ANTI-CD19 scFv (FMC63) POLYPEPTIDE AND USES THEREOF
20180265595 ยท 2018-09-20
Inventors
- Laurence JN Cooper (Houston, TX)
- Bipulendu Jena (Houston, TX)
- Sourindra Maiti (Houston, TX)
- Harjeet SINGH (Houston, TX, US)
- David Rushworth (Houston, TX)
Cpc classification
A61K39/4611
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
G01N33/566
PHYSICS
C07K16/4283
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2319/31
CHEMISTRY; METALLURGY
A61K39/464499
HUMAN NECESSITIES
International classification
C07K14/705
CHEMISTRY; METALLURGY
C07K16/28
CHEMISTRY; METALLURGY
G01N33/566
PHYSICS
Abstract
Provided are monoclonal antibodies that detect CD19 CAR-modified immune cells and CAR-modified immune cells irrespective of the tumor associated antigen they target. Methods of using these functional monoclonal antibodies include, but are not limited to, detection, quantification, activation, and selective propagation of CAR-modified immune cells.
Claims
1.-109. (canceled)
110. A method of inhibiting the activity of an engineered cell comprising a CD19-specific scFv (FMC63) chimeric antigen receptor (CAR) comprising contacting the engineered cell with a composition comprising an isolated antibody or antibody fragment thereof, wherein the isolated antibody or antibody fragment comprises a set of complementarity determining regions (CDRs) HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, wherein (a) HCDR1 has the amino acid sequence of SEQ ID NO: 2; (b) HCDR2 has the amino acid sequence of SEQ ID NO: 3; (c) HCDR3 has the amino acid sequence of SEQ ID NO: 4; (d) LCDR1 has the amino acid sequence of SEQ ID NO: 6; (e) LCDR2 has the amino acid sequence of SEQ ID NO: 7; and (f) LCDR3 has the amino acid sequence of SEQ ID NO: 8.
111. The method of claim 110, wherein the antibody or antibody fragment thereof comprises a heavy chain variable region (VH) having the amino acid sequence of SEQ ID NO: 1, and a light chain variable region (VL) having the amino acid sequence of SEQ ID NO: 5.
112. The method of claim 110, wherein the antibody or antibody fragment thereof is human or humanized.
113. The method of claim 110, wherein the antibody or antibody fragment thereof is conjugated to a toxin.
114. The method of claim 110, wherein the antibody or antibody fragment thereof is membrane bound.
115. The method of claim 114, wherein membrane-bound antibody or antibody fragment thereof comprises one or more of (i) a GM-CSF leader peptide; (ii) a CD8? linker sequence; (iii) a CD28 transmembrane domain; and/or (iv) a CD3?, intracellular domain.
116. The method of claim 110, wherein the antibody fragment is a Fab, a F(ab)2, a F(ab)3, a monovalent scFv, a bivalent scFv, or a single domain antibody.
117. The method of claim 110, wherein the antibody is an IgG, IgM or IgA antibody.
118. The method of claim 110, wherein the antibody or antibody fragment thereof is conjugated to a reporter gene.
119. A method of selecting an engineered cell comprising a CD19-specific scFv (FMC63) chimeric antigen receptor (CAR) comprising contacting the engineered cell with a composition comprising an isolated antibody or antibody fragment thereof, wherein the isolated antibody or antibody fragment comprises a set of complementarity determining regions (CDRs) HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, wherein (a) HCDR1 has the amino acid sequence of SEQ ID NO: 2; (b) HCDR2 has the amino acid sequence of SEQ ID NO: 3; (c) HCDR3 has the amino acid sequence of SEQ ID NO: 4; (d) LCDR1 has the amino acid sequence of SEQ ID NO: 6; (e) LCDR2 has the amino acid sequence of SEQ ID NO: 7; and (f) LCDR3 has the amino acid sequence of SEQ ID NO: 8.
120. The method of claim 119, wherein the antibody or antibody fragment thereof comprises a heavy chain variable region (VH) having the amino acid sequence of SEQ ID NO: 1, and a light chain variable region (VL) having the amino acid sequence of SEQ ID NO: 5.
121. The method of claim 119, wherein the antibody or antibody fragment thereof is conjugated to a reporter gene.
122. The method of claim 119, further comprising selecting engineered cells comprising CD19-specific scFv (FMC63) chimeric antigen receptor (CAR) by fluorescence-activated cell sorting (FACS).
123. A host cell comprising one or more polynucleotide molecule(s) encoding an antibody or antibody fragment thereof wherein the isolated antibody or antibody fragment comprises a set of complementarity determining regions (CDRs) HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, wherein (a) HCDR1 has the amino acid sequence of SEQ ID NO: 2; (b) HCDR2 has the amino acid sequence of SEQ ID NO: 3; (c) HCDR3 has the amino acid sequence of SEQ ID NO: 4; (d) LCDR1 has the amino acid sequence of SEQ ID NO: 6; (e) LCDR2 has the amino acid sequence of SEQ ID NO: 7; and (f) LCDR3 has the amino acid sequence of SEQ ID NO: 8.
