GLYCOPEPTIDES AND USES THEREOF
20240294595 ยท 2024-09-05
Inventors
- Robin L. Polt (Tucson, AZ)
- Torsten A E Falk (Tucson, AZ, US)
- Michael L. Heien (Tucson, AZ)
- John Streicher (Tucson, AZ, US)
Cpc classification
C07K14/57563
CHEMISTRY; METALLURGY
International classification
Abstract
Glycopeptides comprising a peptide that is covalently linked to a saccharide. The peptide portion of the glycopeptides of the invention has from about 20 to about 40 amino acid residues and at least 75% sequence identity to SEQ ID NO:5. The saccharide moiety portion of the glycopeptides of the present invention comprises from 1 to about 8 carbohydrates. The present invention also relates to using the glycopeptides of the invention in treating various neurodegenerative diseases.
Claims
1. A glycopeptide comprising a polypeptide and one or more saccharide moieties covalently linked to said polypeptide, said glycopeptide being capable of crossing human blood brain barrier (BBB), said polypeptide having a sequence of: TABLE-US-00008 (SEQIDNO:5) HSDX.sup.4X.sup.5FX.sup.7DSYSRYRKQX.sup.17AVKKYLAAX.sup.26X.sup.27x.sup.28 wherein X.sup.4 is glycine; alanine; D-alanine; sarcosine; ?-alanine; or diaminovaleric acid; X.sup.5 is isoleucine; valine; leucine; L-tert-Leucine; L-nor-Valine; L-Nor-Leucine; glycine; sarcosine; D- or L-alanine; or D- or L-N-methylalanine; X.sup.7 is threonine or alanine; X.sup.17 is L-Nor-Leucine, L-Leucine; Valine; Nor-Valine; Alanine; or another aliphatic amino acid, or Glycine; X.sup.26 is valine or leucine; X.sup.27 is leucine or serine; and X.sup.28 is absent or serine, and wherein at least one amino acid residue of said polypeptide is glycosylated.
2. The glycopeptide of claim 1, wherein serine at 2-position is (D)-isomer.
3. The glycopeptide of claim 1, wherein X.sup.28 is serine.
4. The glycopeptide of claim 3, wherein X.sup.28 is glycosylated with glucose, galactose, melibiose, xylose, lactose, trehalose, or altose.
5. The glycopeptide of claim 1, wherein X.sup.17 is L-Nor-Leucine, or L-Leucine.
6. The glycopeptide of claim 1, wherein X.sup.17 is L-Leucine.
7. The glycopeptide of claim 1, wherein said polypeptide has a sequence selected from the group consisting of: TABLE-US-00009 (SEQIDNO6) HSDGIFTDSYSRYRKQLAVKKYLAAVL-Ser-CONH.sub.2, and (SEQIDNO7) HSDGIFTDSYSRYRKQLAVKKYLAAVL-Ser-CONH.sub.2, wherein Ser-28 and at least one amino acid other than Ser-28 are glycosylated.
8. The glycopeptide of claim 1, wherein said glycopeptide is a pituitary adenylate cyclase-activating polypeptide type I receptor (PAC1) agonist.
9. The glycopeptide of claim 1, wherein said glycopeptide is a VPAC.sub.1 agonist.
10. The glycopeptide of claim 1, wherein said glycopeptide is a selective PAC1 and VPAC1 agonist.
11. The glycopeptide of claim 1, wherein PAC1 binding affinity (Ki) of said glycopeptide is less than about 10 nM.
12. The glycopeptide of claim 1, wherein VPAC1 binding affinity (Ki) of said glycopeptide is less than about 10 nM.
13. The glycopeptide of claim 1, wherein said polypeptide comprises more than one glycosylated amino acid residue.
14. The glycopeptide of claim 1, wherein said saccharide is selected from the group consisting of glucose, maltose, lactose, melibiose, maltotriose, sucrose, trehalose, altose, saccharose, maltose, cellobiose, gentibiose, isomaltose, primeveose, galactose, xylose, mannose, manosaminic acid, fucose, GalNAc, GlcNAc, idose, iduronic acid, glucuronic acid, sialic acid, and polysaccharides related to the Thompsen-Friedrich antigens (Tn).
15. The glycopeptide of claim 1, wherein said glycopeptide is capable of penetrating blood-brain barrier (BBB) and reaching a CSF concentration of at least 50 nM, or 100 nM, or 400 nM 60 minutes after being injected into a subject intravenously at a concentration of 15 mg glycopeptide per kg body weight of said subject.
16. A method for treating a neurodegenerative disease in a subject, said method comprising administering to the subject in need of such a treatment a therapeutically effective amount of a glycopeptide of claim 1.
17. The method of claim 16, wherein said glycopeptide has a higher blood-brain barrier (BBB) penetration compared to said peptide in the absence of said saccharide.
18. The method of claim 16, wherein said glycopeptide is capable of penetrating blood-brain barrier (BBB) and reaching a CSF concentration of at least 50 nM, or 100 nM, or 400 nM 60 minutes after being injected into a subject intravenously or subcutaneously at a concentration of 15 mg glycopeptide per kg body weight of said subject.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
DETAILED DESCRIPTION OF THE INVENTION
[0060] As used in this specification and the appended claims, the singular forms a, an and the include plural references unless the content clearly dictates otherwise.
[0061] The terms saccharide and carbohydrate are used interchangeably herein and refer to aldoses and ketoses consisting of carbon (C), hydrogen (H) and oxygen (O) atoms, typically, but not necessarily, with a hydrogen-oxygen atom ratio of 2:1. The term also includes mono-deoxy-carbohydrates, such as deoxyribose, etc. where one hydroxy group is removed from the empirical formula C.sub.m(H.sub.2O).sub.n formula, where m is typically 6 and n can be 5 or 6.
[0062] The terms sugar refers to a mono- and/or disaccharide.
[0063] The term monosaccharide refers to any type of hexose of the formula C.sub.6H.sub.12O.sub.6 or a derivative thereof. The ring structure (i.e., ring type) of the monosaccharide can be a pyranose or a furanose. In addition, the monosaccharides can be an ?- or ?-anomer. Monosaccharide can be a ketonic monosaccharide (i.e., ketose), an aldehyde monosaccharide (i.e., aldose), or any type of hexose of the formula C.sub.6H.sub.12O.sub.6 or a derivative thereof. Exemplary aldoses of the invention include, but are not limited to, allose, altrose, glucose, mannose, gulose, idose, galactose, talose, ribose, arabinose, xylose, lyxose, and derivatives thereof. Exemplary ketoses of the invention include, but are not limited to, psicose, fructose, sorbose, tagatose, ribulose, xylulose, and derivatives thereof. As used herein the term derivative refers to a derivative of a monosaccharide in which one or more of the hydroxyl groups is replaced with hydrogen (e.g., 2-deoxy glucose, 5-deoxyglucose, etc.), an amine (e.g., amino sugars) or is replaced with a halogen, such as chloro, fluoro or iodo, (e.g., 5-fluoroglucose, 2-fluoroglucose, 5-chrologlucose, 2-chloroglucose, etc.). Monosaccharide can be an (L)-isomer or a (D)-isomer.
[0064] The term disaccharide refers to a carbohydrate composed of two monosaccharides. It is formed when two monosaccharides are covalently linked to form a dimer. The linkage can be a (1.fwdarw.4) bond, a (1.fwdarw.6) bond, a (1.fwdarw.2) bond, etc. between the two monosaccharides. In addition, each of the monosaccharides can be independently an ?- or ?-anomer. Exemplary disaccharides that can be used in the present invention include, but are not limited to, sucrose, lactose, altose, maltose, trehalose, cellobiose, lactulose, and chitobiose, etc. Each of the monosaccharides can independently be a ketonic monosaccharide (i.e., ketose), an aldehyde monosaccharide (i.e., aldose), or any type of hexose of the formula C.sub.6H.sub.12O.sub.6 or a derivative thereof. Exemplary aldoses that can be used in preparing disaccharides of the invention include, but are not limited to, allose, altrose, glucose, mannose, gulose, idose, galactose, talose, ribose, arabinose, xylose, lyxose, and derivatives thereof. Exemplary ketoses that can be used in preparing disaccharides of the invention include, but are not limited to, psicose, fructose, sorbose, tagatose, ribulose, xylulose, and derivatives thereof. Each monosaccharide can also be independently an (L)-isomer or a (D)-isomer.
[0065] Treating or treatment of a disease includes: (1) preventing the disease, i.e., causing the clinical symptoms of the disease not to develop in a mammal that may be exposed to or predisposed to the disease but does not yet experience or display symptoms of the disease; (2) inhibiting the disease, i.e., arresting or reducing the development of the disease or its clinical symptoms; or (3) relieving the disease, i.e., causing regression of the disease or its clinical symptoms.
