGSGGGGSLEMA (scFv linker) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTST AYMELSSLRSEDTAVYYCARSSYWWTSDRWGQGTLVTVSS (heavy chain variable region) TSGQAGQHHHHHHGAYPYDVPDYAS (His tag .sup.+ HA tag) EXT019-06 DNA Sequence (SEQ ID NO: 311) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) CAGTCTGTCGTGACGCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGGGGGTCACCATCCCCTGCACTGGGAGC AGCTCCAACATCGGGGCAGGTTATGATGTACACTGGTACCAGCAGCTTCCAGGGACAGCCCCCAAACTCCTCATCTA TGGTAACAACAATCGGCCCTCAGGGGTCCCTGACCGCTTCTCTGGCTCCAGGTCTGGCTCCTCAGCCTCCCTGGCCA TCACTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGCCAGTCCTATGACAGCAGCCTGAGTGATGTGGTATTC GGCGGAGGGACCAAGCTGACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) GAGGTGCAGCTGGTGCAGTCTGGAGCAGAGGTGAAAAAGCCGGGGGAGTCTCTGAAGATCTCCTGTAAGGGTTCT GGATACAACTTTGCCAGCGAGTGGATCGGATGGGTCCGCCAGATGCCCGGGAAAGGCCTGGAGTGGATGGGACTG ATCTATCCTGCTGAATCTGAAATCACATACAGCCCGTCCTTCCAAGGCCAGGTCACCATTTCAGTCGACAAGTCCATC AGCACCGCCTACCTGCAGTGGAGCAGCCTGAAGGCCTCGGACACCGCCATGTATTACTGTGCGCGCGCTTGGGACG CTAACTACATCTACATGGATATCTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) QSVVTQPPSVSGAPGQGVTIPCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSRSGSSASLAITG LQAEDEADYYCQSYDSSLSDVVFGGGTKLTVLG [SEQ ID NO: 110] SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135] EVQLVQSGAEVKKPGESLKISCKGSGYNFASEWIGWVRQMPGKGLEWMGLIYPAESEITYSPSFQGQVTISVDKSISTA YLQWSSLKASDTAMYYCARAWDANYIYMDIWGQGTLVTVSS [SEQ ID NO: 109] TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141] QSVVTQPPSVSGAPGQGVTIPCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSRSGSSASLAITG LQAEDEADYYCQSYDSSLSDVVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCK GSGYNFASEWIGWVRQMPGKGLEWMGLIYPAESEITYSPSFQGQVTISVDKSISTAYLQWSSLKASDTAMYYCARAWD ANYIYMDIWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 129] EXT019-08 DNA Sequence (SEQ ID NO: 312) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) CAGTCTGTGTTGACTCAGCCACCCTCGGTGTCTGAAGCCCCCAGGCAGAGGGTCACCATCTCCTGTTCTGGAAGCA GCTCCAACATCGGAAATAATGCTGTAAACTGGTACCAGCAGCTCCCAGGAAAGGCTCCCAAACTCCTCATCTATTAT GATGATCTGCTGCCCTCAGGGGTCTCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAG TGGGCTCCAGTCTGAGGATGAGGCTGATTATTACTGTGCAGCATGGGATGACAGCCTGAATGGTCCTGTCTTCGGA ACTGGGACCAAGGTCACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) GAGGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCT GGTTACAACTTTACCAGTTATGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGA TCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACG AGCACAGCCTACATGGAGTTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGACTGGGATT ACGATTTTTTGACTGGGTGGGACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (SEQ ID NO: 313) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) QSVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWYQQLPGKAPKLLIYYDDLLPSGVSDRFSGSKSGTSASLAISGL QSEDEADYYCAAWDDSLNGPVFGTGTKVTVLG (light chain variable region) SRGGGGSGGGGSGGGGSLEMA (scFv linker) EVQLVQSGAEVKKPGASVKVSCKASGYNFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTS TAYMELRSLRSDDTAVYYCARDWDYDFLTGWDGMDVWGQGTTVTVSS (heavy chain variable region) TSGQAGQHHHHHHGAYPYDVPDYAS (His tag .sup.+ HA tag) EXT019-09 DNA Sequence (SEQ ID NO: 314) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) TCCTATGAGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACA ACATTGGAAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGATAGTAGTAGTGATCATTGGGTGTTCGGCGGAGG GACCAAGCTGACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTGCAGCTGGTGCAATCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCTGAAACTCTCCTGTGCAGCCTCTG GGTTCGCCTTCAGCGGCTCTTCTCTGCACTGGGTCCGCCAGGCTTCCGGGAAAGGGCTGGAGTGGGTTGGCCGTAT TACAAGCAAAGCTTACAATTACGCGACACTATATGCTGCGTCGGTGAAAGGCAGGTTCACCATCTCCAGAGATGATT CAAAGAACACGGCATATCTTCAGATGAACAGCCTGCAAACCGAGGACACGGCCGTGTATTACTGTACCCAGACTGG GGACTCATCAGCCTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDHWVFGGGTKLTVLG [SEQ ID NO: 112] SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135] QVQLVQSGGGLVQPGGSLKLSCAASGFAFSGSSLHWVRQASGKGLEWVGRITSKAYNYATLYAASVKGRFTISRDDSK NTAYLQMNSLQTEDTAVYYCTQTGDSSAYWGQGTLVTVSS [SEQ ID NO: 111] TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141] SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDHWVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQVQLVQSGGGLVQPGGSLKLSCAAS GFAFSGSSLHWVRQASGKGLEWVGRITSKAYNYATLYAASVKGRFTISRDDSKNTAYLQMNSLQTEDTAVYYCTQTGD SSAYWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 130] EXT019-12 DNA Sequence (SEQ ID NO: 315) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) TCCTATGAGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACA ACATTGGAAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGATAGTAGTAGTGATCATCGAGTGTTCGGCGGAGG GACCAAGGTCACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCT GGATTCACTTTTAGTAGTTATTGGATGAATTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTGGCCAACA TAAAGCAAGATGGAAGTGAGAAAAACTATGTGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAA GAATTCACTGTATCTGCAAATGAATAGCCTGAGAGGCGAGGACACGGCCGTATATTACTGTGCGCGCTACGGTGGT GGTCCGTACGATTCTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDHRVFGGGTKVTVLG [SEQ ID NO: 114] SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135] EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVANIKQDGSEKNYVDSVKGRFTISRDNAKN SLYLQMNSLRGEDTAVYYCARYGGGPYDSWGQGTLVTVSS [SEQ ID NO: 113] TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141] SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDHRVFGGGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVESGGGLVQPGGSLRLSCAAS GFTFSSYWMNWVRQAPGKGLEWVANIKQDGSEKNYVDSVKGRFTISRDNAKNSLYLQMNSLRGEDTAVYYCARYGGG PYDSWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 131] EXT019-13 DNA Sequence (SEQ ID NO: 316) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) CTGCCTGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACA ACATTGGAAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGATAGTAGTAGTGCCTATGTCTTCGGAACTGGGAC CAAGGTCACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTACAGCTGCAGCAGTCAGGTCCAGGACTGGTGAAGCCCTCGCAGACCCTCTCACTCACCTGTGCCATCTCCG GGGACAGTGTCTCTAGCAACAGTGCTGCTTGGAACTGGATCAGGCAGTCCCCATCGAGAGGCCTTGAGTGGCTGGG AAGGACATACTACAGGTCCAAGTGGTATAATGATTATGCAGTATCTGTGAAAAGTCGAATAACCATCAACCCAGACA CATCCAAGAACCAGTTCTCCCTGCAGCTGAACTCTGTGACTCCCGAGGACACGGCTGTGTATTACTGTGCGCGCTAC TACTCTACTTCTCTGGATTCTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (SEQ ID NO: 317) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) LPVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSAYVFGTGTKVTVLG (light chain variable region) SRGGGGSGGGGSGGGGSLEMA (scFv linker) QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTS KNQFSLQLNSVTPEDTAVYYCARYYSTSLDSWGQGTLVTVSS (heavy chain variable region) TSGQAGQHHHHHHGAYPYDVPDYAS (His tag .sup.+ HA tag) EXT019-15 DNA Sequence (SEQ ID NO: 318) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) TCCTATGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCGGGAGAGACGGCCAGTATTACCTGTGGGGCCAACA ACATTGGAAGTGAGAGTGTGCACTGGTATCAGCAGAAGTCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGGTCCAACTCTGACAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGAGATGAGGCCGACTATTACTGTCAGGTTTGGGATCATATTAATGATCATTATGTCTTCGGAAGTGGG ACCAAGGTCACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGCACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCC GGATTCTCTTTTAGCAACTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGACGGGGCTGGAGTGGGTCGCAGGTA TTAGCGGTAGAGGTGGGAGTATACATTACGCAGACTCCGTGAAGGGTCGGTTCACCATCTCCAGAGACAATTCCCA GAGCACGGTCTTTCTGCAAATGAACAACCTGGGAGCCGAGGACACGGCCATATACTACTGTGCGAAATCGAGCGAG