124. The host cell of claim 123, wherein the host cell is a mammalian cell, a yeast cell, a bacterial cell, a ciliate cell or an insect cell.
125. The host cell of claim 124, wherein the host cell is an antigen presenting cell (APC).
126. The host cell of claim 125, wherein the host cell is an artificial antigen presenting cell (aAPC) or an activating and propagating cell (AAPC).
127. The host cell of claim 123, wherein the antibody or antibody fragment thereof is human or humanized.
128. The host cell of claim 123, wherein the antibody or antibody fragment thereof is conjugated to a toxin.
129. The host cell of claim 123, wherein the antibody or antibody fragment thereof comprises a heavy chain variable region (VH) having the amino acid sequence of SEQ ID NO: 1, and a light chain variable region (VL) having the amino acid sequence of SEQ ID NO: 5.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0035] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0055] Therapeutics that employ CAR-expressing cells for targeting or specific antigens (e.g., tumor-associated antigens) are currently being investigated for the treatment of a variety of disease from cancers to infectious disease. However, the complexity of these agents requires specialized tools for the purification, propagation and control of CAR-expressing cells, which were previously not available. Embodiments of the present invention provide antibodies that specifically bind to CAR T-cells and can be used to selectively purify, propagate or target CAR T-cells. For example, in one aspect, antibodies are provided that specifically bind to a region of the heavy chain constant domain shared by a wide array of CAR T-cells. For example, the 2D3 monoclonal antibody specifically binds to CAR expressing T-cell and can be used to analyze, isolate or propagate these cells. Likewise, specific anti-idiotype (anti-Id) mAbs are provided with specificity for CD19-specific CARs. The mouse mAb (clone no. 136.20.1) recognizes CD19-specific CARs derived from anti-human CD19 mAb (clone FMC63). The specificity of this mAb for CD19-specific CAR id demonstrated using (i) flow cytometry, (ii) western blotting, (iii) transmission electron microscopy (TEM), and (iv) immunocytochemistry. Furthermore, the binding of this anti-Id mAb to the scFv region of CD19RCD28 was demonstrated using a panel of CAR.sup.+ T cells and inhibition of CD19-dependent cytolysis as observed by chromium release assay (CRA) and video time lapse microscopy (VTLM).
[0056] Previously, CARs expressed on the T-cell surface were detected by antibodies directed against epitope tags or spacer domains incorporated in the extracellular domain. However, such tags would preferably not be employed in therapeutic CAR T-cells. Other commercially-available antibodies detecting Fc regions can, in some case, detect CARs, but cross-reactivity against immunoglobulin, especially when genetically modified T cells are to be assayed from patient-derived PBMC remains an obstacle. Likewise, alternative CAR designs that are non-immunogenic and avoid using a CH.sub.2-CH.sub.3 or employ scaffolding domains that are smaller than the Fc region, may improve the therapeutic potential of genetically modified T cells, but render Fc-binding antibodies useless as reagents. Thus, reagents that can directly bind to and detect the scFv region of the CAR, such as the mAbs provided here, represent the most effective reagents for manipulation of CAR T-cell populations. Indeed, the anti-idiotype mAb developed for detection of CD19-specific CAR.sup.+ T cells provides a methodology to generate reagents to detect CARs targeting TAAs alternative to CD19.
[0057] Thus, the mAbs that binds to the scFv derived CAR T cells provided herein can serve as new and effective systems for T-cell manipulation. Antibodies specific for CAR T-cells (or in some cases CD-19 targeted CAR T-cells particularly) can be used to analyze and characterize CAR reagents. Perhaps even more importantly the CAR-binding agents provided herein can be used to specifically select, purify or propagate CAR T-cells. For example, antibodies of the embodiments can be used as part of a system for selectively growing CAR cells, such as by expressing the antibodies (or portions thereof) in aAPCs. In the case of antibodies that bind CARs in general, the antibodies can be used to generate lines of aAPCs as standardized reagents for expansion of CAR T-cell populations, a significant advantage over the systems previously available that must the individualized for particular CAR therapeutics. Likewise, the antibodies can be used to isolate and target CAR cells in vivo to monitor therapy and, if needed, target and inhibit CAR-expressing cells in a subject. These reagents will likely be instrumental in developing and implementing gene therapy trials infusing CD-19 CAR.sup.+ T cells as well as CAR.sup.+ T cells in general (i.e., CARs containing a generic human Fc gamma chain derived scaffold in its polypeptide chain).