[0066] As used herein, the term treating, contacting or reacting when referring to a synthesis or chemical reaction means adding or mixing two or more reagents under appropriate conditions to produce the indicated and/or the desired product. It should be appreciated that the reaction which produces the indicated and/or the desired product may not necessarily result directly from the combination of two reagents which were initially added, i.e., there may be one or more intermediates which are produced in the mixture which ultimately leads to the formation of the indicated and/or the desired product.
[0067] The terms identical, identity, percent identity, percent sequence identity, and sequence identity are used interchangeably herein. In particular, in the context of comparison of two or more peptides, these terms refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm known to one skilled in the art, or by visual inspection. For example, 75% sequence identity of a peptide A compared to peptide B means, 75% of the amino acid sequences in peptide A are the same as that of the amino acid sequences of peptide B. The term also includes insertion/addition or deletion of amino acids compared to a reference peptide. Thus, 75% sequence identity of peptide A compared to peptide B can also mean that peptide A has 25% more or 25% less (i.e., ?25%) amount of amino acid residues. In particular, if peptide B has 27 amino acids, then 75% sequence identify of peptide A means peptide A can have from 21 to about 33 amino acid residues. In some embodiments, these terms are used to denote sequences which when aligned have similar (identical or conservatively replaced) amino acids in like positions or regions, where identical or conservatively replaced amino acids are those which do not alter the activity or function of the protein as compared to the starting protein. Percent sequence identity may be calculated by determining the number of residues that differ between a peptide encompassed by the present invention and a reference peptide such as SEQ ID NOS: 1, 2 or 3), taking that number and dividing it by the number of amino acids in the reference peptide (e.g., 27 or 27 amino acids), multiplying the result by 100, and subtracting that resulting number from 100. For example, a sequence having 35 amino acids with four amino acids that are different from VIP would have a percent (%) sequence identity of 89% (e.g. 100?((4/35)?100)). For a peptide having a sequence that is longer than the number of amino acids in a reference peptide, the number of residues that differ from the reference peptide will include the additional (or difference in) amino acids over (or under) 35 for purposes of the aforementioned calculation. For example, a sequence having 37 amino acids, with four amino acids different from the 35 amino acids in the reference peptide sequence and with two additional amino acids at the carboxy terminus which are not present in the reference peptide sequence, would have a total of six amino acids that differ from the reference peptide. Thus, this sequence would have a percent (%) sequence identity of 83% (e.g. 100?((6/35)?100)). The degree of sequence identity may be determined using methods well known in the art (see, for example, Wilbur, W. J. et al., Proc. Natl. Acad. Science USA, 1983, 80, 726-730 and Myers E. et al., Comput. Appl. Biosci., 1988, 4, 11-17. One program which may be used in determining the degree of similarity is the MegAlign Lipman-Pearson one pair method (using default parameters) which can be obtained from DNAstar Inc, 1128, Selfpark Street, Madison, Wisconsin, 53715, USA as part of the Lasergene system. Another program, which may be used, is Clustal W. This is a multiple sequence alignment package developed by Thompson et al. (Nucleic Acids Research, 1994, 22(22), 4673-4680) for DNA or protein sequences. Clustal W is a general purpose multiple sequence alignment program for DNA or proteins. It produces biologically meaningful multiple sequence alignments of divergent sequences. It calculates the best match for the selected sequences, and lines them up so that the identities, similarities and differences can be seen.
[0068] A therapeutically effective amount means the amount of a compound that, when administered to a mammal for treating a disease, is sufficient to effect such treatment for the disease. The therapeutically effective amount will vary depending on the compound, the disease and its severity and the age, weight, etc., of the mammal to be treated.
[0069] The term about as used herein is not intended to limit the scope of the invention but instead encompass the specified material, parameter or step as well as those that do not materially affect the basic and novel characteristics of the invention. The term about or approximately as used herein refers to being within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e. the limitations of the measurement system, i.e. the degree of precision required for a particular purpose, such as a pharmaceutical formulation. For example, about can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, about can mean a range of ?20%, typically ?10%, often ?5% and more often ?1% of a given numeric value.
[0070] The present invention provides glycopeptides that are stable and can cross the blood-brain barrier. Glycopeptides are peptides that contain carbohydrate moieties (glycans or saccharides) covalently attached to the side chains of the amino acid residues that constitute the peptide. In particular, glycopeptides of the invention include a peptide that is covalently linked to a saccharide. The peptide portion of the glycopeptide of the invention has from about 20 to about 40 amino acid residues and at least 75% sequence identity to pleiotropic peptide pituitary adenylate cyclase-activating polypeptide (PACAP) of SEQ ID NO:1 or vasoactive intestinal peptide (VIP) of SEQ ID NO:3. The saccharide portion of the glycopeptide of the invention ranges from 1 to about 8 carbohydrates.
[0071] PACAP is a neuropeptide consisting of 38 amino acids. Two forms of the PACAP are known: PACAP-38 (i.e., PACAP.sub.1-38) (SEQ ID NO:1) and PACAP-27 (i.e., PACAP.sub.1-27) (SEQ ID NO:2):
TABLE-US-00002 (SEQIDNO:1) 110203038 HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK (SEQIDNO:2) 1102027 HSDGIFTDSYSRYRKQMAVKKYLAAVL
As the name indicates, PACAP-38 is a full-length PACAP having 38 amino acid residue (i.e., SEQ ID NO:1) and PACAP-27 (i.e., amino acid residues one to twenty-seven of SEQ ID NO:1) is a shorter version of PACAP. Interestingly, PACAP-27 has a 68% homology to VIP (SEQ ID NO:3), which has 28 amino acid residues:
TABLE-US-00003 (SEQIDNO:3) 1102028 HSDAVFTDNYTRLRKQMAVKYYLNSILN
PACAP was first isolated from bovine hypothalamus, and is known to regulate the development, maintenance, function, and plasticity of the nervous system, providing neuroprotective and neurotrophic support. PACAP has been shown to activate 3 closely-related G protein coupled receptors: (i) PAC.sub.1, which has much higher affinity for PACAP, (ii) VPAC.sub.1, and (iii) VPAC.sub.2 which bind both PACAP and VIP. They are expressed on neurons, microglia, and also by many other cell types. Without being bound by any theory, it is believed constitutive expression of PACAP and its receptor PAC.sub.1 confers neuroprotection to central visceromotor neurons via the PAC.sub.1 receptor. PACAP also promotes cytodestructive functions of microglia (M1 amoeboid.fwdarw.M2 hypertrophic phenotype), thought to drive ALS disease progression via the VPAC.sub.1 receptor. Thus, the ideal drugs for neuroprotection would be PAC.sub.1 agonists at motor neurons to promote neuroprotection in case of ALS, or dopaminergic neurons in case of PD, or hippocampal neurons in case of AD, and in each case VPAC.sub.1 antagonists at microglia to reduce inflammation by maintaining the M1 (alternatively activated/resolving anti-inflammatory cells) phenotype vs. the M2 (the classical, proinflammatory macrophages) microglia phenotype or Tau-opathies.
[0072] The present invention is based at least in part in providing treatments for ALS, PD, AD, and/or HD. In one aspect of the invention, a glycopeptide that can be used to treat a neurodegenerative disease. In particular, the glycopeptide of the invention includes a peptide that is covalently linked to a saccharide. The peptide portion of the glycopeptides of the present invention has from about 20 to about 40 amino acid residues and at least 75% sequence identity to pleiotropic peptide pituitary adenylate cyclase-activating polypeptide (PACAP) of SEQ ID NOs:1 or 2; or vasoactive intestinal peptide (VIP) of SEQ ID NO:3. The saccharide portion of the glycopeptides of the invention include from 1 to about 8 carbohydrates.
[0073] In one embodiment, the glycopeptide is selected from the group consisting of PACAP.sub.1-27, PACAP.sub.1-38, VIP, [AC-His.sup.1]PACAP-27, [Ala.sup.2]PACAP-27, [Gly.sup.20]PACAP-27, and Ac-[Phe(pI).sup.6, Nle.sup.17]-PACAP.sub.1-27. It should be appreciated, the terms [Ac-His.sup.1]PACAP-27, [Ala.sup.2]PACAP-27, [Gly.sup.20]PACAP-27, and Ac-[Phe(pI).sup.6, Nle.sup.17]-PACAP.sub.1-27 have the conventional meaning well known to one skilled in the art. For example, [Ac-His.sup.1]PACAP-27 means the histidine residue 1 in PACAP-27 is acetylated; [Ala.sup.2]PACAP-27 means the second amino acid residue of PACAP-27, which is serine, is replaced by alanine; similarly [Gly.sup.20]PACAP-27 means the 20.sup.th amino acid residue of PACAP-27, namely, lysine, is replaced with glycine; and Ac-[Phe(pI).sup.6, Nle.sup.17]-PACAP.sub.1-27 means amino acid residues 6 and 17 of PACAP-27, namely, Phenylalanine and methionine, respectfully, are replaced with para-iodo phenylalanine and norleucine (Nle), respectively.