GACTATTACTTCTATCACATGGACGCCTGGGGCATTGGGACCACGGTCACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) SYVLTQPPSVSVAPGETASITCGANNIGSESVHWYQQKSGQAPVLVIYYDSDRPSGIPERFSGSNSDNTATLTISRVEAG DEADYYCQVWDHINDHYVFGSGTKVTVLG [SEQ ID NO: 116] SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135] EVQLVESGGGLAQPGGSLRLSCAASGFSFSNYAMSWVRQAPGTGLEWVAGISGRGGSIHYADSVKGRFTISRDNSQS TVFLQMNNLGAEDTAIYYCAKSSEDYYFYHMDAWGIGTTVTVSS [SEQ ID NO: 115] TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141] SYVLTQPPSVSVAPGETASITCGANNIGSESVHWYQQKSGQAPVLVIYYDSDRPSGIPERFSGSNSDNTATLTISRVEAG DEADYYCQVWDHINDHYVFGSGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVESGGGLAQPGGSLRLSCAASG FSFSNYAMSWVRQAPGTGLEWVAGISGRGGSIHYADSVKGRFTISRDNSQSTVFLQMNNLGAEDTAIYYCAKSSEDYY FYHMDAWGIGTTVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 132] EXT019-20 DNA Sequence (SEQ ID NO: 319) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) TCCTATGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACA ACATTGGAAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGATAGTAGTAGTGATCGTGTGGTATTCGGCGGAGG GACCAAGCTGACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTACAGCTGCAGCAGTCAGGTCCAGGACTGGTGAAGCCCTCGCAGACCCTCTCACTCACCTGTGCCATCTCCG GGGACAGTATCTCTAGCAAAAGTGCTGCTTGGAACTGGATCAGGCAGTCCCCATCGAGAGGCCTAGAGTGGCTGGG AAGGACATACTACAGGTCCAAGTGGTATTATGAATATGCACCATCTGTGAGAAGTCGAATAACCATCAACCGAGACA CATCCAAGAACCAGTTCTCCCTGCAACTTAACTCTGTGACTCCCGAGGACACGGCTGTATATTATTGTGCAAGATCCA CTGGGACCTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) SYVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDRVVFGGGTKLTVLG [SEQ ID NO: 118] SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135] QVQLQQSGPGLVKPSQTLSLTCAISGDSISSKSAAWNWIRQSPSRGLEWLGRTYYRSKWYYEYAPSVRSRITINRDTSK NQFSLQLNSVTPEDTAVYYCARSTGTFDYWGQGTLVTVSS [SEQ ID NO: 117] TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141] SYVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDRVVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQVQLQQSGPGLVKPSQTLSLTCAISG DSISSKSAAWNWIRQSPSRGLEWLGRTYYRSKWYYEYAPSVRSRITINRDTSKNQFSLQLNSVTPEDTAVYYCARSTGT FDYWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 133]
(649) TABLE-US-00021 APPENDIX E VL VH CDR1 VHCDR2 VH CDR3 VL CDR1 CDR2 VL CDR3 EXT019- GGTFSSYA IIPIFGTA ARSSYWWTSDR NIGSKS YDS QVWDSSSDHPV 04 (SEQ ID NO: (SEQ ID (SEQ ID NO: 327) (SEQ ID (SEQ (SEQ ID NO: 332) 21) NO: 22) NO: 42) ID NO: 43) EXT019- GYNFTSYG ISAYNGNT ARDWDYDFLTGWDGMDV SSNIGNNA YDD AAWDDSLNGPV 08 (SEQ ID NO: (SEQ ID NO: (SEQ ID NO: 328) (SEQ ID (SEQ (SEQ ID NO: 333) 323) 325) NO: 330) ID NO: 331) EXT019- VSSNSAAWN YRSKWYN ARYYSTSLDS NIGSKS YDS QVWDSSSAYV 13 (SEQ ID NO: (SEQ ID NO: (SEQ ID NO: 329) (SEQ ID (SEQ (SEQ ID NO: 334) 324) 326) NO: 42) ID NO: 43)
(650) TABLE-US-00022 APPENDIX F EXT018-02 DNA Sequence (SEQ ID NO: 335) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) CAGTCTGTCGTGACGCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGAGGGTCACCATCTCCTGCACTGGGAGC AGCTCCAACATCGGGGCAGGTTTTGATGTACACTGGTACCAGCAGCTTCCAGGAACAGCCCCCAAACTCCTCATCTA TGGTAACAGCAATCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGCCACCTCAGCCTCCCTGGCCA TCACTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGCCAGTCCTATGACAGCAGCCTGAGTGGTGTGGTATTC GGCGGAGGGACCAAGCTGACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGACTTCTG GAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGGA TCATCCCTATCTTTGGTACAGCAAACTACGCACAGAGGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCCACA AACACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGCGCGAATCTTGGT ACCTTGATGAATGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (SEQ ID NO: 336) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) QSVVTQPPSVSGAPGQRVTISCTGSSSNIGAGFDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSATSASLAITG LQAEDEA DYYCQSYDSSLSGVVFGGGTKLTVLG (light chain variable region) SRGGGGSGGGGSGGGGSLEMA (scFv linker) QVQLVQSGAEVKKPGSSVKVSCKTSGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQRFQGRVTITADESTNT VYMELSSLRSEDTAVYYCARESWYLDEWGQGTLVTVSS (heavy chain variable region) TSGQAGQHHHHHHGAYPYDVPDYAS (His tag .sup.