I. CHIMERIC ANTIGEN RECEPTORS
[0058] The term chimeric antigen receptors (CARs), as used herein, may refer to artificial T-cell receptors, chimeric T-cell receptors, or chimeric immunoreceptors, for example, and encompass engineered receptors that graft an artificial specificity onto a particular immune effector cell. CARs may be employed to impart the specificity of a monoclonal antibody onto a T cell, thereby allowing a large number of specific T cells to be generated, for example, for use in adoptive cell therapy. In specific embodiments, CARs direct specificity of the cell to a tumor associated antigen, for example. In some embodiments, CARs comprise an intracellular activation domain, a transmembrane domain, and an extracellular domain comprising a tumor associated antigen binding region. In particular aspects, CARs comprise fusions of single-chain variable fragments (scFv) derived from monoclonal antibodies, fused to CD3? a transmembrane domain and endodomain. The specificity of other CAR designs may be derived from ligands of receptors (e.g., peptides) or from Dectins. In particular embodiments, one can target malignant B cells by redirecting the specificity of T cells by using a CAR specific for the B-lineage molecule, CD19. In certain cases, CARs comprise domains for additional co-stimulatory signaling, such as CD3?, FcR, CD27, CD28, CD137, DAP10, and/or OX40. In some cases, molecules can be co-expressed with the CAR, including co-stimulatory molecules, reporter genes for imaging (e.g., for positron emission tomography), gene products that conditionally ablate the T cells upon addition of a pro-drug, homing receptors, cytokines, and cytokine receptors.
[0059] As used herein, the term antigen is a molecule capable of being bound by an antibody or T-cell receptor. An antigen is additionally capable of inducing a humoral immune response and/or cellular immune response leading to the production of B and/or T lymphocytes.
[0060] The present invention involves antibodies that have specificity towards antigen-specific and universal chimeric antigen receptor (CAR) polypeptides, including a CAR that has been humanized to reduce immunogenicity (hCAR). In certain embodiments, the CAR may recognize an epitope comprised of the overlapping sequence between one or more antigens.
[0061] In certain aspects, the invention includes a method of making and/or expanding the antigen-specific redirected TCRg cells that comprises transfecting TCRg cells with an expression vector containing a DNA construct encoding the hCAR, then stimulating the cells with an antibody to the receptor to cause the cells to proliferate.
II. ANTIBODIES OF THE EMBODIMENTS
[0062] In certain embodiments, an antibody or a fragment thereof that binds to at least a portion of CD19scFv-specific CAR protein and interferes with the killing of CD19.sup.+ target cells and its associated use in treatment of diseases is contemplated. In other embodiments, an antibody or a fragment thereof that binds to at least the CH.sub.2-CH.sub.3 hinge of CAR protein (all-CAR) is provided. As used herein, the term antibody is intended to refer broadly to any immunologic binding agent, such as IgG, IgM, IgA, IgD, and IgE as well as polypeptides comprising antibody CDR domains that retain antigen binding activity. The antibody may be selected from the group consisting of a chimeric antibody, an affinity matured antibody, a polyclonal antibody, a monoclonal antibody, a humanized antibody, a human antibody, or an antigen-binding antibody fragment or a natural or synthetic ligand. Preferably, the anti-CD19-specific CAR or all-CAR antibody is a monoclonal antibody or a humanized antibody. By known means and as described herein, polyclonal or monoclonal antibodies, antibody fragments, and binding domains and CDRs (including engineered forms of any of the foregoing) may be created that are specific to CD19-specific CAR or all-CAR protein, one or more of its respective epitopes, or conjugates of any of the foregoing, whether such antigens or epitopes are isolated from natural sources or are synthetic derivatives or variants of the natural compounds.
[0063] Examples of antibody fragments suitable for the present embodiments include, without limitation: (i) the Fab fragment, consisting of V.sub.L, V.sub.H, C.sub.L, and C.sub.H1 domains; (ii) the Fd fragment consisting of the V.sub.H and C.sub.H1 domains; (iii) the Fv fragment consisting of the V.sub.L and V.sub.H domains of a single antibody; (iv) the dAb fragment, which consists of a V.sub.H domain; (v) isolated CDR regions; (vi) F(ab)2 fragments, a bivalent fragment comprising two linked Fab fragments; (vii) single chain Fv molecules (scFv), wherein a V.sub.H domain and a V.sub.L domain are linked by a peptide linker that allows the two domains to associate to form a binding domain; (viii) bi-specific single chain Fv dimers (see U.S. Pat. No. 5,091,513); and (ix) diabodies, multivalent or multispecific fragments constructed by gene fusion (US Patent App. Pub. 20050214860). Fv, scFv, or diabody molecules may be stabilized by the incorporation of disulphide bridges linking the V.sub.H and V.sub.L domains. Minibodies comprising a scFv joined to a CH3 domain may also be made (Hu et al., 1996).