[0074] In some embodiments, the glycopeptide of the invention is a retro modified peptide. The term retro modified refers to a peptide which is made up of L-amino acids in which the amino acid residues are assembled in opposite direction to the native peptide with respect the which it is retro modified. In other embodiments, the glycopeptide of the invention is an inverso modified peptide. The term inverso modified refers to a peptide which is made up of D-amino acids in which the amino acid residues are assembled in the same direction as the native peptide with respect to which it is inverso modified. Still in other embodiments, the glycopeptide of the invention is a retro-inverso modified peptide. The term retro-inverso modified refers to a peptide which is made up of D-amino acids in which the amino acid residues are assembled in the opposite direction to the native peptide with respect to which it is retro-inverso modified. Thus, for example, if a normal (i.e., native) Link-N peptide (L-amino acids, NC direction) is HSDGIFTDSY(SEQ ID NO: 8), then Retro-inverso Link-N peptide (D-amino acids, CN direction) is: HSDGIFTDSY(SEQ ID NO: 8). Retro peptide (L-amino acids, CN direction) is: HSDGIFTDSY(SEQ ID NO: 8). And inverso peptide (D-amino acids, NC direction) is: HSDGIFTDSY(SEQ ID NO: 8). These modifications allow inter alia greater stability of peptides from enzymatic and/or hydrolytic cleavage in vivo. In some embodiments, one or more, typically one to ten, often one to five, and more often one to three amino acid residues of the glycopeptide of the invention can be a D-isomer. In one particular embodiment, a single amino acid reside is replaced with a D-isomer.
[0075] In one particular embodiment, glycopeptide [Ala.sup.2]PACAP-27 includes a D-isomer alanine, i.e., [D-Ala.sup.2]PACAP-27.
[0076] Still in another embodiment, at least one of the amino acid residues of SEQ ID NO:1, 2 or 3 is substituted with a substitution amino acid residue having a side-chain functional group that is glycosylated. Typically, the substitution amino acid residue comprises serine, threonine, hydroxyproline or a similar ethanolamine linker. As used herein, the term substitution amino acid refers an amino acid residue that is used to replace another amino acid in the same position. In contrast, the term additional amino acid residue refers to an amino acid residue that is added (i) in between two amino acid residues, (ii) at the C-terminus end of, or (iii)N-terminus end of SEQ ID NOs:1, 2 or 3. In a similar manner, the term deletion or deleted amino acid residue refers to an amino acid residue that is deleted or removed (i) from between two amino acid residues, (ii) at the C-terminus end of, or (iii)N-terminus end of SEQ ID NOs:1, 2 or 3.
[0077] In some embodiments, the glycopeptide has from about 25 to about 40, typically from about 25 to about 35, often about 25 to about 30, and more often 27 to 29 amino acid residues. In one particular embodiment, the glycopeptide has from about 25 to 30 amino acid residue and at least 75%, typically at least 80%, often at least 85%, and more often at least 90% sequence identity to SEQ ID NO:2.
[0078] Yet in other embodiments, the glycopeptide has at least 80%, typically 85%, and often 90% sequence identity to PAPAC.sub.1-27 (SEQ ID NO:2).
[0079] Still yet in another embodiment, the glycopeptide of the invention has at least 75%, typically at least 80%, often at least 85%, and more often at least 90% sequence identity to SEQ ID NO:2 and includes at least one, typically one to five, often one to three, and more often one additional amino acid residue. In one particular embodiment, glycopeptides of the invention have a 28 amino acid residue and at least 75%, typically at least 80%, often at least 85%, and more often at least 90% sequence identity to SEQ ID NO:2.
[0080] Still in other embodiments, the glycopeptide of the present invention has at least one, typically, one to ten, often one to five, and more often one to five additional amino acid residues of SEQ ID NOs:1, 2, or 3.
[0081] In yet other embodiments, the C-terminus end of the peptide is glycosylated.
[0082] Still yet in other embodiments, the glycopeptide is a pituitary adenylate cyclase-activating polypeptide type I receptor (PAC.sub.1) agonist. In other embodiments, the glycopeptide is a VPAC.sub.1 agonist. Yet in other embodiments, the glycopeptide is a selective PAC.sub.1 and VPAC.sub.1 agonist. Still in other embodiments, the glycopeptides of the invention are PAC.sub.1 agonist and VPAC.sub.1 antagonist.
[0083] Yet in other embodiments, the PAC1 binding affinity (Ki) of the glycopeptide is less than about 50 nM, typically less than about 25 nM, and often less than about 10 nM.
[0084] In other embodiments, the VPAC1 binding affinity (Ki) of the glycopeptide is less than about 50 nM, typically less than about 25 nM, and often less than about 10 nM.
[0085] Still in other embodiments, the PAC1 agonist activity (Ki) of the glycopeptide is less than about 50 nM, typically less than about 25 nM, and often less than about 10 nM.
[0086] Yet in other embodiments, the VPAC1 agonist activity (Ki) of said glycopeptide is less than about 50 nM, typically less than about 25 nM, and often less than about 10 nM.
[0087] Agonistic and/or antagonistic activity of glycopeptides of the invention can be readily determined by one skilled in the art having read the present disclosure. For example, methods described by Doan et al., in Biochemical Pharmacology, 2011, 81, pp. 552-561, as well as in the Examples section below.
[0088] Typically, the saccharide comprises from 1 to 5, often 1 to 3 carbohydrates. In one particular embodiment, the saccharide is a monosaccharide or a disaccharide.
[0089] Still yet in other embodiments, the peptide comprises a plurality of glycosylated amino acid residues, i.e., different amino acid residues are glycosylated where each saccharide linked to the amino acid residue is independently selected from those described herein. In some embodiments, 1 to 5, typically 1 to 3, often 1 or 2 different amino acid residues are glycosylated. Often one amino acid residue is glycosylated.
[0090] In some embodiments, the saccharide is selected from the group consisting of with glucose, maltose, lactose, melibiose, maltotriose, sucrose, trehalose, altose, saccharose, maltose, cellobiose, gentibiose, isomaltose, primeveose, galactose, xylose, mannose, manosaminic acid, fucose, GalNAc, GlcNAc, idose, iduronic acid, glucuronic acid, sialic acid, polysaccharides related to the Thompsen-Friedrich antigens (Tn), and other monosaccharide and a disaccharide described herein.
[0091] In one particular embodiment, the glycopeptide of the invention includes a peptide portion having at least 75% sequence identity to SEQ ID NO:2 and with 0-5, typically 0-3, often 1-3, more often 1 or 2 and most often 1 additional amino acid residue(s).
[0092] Still in other embodiments, the glycopeptide of the invention has a peptide portion that is 27 or 28 amino acid residues in length and has about six or less, typically about five or less, and often four or less amino acid residue difference compared to SEQ ID NO:2. Yet in other embodiments, the glycopeptide of the invention has a peptide portion having one additional amino acid residue compared to SEQ ID NO:2. In some embodiments, the additional amino acid residue is attached to the C-terminal end of SEQ ID NO:2. Yet in other embodiments, the additional amino acid residue is glycosylated, i.e., covalently linked to a saccharide.
[0093] In other embodiments, glycopeptide of the invention has at least 75%, typically at least 80%, often at least 85%, more often at least 90%, and most often at least 95% sequence identity to SEQ ID NO:4:
TABLE-US-00004 (SEQIDNO:4) 110202728 HSDXXFXDSYSRYRKQXAVKKYLAAXXX
As can be seen, SEQ ID NO:4 is similar to SEQ ID NO:2 with one additional amino acid residue at the c-terminal end. Still in other embodiments, glycopeptide of the invention is SEQ ID NO:4.
[0094] Methods for preparing glycopeptides of the invention can be readily apparent to one skilled in the art having read the present disclosure. One method of preparing glycopeptides of the invention is using Fmoc-based solid-phase peptide synthesis. Briefly, in this method involves covalently attaching a glycosyl group to the amino acid sequence by an O-linkage to a side chain in the address segment of the sequence. See, for example, as described by the present inventor in Tetrahedron Asymmetry, 2005, 16, pp. 65-75, and the commonly assigned U.S. Pat. No. 5,767,254, issued to the present inventor, Robin Polt, all of which are incorporated herein by reference in their entirety. An amino acid residue having a desired saccharide can be prepared using the procedure described in the above cited U.S. Pat. No. 5,767,254. The peptide portion was synthesized using a solid state synthesis procedure as described in Tetrahedron Asymmetry, 2005, 16, pp. 66-75. By adding/linking each desired amino acid to the solid phase synthesis and using a desired glycosylated amino acid at an appropriate step of the synthetic process, one can produce a wide range of glycopeptides of the invention such as those exemplified in Table 1.