+ HA tag) EXT018-04 DNA Sequence (SEQ ID NO: 337) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) CAGTCTGTGTTGACGCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGAGGGTCACCATCTCCTGCACTGGGAGCA ACTCCAACATCGGGGCAGATTTTGATGTACACTGGTACCAGCAGCTTCCAGGAACAGCCCCCAAGCTCCTCATCTAT GGTAACAACAATCGGCCCTCAGGGGTCCCTGACCGATTTTCTGGCTCCAAGTCTGACACCTCAGCCTCCCTGGCCAT CACTGGGCTCCAGGCTGAGGATGAGGCTGATTACTACTGCCAGTCCTATGACATCAGCCTGAATGGTTATGTCTTCG GAACTGGGACCAAGGTCACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCGCTGTCTCTG GTGGGTCCTTCAGTGATTACTACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA TCACTCATACTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCATATCAGTAGACACGTCCAAGAAC CATTTCTCCCTGAATCTGACCTCTGTGACCGCCGCGGACACGGCCGTGTATTACTGTGCGCGCTCTAACGGTTTCTA CTACGATACTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (SEQ ID NO: 338) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) QSVLTQPPSVSGAPGQRVTISCTGSNSNIGADFDVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSKSDTSASLAITG LQAEDEADYYCQSYDISLNGYVFGTGTKVTVLG (light chain variable region) SRGGGGSGGGGSGGGGSLEMA (scFv linker) QVQLQQWGAGLLKPSETLSLTCAVSGGSFSDYYWSWIRQPPGKGLEWIGEITHTGSTNYNPSLKSRVTISVDTSKNHF SLNLTSVTAADTAVYYCARSNGFYYDTWGQGTLVTVSS (heavy chain variable region) TSGQAGQHHHHHHGAYPYDVPDYAS (His tag .sup.+ HA tag) EXT018-05 DNA Sequence (SEQ ID NO: 339) (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) CAGTCTGTGTTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAAGATTACCTGTGGCGGAGACA ACATTGGAAGTAAAACTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGCACTTCTCATCTATTATGATAGT GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAATTCTGGAAATACGGCCACCCTGAGCATCAGCAGGG TCGAGGCCGGGGATGAGGCCGGCTATTTCTGTCAGGTGTGGGATGGGAGTAGTGATCATGTGATCTTCGGCGGAG GGACCAAGCTGACCGTCCTAGGT (light chain variable region) TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGATGCAGCTGGTGCAATCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCCTCT GGATTCACCTTCAGTAGCTATGCTATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTA TATCATATGATGGAAGTAATAAATACTACGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAG AACACGCTGTATCTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAGAGATCGGCATG ATTACGTTATGGACGTCTGGGGCAAAGGGACCACGGTCACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT (His tag .sup.+ HA tag) Amino Acid Sequence (light chain variable region scFv linker heavy chain variable region His tag .sup.+ HA tag) QSVLTQPPSVSVAPGKTAKITCGGDNIGSKTVHWYQQKPGQAPALLIYYDSDRPSGIPERFSGSNSGNTATLSISRVEA GDEAGYFCQVWDGSSDHVIFGGGTKLTVLG [SEQ ID NO: 120] SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135] QMQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKN TLYLQMNSLRAEDTAVYYCARDRHDYVMDVWGKGTTVTVSS [SEQ ID NO: 119] TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141] QSVLTQPPSVSVAPGKTAKITCGGDNIGSKTVHWYQQKPGQAPALLIYYDSDRPSGIPERFSGSNSGNTATLSISRVEA GDEAGYFCQVWDGSSDHVIFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQMQLVQSGGGVVQPGRSLRLSCAA SGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRHD YVMDVWGKGTTVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 134]
(651) TABLE-US-00023 APPENDIX G HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 EXT018- GGTFSSYA IIPIFGTA ARESWYLDE SSNIGAGFD GNS QSYDSSLSGVV 02 (SEQ ID (SEQ ID (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: NO: 21) NO: 22) 342) 344) NO: 13) 321) EXT018- GGSFSDYY ITHTGST ARSNGFYYDT NSNIGADFD GNN QSYDISLNGYV 04 (SEQ ID (SEQ ID (SEQ ID NO: (SEQ ID NO: (SEQ ID (SEQ ID NO: NO: 340) NO: 341) 343) 320) NO: 61) 322)