[0064] Antibody-like binding peptidomimetics are also contemplated in embodiments. Liu et al. (2003) describe antibody like binding peptidomimetics (ABiPs), which are peptides that act as pared-down antibodies and have certain advantages of longer serum half-life as well as less cumbersome synthesis methods.
[0065] Animals may be inoculated with an antigen in order to produce antibodies specific for CD19scFv-specific CAR or all-CAR protein. Frequently an antigen is bound or conjugated to another molecule to enhance the immune response. As used herein, a conjugate is any peptide, polypeptide, protein, or non-proteinaceous substance bound to an antigen that is used to elicit an immune response in an animal. Antibodies produced in an animal in response to antigen inoculation comprise a variety of non-identical molecules (polyclonal antibodies) made from a variety of individual antibody producing B lymphocytes. A polyclonal antibody is a mixed population of antibody species, each of which may recognize a different epitope on the same antigen. Given the correct conditions for polyclonal antibody production in an animal, most of the antibodies in the animal's serum will recognize the collective epitopes on the antigenic compound to which the animal has been immunized. This specificity is further enhanced by affinity purification to select only those antibodies that recognize the antigen or epitope of interest.
[0066] A monoclonal antibody is a single species of antibody wherein every antibody molecule recognizes the same epitope because all antibody producing cells are derived from a single B-lymphocyte cell line. The methods for generating monoclonal antibodies (MAbs) generally begin along the same lines as those for preparing polyclonal antibodies. In some embodiments, rodents such as mice and rats are used in generating monoclonal antibodies. In some embodiments, rabbit, sheep, or frog cells are used in generating monoclonal antibodies. The use of rats is well known and may provide certain advantages. Mice (e.g., BALB/c mice) are routinely used and generally give a high percentage of stable fusions.
[0067] Hybridoma technology involves the fusion of a single B lymphocyte from a mouse previously immunized with a CD19scFv-specific CAR or all-CAR antigen with an immortal myeloma cell (usually mouse myeloma). This technology provides a method to propagate a single antibody-producing cell for an indefinite number of generations, such that unlimited quantities of structurally identical antibodies having the same antigen or epitope specificity (monoclonal antibodies) may be produced.
[0068] In one embodiment, the antibody is a chimeric antibody, for example, an antibody comprising antigen binding sequences from a non-human donor grafted to a heterologous non-human, human, or humanized sequence (e.g., framework and/or constant domain sequences). Methods have been developed to replace light and heavy chain constant domains of the monoclonal antibody with analogous domains of human origin, leaving the variable regions of the foreign antibody intact. Alternatively, fully human monoclonal antibodies are produced in mice transgenic for human immunoglobulin genes. Methods have also been developed to convert variable domains of monoclonal antibodies to more human form by recombinantly constructing antibody variable domains having both rodent, for example, mouse, and human amino acid sequences. In humanized monoclonal antibodies, only the hypervariable CDR is derived from mouse monoclonal antibodies, and the framework and constant regions are derived from human amino acid sequences (see U.S. Pat. Nos. 5,091,513 and 6,881,557). It is thought that replacing amino acid sequences in the antibody that are characteristic of rodents with amino acid sequences found in the corresponding position of human antibodies will reduce the likelihood of adverse immune reaction during therapeutic use. A hybridoma or other cell producing an antibody may also be subject to genetic mutation or other changes, which may or may not alter the binding specificity of antibodies produced by the hybridoma.
[0069] Methods for producing polyclonal antibodies in various animal species, as well as for producing monoclonal antibodies of various types, including humanized, chimeric, and fully human, are well known in the art and highly predictable. For example, the following U.S. patents and patent applications provide enabling descriptions of such methods: U.S. Patent Application Nos. 2004/0126828 and 2002/0172677; and U.S. Pat. Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,196,265; 4,275,149; 4,277,437; 4,366,241; 4,469,797; 4,472,509; 4,606,855; 4,703,003; 4,742,159; 4,767,720; 4,816,567; 4,867,973; 4,938,948; 4,946,778; 5,021,236; 5,164,296; 5,196,066; 5,223,409; 5,403,484; 5,420,253; 5,565,332; 5,571,698; 5,627,052; 5,656,434; 5,770,376; 5,789,208; 5,821,337; 5,844,091; 5,858,657; 5,861,155; 5,871,907; 5,969,108; 6,054,297; 6,165,464; 6,365,157; 6,406,867; 6,709,659; 6,709,873; 6,753,407; 6,814,965; 6,849,259; 6,861,572; 6,875,434; and 6,891,024. All patents, patent application publications, and other publications cited herein and therein are hereby incorporated by reference in the present application.