[0095] Yet in another embodiment, one or more serine amino acid residue of SEQ ID NO:2 or 4 is glycosylated. In one particular embodiment, the saccharide moiety within this embodiment is independently selected from the group consisting of glucose, galactose, melibiose, xylose, lactose, trehalose, altose, or other monosaccharide or a disaccharide described herein. Yet in another particular embodiment, one or more amino acid, e.g., serine, of SEQ ID NO:2 or 4 can be independently either L- or D-isomer.
[0096] Still in another embodiment, the glycopeptide is selected from those listed in Table 1 with a proviso that at least one amino acid residue is glycosylated. As can be seen, all glycopeptides in Table 1 fall within the scope of SEQ ID NO:4.
TABLE-US-00005 TABLE1 RepresentativeglycopeptidesofSEQIDNO:4 SEQIDNO:4RepresentativeAminoAcidSequences HSDGIFTDS.sup.1YS.sup.1RYRKQLAVKKYLAAVL SEQIDNO:16 HsDGIFTDS.sup.1YS.sup.1RYRKQ
AVKKYLAAVLS*SEQIDNO:17 AcHsDGIFTDS.sup.1YS.sup.1RYRKQ
AVKKYLAAVLS*SEQIDNO:18 HsDGIFTDS.sup.1YS.sup.1RYRKQ
AVKKYLAAVS*SEQIDNO:19 HsDGIFTDS.sup.1YS.sup.1RYRKQ
AVKKYLAALS*LSEQIDNO:20 HsDGIFADSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:21 HsDGIFADSYSRYRKQ
AVKKYLAAVS*SEQIDNO:22 HsDGIFADSYSRYRKQ
AVKKYLAAVS*LSEQIDNO:23 HsDaIFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:24 HsDSarIFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:25 HsD?AIFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:26 HsDDavaIFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:27 HsDAIFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:28 HsDBIFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:29 HsDGVFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:30 HsDGLFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:31 HsDGAFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:32 HsDGtLFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:33 HsDGNvaFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:34 HsDG
FTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:35 HsDGGFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:36 HsDSarGFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:37 HsDGSarFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:38 HsDSarSarFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:39 HsDSarAFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:40 HsDASarFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:41 HsDSaraFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:42 HsDaSarFTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:43 HsDA?FTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:44 HsDa?FTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:45 HsDA?FTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:46 HsDa?FTDSYSRYRKQ
AVKKYLAAVLS*SEQIDNO:47 HSDGIFTDS.sup.1YS.sup.1RYRKQMAVKKYLAAVL
SEQIDNO:48 HSDGIFTDS.sup.1YS.sup.1RYRKQMAVKKYLAAVLS.sup.1SEQIDNO:49 HS.sup.1DGIFTDS.sup.1YS.sup.1RYRKQX.sup.17AVKKYLAAVLS.sup.1SEQIDNO:50 Hs.sup.1DGIFTDs/S.sup.1YS.sup.1RYRKQMAVKKYLAAVLS.sup.1SEQIDNO:51 HS.sup.1DGIFTDS.sup.1YS.sup.1RYRKQMAVKKYLAAVLs/S.sup.1SEQIDNO:52 HSDGIFTDS.sup.1YS.sup.1RYRKQMAVKKYLAAV
SEQIDNO:53 HSDGIFTDS.sup.1YS.sup.1RYRKQMAVKKYLAAVS.sup.1SEQIDNO:54 HS.sup.1DGIFTDS.sup.1YS.sup.1RYRKQMAVKKYLAAVS.sup.1SEQIDNO:55 Hs.sup.1DGIFTDs/S.sup.1YS.sup.1RYRKQMAVKKYLAAVS.sup.1SEQIDNO:56 HS.sup.1DGIFTDS.sup.1YS.sup.1RYRKQMAVKKYLAAVs/S.sup.1SEQIDNO:57 Mel =melibiose; s =D-Serine; ?=L-Nor-Leucine; S* =L-Ser(?-D-Glc); {hacek over (S)}=L-Ser(?-Melibiose); Sar =Sarcosine; a =D-Alanine; ?A =?-Alanine; Dava =Diaminovaleric Acid; B =?-Aminoisobuteric Acid; tL = L-tert-Leucine; Nva =L-nor-Valine; ?=L-N-Methylalanine; ?= D-N-Methylalanine; X.sup.17 =M or ?at 17-position; .sup.1 =each is optionally and independently glycosylated with glucose, galactose, melibiose, xylose, lactose, trehalose, altose, or other monosaccharide or a disaccharide described herein; and s/S =D- or L-isomer of serine, respectively. In all cases, at least one of the amino acid residue is glycosylated.
[0097] The ability of glycopeptides of the invention to cross the blood-brain barrier can be readily determined by one skilled in the art having read the present disclosure. Exemplary examples for determining the blood-brain barrier crossing can be found in the Examples section below.
[0098] In some embodiments, the in vivo plasma half-life (t.sub.1/2) of glycopeptides of the present invention is at least 20 min, typically at least 30 min, often at least 40 min and more often at least 60 min. Alternatively, the half-life of glycopeptides of the invention is at least about 600% or more, typically at least about 1200% or more, often at least about 1400% or more, and more often at least 1700% or more than the same peptide in the absence of the saccharide portion.
[0099] Still in other embodiments, the amount of blood-brain barrier crossing by glycopeptides of the invention is increased by at least about 1000%, typically at least about 1200%, often at least about 1500%, and more often at least about 1700% compared to the same peptide in the absence of the saccharide portion.
[0100] Some representative agonist data for glycopeptides of SEQ ID NO:4 are provided in Table 2 below.
TABLE-US-00006 PAC1 VPAC1 VPAC2 EC.sub.50 E.sub.Max EC.sub.50 E.sub.Max EC.sub.50 E.sub.Max Sequence (nM) (%) (nM) (%) (nM) (%) HSDGIFTDSYSRYRKQMAVKKYLAAVL 0.4, 100 14.8?1.6 100 0.35?0.16 100 0.13, 0.34 HSDGIFTDSYSRYRKQLAVKKYLAAVL-Ser(Mel) 0.57 99 0.55 102 9.4 86 HsDGIFTDSYSRYRKQ?AVKKYLAAVL-Ser(Glc) 25.5 85 1.3 90 241 104 HsDGIFTDSYSRYRKQ?AVKKYLAAV-Ser(Glc) 54.5 86 4.8 90 654 107 HsDGIFTDSYSRYRKQ?AVKKYLAAL-Ser(Glc)-L >250 ?79 5.9 93 >2500 ?95 HsDGIFADSYSRYRKQ?AVKKYLAAVL-Ser(Glc) >250 ?71 78.8 93 >2500 ?42 HsDGIFADSYSRYRKQ?AVKKYLAAV-Ser(Glc) NC NC 1366 85 NC NC HsDGIFADSYSRYRKQ?AVKKYLAAV-Ser(Glc)-L NC NC 1623 78 NC NC
[0101] Chemical stability of the glycopeptides in vivo plays an important role in the deliverability of the drugs to the site(s) of action within the brain. It is also important to know what the chemical or metabolic instabilities are in order to inform the drug design process. To this end, stability of PACAP.sub.1-27; PACAP.sub.1-27-S-G and PACAP.sub.1-27-S-L was tested. As shown in
[0102] Using CHO cells that express human PAC.sub.1 receptors, PACAP.sub.1-27, the glucoside PACAP.sub.27-S-G, and the truncated putative antagonist PACAP.sub.6-27 and its derivatives were tested as agonists using FLIPR. It was found that PACAP.sub.1-27 and PACAP.sub.1-27-S-G, the serine glucoside, activated PAC.sub.1 with high potency (0.95?0.4 nM and 5.68?2.3 nM, respectively). See
[0103] PAC.sub.1-CHO calcium flux activation was measured using FLIPR in response to 11 point concentration curves of PACAP.sub.1-27, the glucoside PACAP.sub.1-27-S-G, and the truncated derivatives (putative antagonists) of PACAP.sub.6-27. Response was measured over 10 minutes, the max-min calculated, and all data was normalized to the maximum response caused by PACAP.sub.1-27 (100%) and vehicle (0%). The mean?SEM is shown, using the mean value from each independent experiment. N=3 independent experiments performed, 3 variable non-linear curve fit using Prism. PACAP.sub.1-27 and PACAP.sub.1-27-S-G showed potent, efficacious agonist activity.
[0104] The ability of glycosylated and non-glycosylated PACAP.sub.6-27 derivatives to block activation of the PAC.sub.1 receptor by PACAP.sub.1-27 was also tested. A variable concentration mode antagonist assay versus 5 nM of PACAP.sub.1-27 in the PAC.sub.1-CHO cells was employed using FLIPR. Surprisingly, no significant antagonist activity of PACAP.sub.6-27 or any derivative at a concentration up to 1 ?M was detected. See
[0105] The ability of PACAP.sub.6-27 derivatives to block PACAP.sub.1-27 induced calcium flux was measured using FLIPR.
[0106] Fixed concentration antagonist mode experiments was performed with the peptides PACAP.sub.6-27 and PACAP.sub.6-38. It was found that PACAP.sub.6-27 caused no shift in the agonist curves, while PACAP.sub.6-38 induced a shift only at 1 ?M. See
[0107] PC12 cells are non-adherent cells, and in spite of using the poly-D-Lysine coated plates, the majority of the cells remained suspended. During the media exchange many of the cells were removed with the spent media. The remaining cells could be visually evaluated for qualitative morphological changes at the end of the treatment period, but meaningful cell quantification could not be done reliably using this approach. It was found that glucoside and lactoside PACAP.sub.1-27 derivative treatment produced neurite outgrowth and arborization when compared to vehicle treated cells.
[0108]
[0109] Endogenous PACAP peptides occur as C-terminal peptide amides that have either 27 (10%) or 38 (90%) amino acid residues, and are typically regarded as PAC.sub.1 agonists in assays using intact tissue or in cell culture. For the present studies, a separate CHO cell line expressing the PAC.sub.1 receptor individually was developed. Use of solid-phase peptide synthesis allowed a wide different glycopeptides as illustrated in Table 1 above. As can be seen, glycopeptides of the invention retained their agonist activity on PC12 cell cultures (
[0110] Pharmaceutical formulations and pharmaceutical compositions are well known in the art, and can be found, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., USA, which is hereby incorporated by reference in its entirety. Any formulations described therein or otherwise known in the art are embraced by embodiments of the disclosure.
[0111] Pharmaceutical excipients are well known in the art and include, but are not limited to, saccharides such as, for example, lactose or sucrose, mannitol or sorbitol, cellulose preparations, calcium phosphates such as tricalcium phosphate or calcium hydrogen phosphate, as well as binders, such as, starch paste such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, tragacanth, methyl cellulose, hydroxypropylmethylcellulose, sodium carboxymethylcellulose, polyvinyl pyrrolidone or combinations thereof.
[0112] In particular embodiments, pharmaceutical formulations may include the active compound described and embodied above, a pharmaceutically acceptable carrier or excipient and any number of additional or auxiliary components known in the pharmaceutical arts such as, for example, binders, fillers, disintegrating agents, sweeteners, wetting agents, colorants, sustained release agents, and the like, and in certain embodiments, the pharmaceutical composition may include one or more secondary active agents. Disintegrating agents, such as starches as described above, carboxymethyl-starch, cross-linked polyvinyl pyrrolidone, agar, alginic acid or a salt thereof, such as sodium alginate and combinations thereof. Auxiliary agents may include, for example, flow-regulating agents and lubricants, such as silica, talc, stearic acid or salts thereof, such as magnesium stearate or calcium stearate, polyethylene glycol and combinations thereof. In certain embodiments, dragee cores may be prepared with suitable coatings that are resistant to gastric juices, such as concentrated saccharide solutions, which may contain, for example, gum arabic, talc, polyvinyl pyrrolidone, polyethylene glycol, titanium dioxide, lacquer solutions and suitable organic solvents or solvent mixtures and combinations thereof. In order to produce coatings resistant to gastric juices, solutions of suitable cellulose preparations, such as acetylcellulose phthalate or hydroxypropylmethyl-cellulose phthalate may also be used. In still other embodiments, dye or pigments may be added to the tablets or dragee coatings, for example, for identification or in order to characterize combinations of active compound doses.
[0113] Pharmaceutical compositions of the disclosure can be administered to any animal, and in particular, any mammal, that may experience a beneficial effect as a result of being administered a compound of the disclosure including, but not limited to, humans, canines, felines, livestock, horses, cattle, sheep, and the like. The dosage or amount of at least one compound according to the disclosure provided pharmaceutical compositions of embodiments may vary and may depend, for example, on the use of the pharmaceutical composition, the mode of administration or delivery of the pharmaceutical composition, the disease indication being treated, the age, health, weight, etc. of the recipient, concurrent treatment, if any, frequency of treatment, and the nature of the effect desired and so on. Various embodiments of the disclosure include pharmaceutical compositions that include one or more compounds of the disclosure in an amount sufficient to treat or prevent diseases such as, for example, cancer. An effective amount of the one or more compounds may vary and may be, for example, from about 0.1 to 10 milligrams per kilo, typically 1-2 doses per day.
[0114] The pharmaceutical compositions of the disclosure can be administered by any means that achieve their intended purpose. For example, routes of administration encompassed by the disclosure include, but are not limited to, subcutaneous, intravenous, intramuscular, intraperitoneal, buccal, or ocular routes, rectally, parenterally, intrasystemically, intravaginally, topically (as by powders, ointments, drops or transdermal patch), oral, deep lung, intranasal administration or nasal spray (nebulization) are contemplated in combination with the above described compositions.
[0115] Embodiments of the disclosure also include methods for preparing pharmaceutical compositions as described above by, for example, conventional mixing, granulating, dragee-making, dissolving, lyophilizing processes and the like. For example, pharmaceutical compositions for oral use can be obtained by combining the one or more active compounds with one or more solid excipients and, optionally, grinding the mixture.
[0116] Suitable auxiliaries may then be added and the mixture may be processed to form granules which may be used to form tablets or dragee cores. Other pharmaceutical solid preparations include push-fit capsules containing granules of one or more compound of the disclosure that can, in some embodiments, be mixed, for example, with fillers, binders, lubricants, stearate, stabilizers or combinations thereof. Push-fit capsules are well known and may be made of gelatin alone or gelatin in combination with one or more plasticizer such as glycerol or sorbitol to form a soft capsule. In embodiments in which soft capsules are utilized, compounds of the disclosure may be dissolved or suspended in one or more suitable liquids, such as, fatty oils or liquid paraffin and, in some cases, one or more stabilizers.
[0117] Liquid dosage formulations suitable for oral administration are also encompassed by embodiments of the disclosure. Such embodiments, may include one or more compounds of the disclosure in pharmaceutically acceptable emulsions, solutions, suspensions, syrups, and elixirs that may contain, for example, one or more inert diluents commonly used in the art such as, but not limited to, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethyl formamide, oils (for example, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, fatty acid derivatives of glycerol (for example, labrasol), tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. Suspensions may further contain suspending agents as, for example, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar, and tragacanth, and mixtures thereof.
[0118] Formulations for parenteral administration may include one or more compounds of the disclosure in water-soluble form, for example, water-soluble salts, alkaline solutions, and cyclodextrin inclusion complexes in a physiologically acceptable diluent which may be administered by injection. Physiologically acceptable diluent of such embodiments, may include, for example, sterile liquids such as water, saline, aqueous dextrose, other pharmaceutically acceptable sugar solutions; alcohols such as ethanol, isopropanol or hexadecyl alcohol; glycols such as propylene glycol or polyethylene glycol; glycerol ketals such as 2,2-dimethyl-1,3-dioxolane-4-methanol; ethers such as poly(ethyleneglycol)400; pharmaceutically acceptable oils such as fatty acid, fatty acid ester or glyceride, or an acetylated fatty acid glyceride. In some embodiments, formulations suitable for parenteral administration may additionally include one or more pharmaceutically acceptable surfactants, such as a soap or detergent; suspending agent such as pectin, carbomers, methylcellulose, hydroxypropylmethylcellulose, or carboxymethylcellulose; an emulsifying agent; pharmaceutically acceptable adjuvants or combinations thereof. Additional pharmaceutically acceptable oils which may be useful in such formulations include those of petroleum, animal, vegetable or synthetic origin including, but not limited to, peanut oil, soybean oil, sesame oil, cottonseed oil, olive oil, sunflower oil, petrolatum, and mineral oil; fatty acids such as oleic acid, stearic acid, and isostearic acid; and fatty acid esters such as ethyl oleate and isopropyl myristate. Additional suitable detergents include, for example, fatty acid alkali metal, ammonium, and triethanolamine salts; cationic detergents such as dimethyl dialkyl ammonium halides, alkyl pyridinium halides, and alkylamine acetates; and anionic detergents, such as alkyl, aryl, and olefin sulfonates, alkyl, olefin, ether and monoglyceride sulfates, and sulfosuccinates. In some embodiments, non-ionic detergents including, but not limited to, fatty amine oxides, fatty acid alkanolamides and polyoxyethylenepolypropylene copolymers or amphoteric detergents such as alkyl-?-aminopropionates and 2-alkylimidazoline quaternary salts, and mixtures thereof may be useful in parenteral formulations of the disclosure.
[0119] Pharmaceutical compositions for parenteral administration may contain from about 0.5 to about 25% by weight of one or more of the compounds of the disclosure and from about 0.05% to about 5% suspending agent in an isotonic medium. In various embodiments, the injectable solution should be sterile and should be fluid to the extent that it can be easily loaded into a syringe. In addition, injectable pharmaceutical compositions may be stable under the conditions of manufacture and storage and may be preserved against the contaminating action of microorganisms such as bacteria and fungi.