[0070] Substitutional variants typically contain the exchange of one amino acid for another at one or more sites within the protein, and may be designed to modulate one or more properties of the polypeptide, with or without the loss of other functions or properties. Substitutions may be conservative, that is, one amino acid is replaced with one of similar shape and charge. Conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine. Alternatively, substitutions may be non-conservative such that a function or activity of the polypeptide is affected. Non-conservative changes typically involve substituting a residue with one that is chemically dissimilar, such as a polar or charged amino acid for a nonpolar or uncharged amino acid, and vice versa.
[0071] Proteins may be recombinant, or synthesized in vitro. Alternatively, a non-recombinant or recombinant protein may be isolated from bacteria. It is also contemplated that a bacteria containing such a variant may be implemented in compositions and methods. Consequently, a protein need not be isolated.
[0072] An antibody or preferably an immunological portion of an antibody, can be chemically conjugated to, or expressed as, a fusion protein with other proteins. For purposes of this specification and the accompanying claims, all such fused proteins are included in the definition of antibodies or an immunological portion of an antibody.
III. CHIMERIC ANTIGEN RECEPTORS
[0073] Embodiments of the present invention involve nucleic acids, including nucleic acids encoding an antigen-specific chimeric antigen receptor (CAR) polypeptide, including a CAR that has been humanized to reduce immunogenicity (hCAR), comprising an intracellular signaling domain, a transmembrane domain, and an extracellular domain comprising one or more signaling motifs. In certain embodiments, the CAR may recognize an epitope comprised of the shared space between one or more antigens. Pattern recognition receptors, such as Dectin-1, may be used to derive specificity to a carbohydrate antigen. In certain embodiments, the binding region can comprise complementary determining regions of a monoclonal antibody, variable regions of a monoclonal antibody, and/or antigen binding fragments thereof. In another embodiment, that specificity is derived from a peptide (e.g., cytokine) that binds to a receptor. A complementarity determining region (CDR) is a short amino acid sequence found in the variable domains of antigen receptor (e.g., immunoglobulin and T-cell receptor) proteins that complements an antigen and therefore provides the receptor with its specificity for that particular antigen. Each polypeptide chain of an antigen receptor contains three CDRs (CDR1, CDR2, and CDR3). Since the antigen receptors are typically composed of two polypeptide chains, there are six CDRs for each antigen receptor that can come into contact with the antigeneach heavy and light chain contains three CDRs. Because most sequence variation associated with immunoglobulins and T-cell receptors are found in the CDRs, these regions are sometimes referred to as hypervariable domains. Among these, CDR3 shows the greatest variability as it is encoded by a recombination of the VJ (VDJ in the case of heavy chain and TCR ?? chain) regions.
[0074] It is contemplated that the human CAR nucleic acids are human genes to enhance cellular immunotherapy for human patients. In a specific embodiment, the invention includes a full length CAR cDNA or coding region. The antigen binding regions or domain can comprise a fragment of the V.sub.H and V.sub.L chains of a single-chain variable fragment (scFv) derived from a particular human monoclonal antibody, such as those described in U.S. Pat. No. 7,109,304, incorporated herein by reference. The fragment can also be any number of different antigen binding domains of a human antigen-specific antibody. In a more specific embodiment, the fragment is an antigen-specific scFv encoded by a sequence that is optimized for human codon usage for expression in human cells.
[0075] The arrangement could be multimeric, such as a diabody or multimers. The multimers are most likely formed by cross pairing of the variable portion of the light and heavy chains into what has been referred to by Winters as a diabody. The hinge portion of the construct can have multiple alternatives from being totally deleted, to having the first cysteine maintained, to a proline rather than a serine substitution, to being truncated up to the first cysteine. The Fc portion can be deleted. Any protein that is stable and/or dimerizes can serve this purpose. One could use just one of the Fc domains, e.g., either the CH2 or CH3 domain from human immunoglobulin. One could also use the hinge, CH2 and CH3 region of a human immunoglobulin that has been modified to improve dimerization. One could also use just the hinge portion of an immunoglobulin. One could also use portions of CD8?.
[0076] The intracellular signaling domain of the chimeric receptor of the invention is responsible for activation of at least one of the normal effector functions of the immune cell in which the chimeric receptor has been placed. The term effector function refers to a specialized function of a differentiated cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines. Effector function in a naive, memory, or memory-type T cell includes antigen-dependent proliferation. Thus the term intracellular signaling domain refers to the portion of a protein that transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain will be employed, in many cases it will not be necessary to use the entire intracellular polypeptide. To the extent that a truncated portion of the intracellular signaling domain may find use, such truncated portion may be used in place of the intact chain as long as it still transduces the effector function signal. The term intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal. Examples include the zeta chain of the T-cell receptor or any of its homologs (e.g., eta, delta, gamma, or epsilon), MB1 chain, B29, Fc RIII, Fc RI, and combinations of signaling molecules, such as CD3? and CD28, CD27, 4-1BB, DAP-10, OX40, and combinations thereof, as well as other similar molecules and fragments. Intracellular signaling portions of other members of the families of activating proteins can be used, such as Fc?RIII and Fc?RI. See Gross et al. (1992), Stancovski et al. (1993), Moritz et al. (1994), Hwu et al. (1995), Weijtens et al. (1996), and Hekele et al. (1996) for disclosures of cTCR's using these alternative transmembrane and intracellular domains. In a preferred embodiment, the human CD3? intracellular domain was taken for activation.