[0120] Topical administration includes administration to the skin or mucosa, including surfaces of the lung and eye. Compositions for topical administration, may be prepared as a dry powder which may be pressurized or non-pressurized. In non-pressurized powder compositions, the active ingredients in admixture are prepared as a finely divided powder. In such embodiments, at least 95% by weight of the particles of the admixture may have an effective particle size in the range of 0.01 to 10 micrometers. In some embodiments, the finely divided admixture powder may be additionally mixed with an inert carrier such as a sugar having a larger particle size, for example, of up to 100 micrometers in diameter. Alternatively, the composition may be pressurized using a compressed gas, such as nitrogen or a liquefied gas propellant. In embodiments, in which a liquefied propellant medium is used, the propellant may be chosen such that the compound and/or an admixture including the compound do not dissolve in the propellant to any substantial extent. In some embodiments, a pressurized form of the composition may also contain a surface-active agent. The surface-active agent may be a liquid or solid non-ionic surface-active agent or may be a solid anionic surface-active agent, which in certain embodiments, may be in the form of a sodium salt.
[0121] Compositions for rectal administration may be prepared by mixing the compounds or compositions of the disclosure with suitable non-irritating excipients or carriers such as for example, cocoa butter, polyethylene glycol or a suppository wax. Such carriers may be solid at room temperature but liquid at body temperature and therefore melt in the rectum and release the drugs.
[0122] In still other embodiments, the compounds or compositions of the disclosure can be administered in the form of liposomes. Liposomes are generally derived from phospholipids or other lipid substances that form mono- or multi-lamellar hydrated liquid crystals when dispersed in an aqueous medium. Any non-toxic, physiologically acceptable and metabolizable lipid capable of forming liposomes can be used, and in particular embodiments, the lipids utilized may be natural and/or synthetic phospholipids and phosphatidyl cholines (lecithins). Methods to form liposomes are known in the art (see, for example, Prescott, Ed., Meth. Cell Biol. 14:33 (1976), which is hereby incorporated by reference in its entirety). Compositions including one or more compounds of the disclosure in liposome form can contain, for example, stabilizers, preservatives, excipients and the like.
[0123] In general, methods of embodiments of the disclosure may include the step of administering or providing an effective amount or a therapeutically effective amount of a compound or composition of the disclosure to an individual. In such embodiments, an effective amount of the compounds of the disclosure may be any amount that produces the desired effect. As described above, this amount may vary depending on, for example, the circumstances under which the compound or composition is administered (e.g., to incite treatment or prophylactically), the type of individual, the size, health, etc. of the individual and so on. The dosage may further vary based on the severity of the condition. For example, a higher dose may be administered to treat an individual with a well-developed metastatic condition, compared to the amount used to prevent a subject from developing the metastatic condition. Those skilled in the art can discern the proper dosage based on such factors. For example, in some embodiments, the dosage may be within the range of about 0.01 mg/kg body weight to about 10 mg/kg body weight.
[0124] The administration schedule may also vary. For example, in some embodiments, the compounds or compositions of the disclosure may be administered in a single dose once per day or once per week. In other embodiments, the compounds or compositions of the disclosure may be administered in one or two or more doses per day. For example, in one embodiment, an effective amount for a single day may be divided into separate dosages that may contain the same or a different amount of the compound or composition and may be administered several times throughout a single day. Without wishing to be bound by theory, the dosage per administration and frequency of administration may depend, for example, on the specific compound or composition used, the condition being treated, the severity of the condition being treated, and the age, weight, and general physical condition of the individual to which the compound or composition is administered and other medications which the individual may be taking. In another exemplary embodiment, treatment may be initiated with smaller dosages that are less than the optimum dose of the compound, and the dosage may be increased incrementally until a more optimum dosage is achieved.
[0125] In each of the embodiments above, the compound administered can be provided as a pharmaceutical composition including compound as described above and a pharmaceutically acceptable excipient or a pure form of the compound may be administered.
[0126] In additional embodiments, the compound or composition of the disclosure may be used alone or in combination with one or more additional agents. For example, in some embodiments, a compound or composition of disclosure may be formulated with one or more additional anti-cancer agents or combinations thereof such that the pharmaceutical composition obtained including the compound or composition of the disclosure and the one or more additional agents can be delivered to an individual in a single dose. In other embodiments, the compound or composition of the disclosure may be formulated as a separate pharmaceutical composition that is delivered in a separate dose from pharmaceutical compositions including the one or more additional agents. In such embodiments, two or more pharmaceutical compositions may be administered to deliver effective amounts of a compound or composition of the disclosure and the one or more additional agents.
[0127] Additional objects, advantages, and novel features of this invention will become apparent to those skilled in the art upon examination of the following examples thereof, which are not intended to be limiting. In the Examples, procedures that are constructively reduced to practice are described in the present tense, and procedures that have been carried out in the laboratory are set forth in the past tense.
EXAMPLES
Example 1 Methods and Materials
[0128] Glycopeptides of the invention were prepared using one of the following procedures.
[0129] General Method I. The C-terminal amino acids were loaded onto Fmoc-Rink resin (Advanced ChemTech, Louisville, KY, USA) at 0.1 mmol/g resin loading in 25 mL fritted syringes and dimethylformamide (?5 mL per gram resin) was added. The mixture was stirred at RT for two minutes (x2). A solution of 2% DBU and 3% piperidine in DMF (v:v) was added and the mixture was agitated for 5 minutes, refreshed, and agitated for an additional 10 minutes. The resin was washed with DMF (x5), and finally with N-methylpyrrolidine (NMP). In a separate vial, a solution of Fmoc-?-OGlc(OAc).sub.4-Ser-OH (0.12 mmol) and HOBt?H.sub.2O (0.13 mmol) in 5 mL NMP was prepared. To this solution was added DIC (0.26 mmol) and the mixture was stirred for 5 minutes. The resulting solution was added to the resin and agitated for 10 minutes. Next, the syringe was placed in a microwave oven (Emerson 900 W MicrowaveMW9338SB) and irradiated at power level 1 for 10 minutes. The syringe was then agitated at RT for an additional 30 minutes. The resin was washed with NMP (x1), DMF (x5), and CH.sub.2Cl.sub.2 (x5), and dried in vacuo overnight.
[0130] General Method II: Glycopeptides were assembled on a Prelude? Peptide Synthesizer (Protein Technologies, Inc., Tucson, AZ, USA) using the following procedure.
[0131] Rink resin (100 mg) was placed into the fritted reaction vessels. Amino acids were dissolved in DMF at 250 mM concentration, HATU at 375 mM, and TMP at 3M. The following steps were performed for coupling: DMF Top Wash (1.5 mL, 2 min mix and drain; x6), Deprotection (2% DBU/3% piperidine in DMF; 1.5 mL, 4 min mix and drain; 8 min mix and drain), DMF Top Wash (1.5 ml, 2 min mix and drain; x5), Amino Acid Building Block (0.950 mL, 30 sec mix), Activator 1 (HATU, 0.650 mL, 30 sec mix), Base (TMP, 0.300 mL, 35 min mix and drain), DMF Top Wash (1.5 mL, 2 min mix and drain; x2). After coupling aspartic acid D7, the deprotection solution was changed to 0.1 M HOBt?H.sub.2O/5% piperazine in DMF to minimize aspartimide formation.
[0132] Cleavage of the glycopeptides from the resin. The glycopeptides prepared using General Method I or II were cleaved from the resin using a mixture of trifluoroacetic acid, triethylsilane, water, methylene chloride and methoxyphenyl (9:0.3:0.2:1:0.05 by volume). Briefly, the mixture was agitated at room temperature (RT) for 2 hours. The resulting solutions were transferred to 15 mL centrifuge tubes, evaporated under argon, precipitated in ice-cold Et.sub.2O, decanted, and rewashed with Et.sub.2O, then dissolved in H.sub.2O and lyophilized to afford the crude material as fluffy white solids.
[0133] Purification of the crude glycopeptides was accomplished by Reversed Phase HPLC (RP-HPLC) with a preparative RP (C-18) Phenomenex (250?22 mm) column using a CH.sub.3CNH.sub.2O gradient solvent system containing 0.1% trifluoroacetic acid. Homogeneity of the purified glycopeptides was confirmed by analytical RP-HPLC and high resolution mass spectrometry.
Binding Assay.