[0077] The antigen-specific extracellular domain and the intracellular signaling-domain may be linked by a transmembrane domain, such as the human IgG4Fc hinge and Fc regions. Alternatives include the human CD4 transmembrane domain, the human CD28 transmembrane domain, the transmembrane human CD3? domain, or a cysteine mutated human CD3? domain, or other transmembrane domains from other human transmembrane signaling proteins, such as CD16 and CD8 and erythropoietin receptor.
[0078] In some embodiments, the CAR nucleic acid comprises a sequence encoding other costimulatory receptors, such as a transmembrane domain and a modified CD28 intracellular signaling domain. Other costimulatory receptors include, but are not limited to one or more of CD28, CD27, OX-40 (CD134), DAP10, and 4-1BB (CD137). In addition to a primary signal initiated by CD3?, an additional signal provided by a human costimulatory receptor inserted in a human CAR is important for full activation of T cells and could help improve in vivo persistence and the therapeutic success of the adoptive immunotherapy.
[0079] In particular embodiments, the invention concerns isolated nucleic acid segments and expression cassettes incorporating DNA sequences that encode the CAR. Vectors of the present invention are designed, primarily, to deliver desired genes to immune cells, preferably T cells under the control of regulated eukaryotic promoters, for example, MNDU3 promoter, CMV promoter, EF1alpha promoter, or Ubiquitin promoter. Also, the vectors may contain a selectable marker, if for no other reason, to facilitate their manipulation in vitro. In other embodiments, the CAR can be expressed from mRNA in vitro transcribed from a DNA template.
[0080] Chimeric antigen receptor molecules are recombinant and are distinguished by their ability to both bind antigen and transduce activation signals via immunoreceptor activation motifs (ITAM's) present in their cytoplasmic tails. Receptor constructs utilizing an antigen-binding moiety (for example, generated from single chain antibodies (scFv)) afford the additional advantage of being universal in that they bind native antigen on the target cell surface in an HLA-independent fashion. For example, several laboratories have reported on scFv constructs fused to sequences coding for the intracellular portion of the CD3 complex's zeta chain (?), the Fc receptor gamma chain, and sky tyrosine kinase (Eshhar et al., 1993; Fitzer-Attas et al., 1998). Re-directed T cell effector mechanisms including tumor recognition and lysis by CTL have been documented in several murine and human antigen-scFv: ? systems (Eshhar, 1997; Altenschmidt et al., 1997; Brocker et al., 1998).
[0081] To date non-human antigen binding regions are typically used in constructing a chimeric antigen receptor. A potential problem with using non-human antigen binding regions, such as murine monoclonal antibodies, is the lack of human effector functionality and inability to penetrate into tumor masses. In other words, such antibodies may be unable to mediate complement-dependent lysis or lyse human target cells through antibody-dependent cellular toxicity or Fc-receptor mediated phagocytosis to destroy cells expressing CAR. Furthermore, non-human monoclonal antibodies can be recognized by the human host as a foreign protein, and therefore, repeated injections of such foreign antibodies can lead to the induction of immune responses leading to harmful hypersensitivity reactions. For murine-based monoclonal antibodies, this is often referred to as a Human Anti-Mouse Antibody (HAMA) response. Therefore, the use of human antibodies is more preferred because they do not elicit as strong a HAMA response as murine antibodies. Similarly, the use of human sequences in the CAR can avoid immune-mediated recognition and therefore elimination by endogenous T cells that reside in the recipient and recognize processed antigen in the context of HLA.
[0082] In some embodiments, the chimeric antigen receptor comprises: a) an intracellular signaling domain, b) a transmembrane domain, and c) an extracellular domain comprising an antigen binding region.
[0083] In specific embodiments, intracellular receptor signaling domains in the CAR include those of the T cell antigen receptor complex, such as the zeta chain of CD3, also Fc? RIII costimulatory signaling domains, CD28, CD27, DAP10, CD137, OX40, CD2, alone or in a series with CD3zeta, for example. In specific embodiments, the intracellular domain (which may be referred to as the cytoplasmic domain) comprises part or all of one or more of TCR zeta chain, CD28, CD27, OX40/CD134, 4-1BB/CD137, Fc?RI?, ICOS/CD278, IL-2Rbeta/CD122, IL-2Ralpha/CD132, DAP10, DAP12, and CD40. In some embodiments, one employs any part of the endogenous T cell receptor complex in the intracellular domain. One or multiple cytoplasmic domains may be employed, as so-called third generation CARs have at least two or three signaling domains fused together for additive or synergistic effect, for example.
[0084] In certain embodiments of the chimeric antigen receptor, the antigen-specific portion of the receptor (which may be referred to as an extracellular domain comprising an antigen binding region) comprises a tumor associated antigen or a pathogen-specific antigen binding domain including carbohydrate antigen recognized by pattern-recognition receptors, such as Dectin-1. A tumor associated antigen may be of any kind so long as it is expressed on the cell surface of tumor cells. Exemplary embodiments of tumor associated antigens include CD19, CD20, carcinoembryonic antigen, alphafetoprotein, CA-125, MUC-1, CD56, EGFR, c-Met, AKT, Her2, Her3, epithelial tumor antigen, melanoma-associated antigen, mutated p53, mutated ras, and so forth. In certain embodiments, the CAR can be co-expressed with a membrane-bound cytokine to improve persistence when there is a low amount of tumor-associated antigen. For example, CAR can be co-expressed with membrane-bound IL-15.
[0085] In certain embodiments intracellular tumor associated antigens may be targeted, such as HA-1, survivin, WT1, and p53. This can be achieved by a CAR expressed on a universal T cell that recognizes the processed peptide described from the intracellular tumor associated antigen in the context of HLA. In addition, the universal T cell may be genetically modified to express a T-cell receptor pairing that recognizes the intracellular processed tumor associated antigen in the context of HLA.
[0086] The pathogen may be of any kind, but in specific embodiments the pathogen is a fungus, bacteria, or virus, for example. Exemplary viral pathogens include those of the families of Adenoviridae, Epstein-Barr virus (EBV), Cytomegalovirus (CMV), Respiratory Syncytial Virus (RSV), JC virus, BK virus, HSV, HHV family of viruses, Picornaviridae, Herpesviridae, Hepadnaviridae, Flaviviridae, Retroviridae, Orthomyxoviridae, Paramyxoviridae, Papovaviridae, Polyomavirus, Rhabdoviridae, and Togaviridae. Exemplary pathogenic viruses cause smallpox, influenza, mumps, measles, chickenpox, ebola, and rubella. Exemplary pathogenic fungi include Candida, Aspergillus, Cryptococcus, Histoplasma, Pneumocystis, and Stachybotrys. Exemplary pathogenic bacteria include Streptococcus, Pseudomonas, Shigella, Campylobacter, Staphylococcus, Helicobacter, E. coli, Rickettsia, Bacillus, Bordetella, Chlamydia, Spirochetes, and Salmonella. In one embodiment the pathogen receptor Dectin-1 can be used to generate a CAR that recognizes the carbohydrate structure on the cell wall of fungi. T cells genetically modified to express the CAR based on the specificity of Dectin-1 can recognize Aspergillus and target hyphal growth. In another embodiment, CARs can be made based on an antibody recognizing viral determinants (e.g., the glycoproteins from CMV and Ebola) to interrupt viral infections and pathology.
[0087] In some embodiments, the pathogenic antigen is an Aspergillus carbohydrate antigen for which the extracellular domain in the CAR recognizes patterns of carbohydrates of the fungal cell wall, such as via Dectin-1.
[0088] It is contemplated that the chimeric construct can be introduced into the subject's own T cells as naked DNA or in a suitable vector. Methods of stably transfecting T cells by electroporation using naked DNA are known in the art. See, e.g., U.S. Pat. No. 6,410,319. Naked DNA generally refers to the DNA encoding a chimeric receptor of the present invention contained in a plasmid expression vector in proper orientation for expression. Advantageously, the use of naked DNA reduces the time required to produce T cells expressing the chimeric receptor of the present invention.
[0089] Alternatively, a viral vector (e.g., a retroviral vector, adenoviral vector, adeno-associated viral vector, or lentiviral vector) can be used to introduce the chimeric construct into T cells. Suitable vectors for use in accordance with the method of the present invention are non-replicating in the subject's T cells. A large number of vectors are known that are based on viruses, where the copy number of the virus maintained in the cell is low enough to maintain the viability of the cell. Illustrative vectors include the pFB-neo vectors (STRATAGENE?) disclosed herein as well as vectors based on HIV, SV40, EBV, HSV, or BPV.