[0134] Binding assay to determine PAC1, VPAC1, and VPAC2 agonist activity can be performed as described by Doan et al. in Biochem. Pharmalcol., 2011, 81, pp. 552-561. Briefly, the binding assay procedure is as follows: Acetylated PACAP.sub.27 was radio-iodinated using the chloramine-T technique (Hunter WMGF, Nature, 1962,194, pp. 495-6) and purified on a Sep-Pak C18 cartridge (Waters, Milford, MA, USA). CHO cells expressing one of the PACAP-related receptors were seeded at a density of 125,000 cells per well in 24-well plates. After 24 h, the culture medium was removed, and cells were first incubated at room temperature for 10 min in binding buffer (0.1% BSA, 25 mM Tris-HCl, 25 mM MgCl.sub.2, and 5 mg/L bacitracin, pH 7.4) and then exposed to increasing peptide concentrations in the presence of 0.05 nM .sup.125IAc-PACAP27. After 2 h at room temperature, cells were washed twice with binding buffer, lysed (0.1 M NaOH), and the cell-bound radioactivity was quantified using a g-counter (1470 Automatic Gamma Counter, Perkin Elmer). Results were expressed as the percentage of the specific binding of .sup.125IAc-PACAP27 obtained in the absence of competitive ligands. Nonspecific binding was determined in the presence of 10 mM PACAP38 and averaged at 5-10% of total binding.
Biological Assay.
[0135] The neuroprotective effects of the PAC.sub.1 agonist and the anti-inflammatory effects of the VPAC.sub.1 antagonist in cell culture models were tested. In addition, stability of peptides and BBB penetration in vivo were also tested. These tests were used to identify peptides for therapeutic candidates in vivo in preclinical models of ALS and PD.
[0136] The overall process was as follows: Flow-injection tandem mass spectrometry (FI-MS.sup.n) was used to observe the degradation of the peptides and glycopeptides with a Thermo LCQ with electrospray ionization (ESI). The technique involved injection of a sample bolus of material in mouse serum via a six port valve with fluid flow delivered via a syringe pump, and subsequent electrospray ionization (ESI) followed by mass spectral analysis. Samples were diluted to a concentration of ?5 ?M of each PACAP analogue, and were incubated at 37? C. for times varying from 1 to 60 minutes. After samples had been incubated for the prescribed amount of time they were prepared for mass spectrometry analysis by withdrawing 10 microliters of solution and spiking with 1 microliter of a 10 ?M solution of peptide internal standard (angiotensin II) in 50% acetic acid and subjecting them to a standard C18 zip tip desalting. These solutions, once eluted from the zip tip were diluted to 100 ?L in 50:50 acetonitrile/water with 0.1% formic acid. Tandem mass spectrometry analysis (MS.sup.3) was conducted to yield specific, quantitative signals proportional to the amount of PACAP analogue at each time point. This technique was also used with microdiasylate samples from a mouse after i.p. administration of PACAP1-27-S-G.
[0137] A custom DNA clone of the human PAC1 gene with 3 hemagglutinin (HA) tags inserted 3 to the signal peptide sequence (to avoid proteolytic loss) was obtained from Genecopoeia (Rockville, MD). The construct was electroporated into Chinese Hamster Ovary (CHO) cells, and selected for with 500 ?g/mL of G418. The resulting population was screened for high expressing clones, and one such clone selected for further analysis. The clonal cell line (PAC.sub.1-CHO) displayed high receptor expression by immunocytochemistry and Western blot, and showed selective activation of signaling in response to PACAP.sub.1-27. This cell line was used for all molecular pharmacology experiments. The cells were maintained in DMEM/F12 with 10% heat-inactivated FBS, 1? penicillin/streptomycin, and 500 ?g/mL G418, at 37? C. and 5% CO.sub.2.
[0138] All molecular pharmacology experiments were carried out using a FLIPR Tetra from Molecular Devices (Sunnyvale, CA), set to image calcium flux using the manufacturer's recommended settings and protocols. The day before an experiment, the PAC.sub.1-CHO cells were split into 384 well black walled, clear bottom microplates, 10,000 cells per well. The cells were recovered overnight in growth medium (as above). The next day, the growth medium was replaced with Calcium 6 dye (Molecular Devices) using the manufacturer recommended buffer with 2.5 mM probenecid. The cells were incubated for 2 hours in the culture incubator, and removed during the last 15 minutes to allow equilibration to room temperature. Compound as indicated below was added to the cells using a 384 tip block, with real time monitoring before, during, and 15 minutes after compound addition. The resulting calcium flux was recorded, and the maximum-minimum response over the entire observation time calculated and reported as the mean?SEM (4 wells per point).
[0139] For agonist mode experiments, compound was added in an 11 point concentration curve, with a vehicle control (buffer). The resulting response was normalized to the stimulation caused by PACAP.sub.1-27 (100%) and vehicle (0%). The response was analyzed using a 3 variable non-linear curve fit, and the EC.sub.50 (nM) and E.sub.Max (%) calculated and reported (Prism, GraphPad, La Jolla, CA).
[0140] For antagonist mode experiments, a concentration curve (variable concentration mode) or fixed amount (fixed concentration mode) of antagonist was added to the cells, and allowed to equilibrate for 2 minutes. Then, either a 5 nM fixed concentration (variable concentration mode) or an 11 point concentration curve (fixed concentration mode) of PACAP.sub.1-27 was added to the cells, and the max-min response recorded as above. For variable concentration mode experiments, the data was normalized to the stimulation caused by 5 nM PACAP.sub.1-27 (100%) and vehicle (0%), and analyzed with a 3 variable non-linear curve fit, with the IC.sub.50 (nM) and I.sub.Max(%) calculated and reported (Prism). For the fixed concentration mode experiments, each curve was normalized to the maximum stimulation caused by PACAP.sub.1-27 with no antagonist present (100%) and vehicle (0%). The resulting data was analyzed using a Gaddum/Schild EC.sub.50 shift model, (Schild, 1957, Gaddum, 1957) designed to analyze competitive antagonism. (Lazareno and Birdsall, 1993) The data output was the pA2 (nM) and the Schild Slope, a measure of how closely the experimental data fits the operational model of competitive antagonism (Prism). For all analyses, each independent experiment performed in quadruplicate is considered to be a sample size of 1. The pharmacology values are calculated separately from each experiment, then combined and reported as the mean?SEM for the entire set of experiments.
[0141] The PC12 cells were cultured in RPMI containing 5% heat inactivated fetal bovine serum and 10% horse serum in the presence of 100 units/mL penicillin and 100 microgram/mL streptomycin. The cells were plated on poly-D-Lysine coated 6-well tissue culture plates at a density of 150,000 cells per well in 2 mL media. After 48 hours at 37? C. in 5% CO.sub.2 atmosphere, media exchange was performed and plates were dosed, using the peptide diluent (water) for the control samples. PACAP.sub.1-27, PACAP.sub.1-27-S-G, and PACAP.sub.1-27-S-L were used to screen for PAC.sub.1 receptor activation. Four groups of cells were used; one control group (diluent treated) and three treatment groups, each treatment group was exposed to 100 nM concentrations of PACAP.sub.1-27, PACAP.sub.1-27-S-G, or PACAP.sub.1-27-s-L. All groups were run in triplicate. Cell images of each treatment group were captured and compared to the control cells to screen for differentiation and cell body volume increases. Cells having neurite-like process outgrowth were noted and photographed. The neurite-like outgrowth was deemed positive if its length was at least two times the width of the cell body.
Example 2 Synthesis of PACAP Glycopeptides
[0142] A modest library of 47 glycopeptide analogues of PACAP were successfully synthesized, purified, and characterized by HPLC and MS. The carbohydrate moieties were introduced pre-translationally by incorporation of Fmoc-Serine glycoside building blocks that were prepared using minimally competent InBr.sub.3 catalysis (Mitchell et al., 200; Lefever et al., 2012). PACAP is considered a difficult peptide sequence due to its length and presence of two dipeptide motifs within its structure that are prone to aspartimide formation (D?lling et al., 1994; Lauer et al., 1995; Subir?s-Funosas et al., 2011; Parad?s-Bas et al., 2016; Samson et al., 2019). Thus, the use of a single coupling protocol and standard Fmoc amino acid building blocks typically results in low yields and purity. We addressed these problems by utilizing several different coupling protocols for the PACAP derivatives (
TABLE-US-00007 TABLE 3 List of synthesized PACAP peptides Compound Structure 1st series 2L372-1 HSDGIFTDSY.sub.10SRYRKOLSVK.sub.20KYLAAVL-CONH 2L372-2 HSDGIFTDSY.sub.10SRYRKOLSVK.sub.20KYLAAVL-CONH
2L
72-3 HsDGIFTDSY.sub.10SRYRKOLSVK.sub.20KYLAAVL-CONH
2L
HSDGIFTDSY.sub.10SRYRKOLSVK.sub.20KYLAAVL-Ser(Glc)-CONH
2L
HSDGIFTDSY.sub.10SRYRKOLSVK.sub.20KYLAAVL-Ser(Lac
)-CONH
2L3
HSDGIFTDSY.sub.10SRYRKOLSVK.sub.20KYLAAVL-Ser(
)-CONH
2L
HSDGIFTDSY.sub.10SRYRKOLSVK.sub.20KYLAAVL-Ser(
)-CONH
2nd Series CRA3000 HsDGIFTDSY.sub.10SRYRKO-
KYLAAVL-Ser(Glc)-CONH
CRA3001 HsDGIFTDSY.sub.10SRYRKO-
KYLAAV-Ser(Glc)-CONH
CRA3002 HsDGIFTDSY.sub.10SRYRKO-
KYLAA-Ser(Glc)-L-CONH
CRA3003 HsDGIFTDSY.sub.10SRYRKO-
KYLAAVL-Ser(Glc)-CONH
CRA3004 HsDGIFTDSY.sub.10SRYRKO-
KYLAAV-Ser(Glc)-L-CONH
CRA3005 HsDGIFTDSY.sub.10SRYRKO-
KYLAA-Ser(Glc)-CONH
2L
HSDGIFTDSY.sub.10SRYRKOLAVK
KYLAAVL-Ser(
)-CONH
2L
HSDGIFTDSY.sub.10SRYRKOLAVK
KYLAAV
L-Ser(
)-CONH
2L
HSDGIFTDSY.sub.10SRYRKOLAV
KYLAAV
L-Ser(
)-CONH
3rd Series CRA3006 HsD-GABA-IFTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3007 HsD-Ser-IFTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3008 HsD-
-IFTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3009 HsD-DAVA-IFTDSY.sub.10SRYRKO-N
-AVK
KVLAAVL-Ser(Glc)-CONH
CRA3010 HsDAIFTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3011 HsD-A
-IFTDSY SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3012 HsDG
FTDST.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3013 HsDG
FTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3014 HsDGAFTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3015 HsDG-T
-FTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3016 HsDG-N
-FTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3017 HsDG-
-FTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
2L
132 HSDGIFTSDY.sub.10SRYRKOLAVK.sub.20KYLAAVLS(Lac)-DC
H
4th Series Ao-2L
132 Ao-HSDGIFTDSY.sub.10SRYRKOLAVK.sub.20KYLAAVLS(Lac)-CONH
Ao-CRA3000 Ao-HsDGIFTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3000-Lac HsDGIFTDSY.sub.10SRYRKO-N
-AVK
KYLAAVLSer (Lac)-CONH
Ao-CR
-La
. Ao-HsDGIFTDSY.sub.10SRYRKO-N
-AVK
KYLAAVLSer (
)-CONH
CRA3018 HsD-Ser-N
-FTDSY.sub.10SSRYRKO-N
-AVK
KYLAAVL-Ser(
)-CONH
Ao-CRA3018 Ao-HsD-Ser-N
-FTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3019 HsDG-D-N
-FTDSY.sub.10SRYRKO-N
-AVK.sub.20KYLAAVL-Ser(Glc)-CONH
Ao-CRA3019 Ao-HsDG-D-N
-FTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(
)-CONH
CRA3020 HsDG-D-N
-FTDSY.sub.10SRYRKO-N
-AVK
YLAAVL-Ser(
)-CONH
Ao-CRA3020 Ao-HsDG-D-N
-FTDSY
SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
CRA3021 HsD
FTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
Ao-CRA3021 Ao-HsD
FTDSY.sub.10SRYRKO-N
-AVK
KYLAAVL-Ser(Glc)-CONH
2L
140 HSDGIFTDSY.sub.10SRYRKOLAVK
KYLAAV
-Ser(Glc)-Ser(Glc)-CONH
indicates data missing or illegible when filed
Example 3 In Vivo Stability and BBB Penetration
[0143] Initial investigations into the stability of select 2nd series PACAPglycopeptides were carried out in water and in artificial cerebrospinal fluid (aCSF). The compounds remained stable in water, and they exhibited half-life values ranging between 10 and 15 min in aCSF. Selected 2LS-glycosides, namely the glucoside and lactoside, were examined for their stability in rat serum at 37? C. Upon introduction of a glucose residue (2LS72-4) the half-life was extended by approximately 15 min compared to the non-glycosylated compound. The lactose-containing glycopeptide 2LS80Lac exhibited a half-life extending greater than 1 h, suggesting that disaccharides provide a greater degree of protection from enzymatic degradation compared to a monosaccharide. Selected compounds from the 3rd series of PACAP glycopeptides were subjected to in vitro stability studies in rat serum at physiological temperatures as well (Liu et al., 2022) and unpublished results).
[0144] The d8 mass shifted analogues of 2LS72-2 and 2LS80Lac (d82LS98-OH and d82LS98Lact, respectively) were investigated for their in vivo BBB transport in rats. More specifically, a technique known as shotgun microdialysis, wherein multiple compounds are injected at one time in a single rat, was utilized to reduce the total number of animals used in the study and to mitigate subtle variations in the injection site (Mabrouk et al., 2012; Hay et al., 2019). Following i.v. injection (15 mg/kg) of d82LS98-OH and d82LS98Lact, aliquots of CSF were removed at specific time points and the concentrations of the peptides were quantified by LC-MS. A dosage of 15 mg/kg was selected due to the high detection limit in the CSF. The concentration of the un-glycosylated compound d82LS98-OH was exceptionally low, suggesting poor penetration of the BBB. However, the CSF concentration of the lactose-containing d82LS98Lact was determined to be much higher, peaking around 400 nM (
Example 4 Neuroprotection and Anti-Inflammatory Activity of the Glycopeptides
[0145] Following extensive in vitro and in vivo experiments assessing the functional activity and stability and BBB transport of our PACAP glycopeptides, two compounds were chosen for assessment in animal models of TBI and PD. More specifically, 2LS80Mel was chosen for evaluation in a rodent model of TBI, and 2LS98Lac was examined for its neuroprotective potential in the progressive 6-hydroxydopamine (6-OHDA) hemi-parkinsonian rat model.
[0146] Lead compound 2LS80Mel was evaluated for its neuroprotective potential in vivo utilizing a mouse model of traumatic brain injury (TBI). Mice were pretreated with either a single dose of 2LS80Mel (10 mg/kg i.p.) or sterile saline 30 min prior to being subjected to a midline fluid percussion injury. The mice were then evaluated for sleep-wake behavior (
[0147] Rowe and others have previously reported diffuse TBI increases post-traumatic sleep immediately following injury, and attenuation of TBI-induced sleep using pharmacological therapies improved outcomes (Rowe et al., 2014c; Rowe et al., 2018; Rowe et al., 2019). In this study, diffuse TBI led to an increase in cumulative minutes slept in the first 6 h post-injury, and mice administered 2LS80Mel prior to TBI slept comparable minutes to uninjured sham animals (F.sub.2,46=3.364, p=0.0433;
[0148] To assess motor function, the Rotarod test was used as previously published by Rowe and others (Rowe et al., 2014b; Rowe et al., 2018). Motor function was tested as the latency to stay on the Rotarod over 7 DPI, with significant effects of both time post-injury (F.sub.2,110=8.941, p=0.0003;
[0149] Analysis of inflammatory markers and microglial morphology in the different groups of mice further confirmed protective/anti-inflammatory activity of 2LS80Mel. TBI resulted in higher CD11b.sup.+Ly6C.sup.high (F.sub.2,49=4.259, p=0.019;
[0150] Overall, 2LS80Mel demonstrated protective effects in a mouse model of diffuse TBI. A single injection of 2LS80Mel resulted in attenuation of common sensorimotor and motor deficits observed in TBI and TBI-induced post-traumatic sleep. Furthermore, TBI-induced increases in peripheral monocyte populations were mitigated by 2LS80Mel. Despite no significant differences between 2LS80Mel-treated and saline-treated groups in levels of select inflammatory cytokines and microglial morphology, 2LS80Mel still demonstrated robust neuroprotection and anti-inflammatory activity in vivo.
[0151] The classical mild progressive 6-OHDA hemi-parkinsonian rat model was used to assess the neuroprotective potential of 2LS98Lac (
[0152] In a follow-up study, the neuroprotective potential of 2LS98Lac was also probed in rats with more severe (40%) 6-OHDA-induced lesions and three treatment-injections with 2LS98Lac (
[0153] The microglia morphology was also evaluated in this experiment, to investigate effects on neuroinflammation, and found that 6-OHDA-lesioning did lead to a significant change in the morphologic phenotype that was fully reversed by treatment with 2LS98Lac (
[0154] The foregoing discussion of the invention has been presented for purposes of illustration and description. The foregoing is not intended to limit the invention to the form or forms disclosed herein. Although the description of the invention has included description of one or more embodiments and certain variations and modifications, other variations and modifications are within the scope of the invention, e.g., as may be within the skill and knowledge of those in the art, after understanding the present disclosure. It is intended to obtain rights which include alternative embodiments to the extent permitted, including alternate, interchangeable and/or equivalent structures, functions, ranges or steps to those claimed, whether or not such alternate, interchangeable and/or equivalent structures, functions, ranges or steps are disclosed herein, and without intending to publicly dedicate any patentable subject matter. All references cited herein are incorporated by reference in their entirety.