[0090] Once it is established that the transfected or transduced T cell is capable of expressing the chimeric receptor as a surface membrane protein with the desired regulation and at a desired level, it can be determined whether the chimeric receptor is functional in the host cell to provide for the desired signal induction. Subsequently, the transduced T cells are reintroduced or administered to the subject to activate anti-tumor responses in the subject. To facilitate administration, the transduced T cells according to the invention can be made into a pharmaceutical composition or made into an implant appropriate for administration in vivo, with appropriate carriers or diluents, which further can be pharmaceutically acceptable. The means of making such a composition or an implant have been described in the art (see, for instance, Remington's Pharmaceutical Sciences, 16th Ed., Mack, ed. (1980)). Where appropriate, the transduced T cells can be formulated into a preparation in semisolid or liquid form, such as a capsule, solution, injection, inhalant, or aerosol, in the usual ways for their respective route of administration. Means known in the art can be utilized to prevent or minimize release and absorption of the composition until it reaches the target tissue or organ, or to ensure timed-release of the composition. Desirably, however, a pharmaceutically acceptable form is employed that does not ineffectuate the cells expressing the chimeric receptor. Thus, desirably the transduced T cells can be made into a pharmaceutical composition containing a balanced salt solution, preferably Hanks' balanced salt solution, or normal saline.
IV. ARTIFICIAL ANTIGEN PRESENTING CELLS
[0091] In some cases, aAPCs are useful in preparing CAR-based therapeutic compositions and cell therapy products. For general guidance regarding the preparation and use of antigen-presenting systems, see, e.g., U.S. Pat. Nos. 6,225,042, 6,355,479, 6,362,001 and 6,790,662; U.S. Patent Application Publication Nos. 2009/0017000 and 2009/0004142; and International Publication No. WO2007/103009). As further detailed herein, in some aspects, aAPCs are provided, which comprise an antibody of the embodiments expressed on the surface. For instance, in some aspects, the antibody can be provided in additional to or instead of the antigen that is recognized by the CAR in order to mediate CAR T-cell expansion.
[0092] Thus, aAPCs, the cells can express an antibody and/or an antigen of interest. In addition to antibody or antigen of interest, the aAPC systems may also comprise at least one exogenous assisting molecule. Any suitable number and combination of assisting molecules may be employed. The assisting molecule may be selected from assisting molecules such as co-stimulatory molecules and adhesion molecules. Exemplary co-stimulatory molecules include CD70 and B7.1 (B7.1 was previously known as B7 and also known as CD80), which among other things, bind to CD28 and/or CTLA-4 molecules on the surface of T cells, thereby affecting, for example, T-cell expansion, Th1 differentiation, short-term T-cell survival, and cytokine secretion such as interleukin (IL)-2 (see Kim et al., 2004, Nature, Vol. 22(4), pp. 403-410). Adhesion molecules may include carbohydrate-binding glycoproteins such as selectins, transmembrane binding glycoproteins such as integrins, calcium-dependent proteins such as cadherins, and single-pass transmembrane immunoglobulin (Ig) superfamily proteins, such as intercellular adhesion molecules (ICAMs), that promote, for example, cell-to-cell or cell-to-matrix contact. Exemplary adhesion molecules include LFA-3 and ICAMs, such as ICAM-1. Techniques, methods, and reagents useful for selection, cloning, preparation, and expression of exemplary assisting molecules, including co-stimulatory molecules and adhesion molecules, are exemplified in, e.g., U.S. Pat. Nos. 6,225,042, 6,355,479, and 6,362,001.
[0093] Cells selected to become aAPCs, preferably have deficiencies in intracellular antigen-processing, intracellular peptide trafficking, and/or intracellular MHC Class I or Class II molecule-peptide loading, or are poikilothermic (i.e., less sensitive to temperature challenge than mammalian cell lines), or possess both deficiencies and poikilothermic properties. Preferably, cells selected to become aAPCs also lack the ability to express at least one endogenous counterpart (e.g., endogenous MHC Class I or Class II molecule and/or endogenous assisting molecules as described above) to the exogenous MHC Class I or Class II molecule and assisting molecule components that are introduced into the cells. Furthermore, aAPCs preferably retain the deficiencies and poikilothermic properties that were possessed by the cells prior to their modification to generate the aAPCs. Exemplary aAPCs either constitute or are derived from a transporter associated with antigen processing (TAP)-deficient cell line, such as an insect cell line. An exemplary poikilothermic insect cells line is a Drosophila cell line, such as a Schneider 2 cell line (see, e.g. Schneider, J. Embryol. Exp. Morph. 1972 Vol 27, pp. 353-365). Illustrative methods for the preparation, growth, and culture of Schneider 2 cells, are provided in U.S. Pat. Nos. 6,225,042, 6,355,479, and 6,362,001.
[0094] In one embodiment, aAPCs are also subjected to a freeze-thaw cycle. In an exemplary freeze-thaw cycle, the aAPCs may be frozen by contacting a suitable receptacle containing the aAPCs with an appropriate amount of liquid nitrogen, solid carbon dioxide (i.e., dry ice), or similar low-temperature material, such that freezing occurs rapidly. The frozen aAPCs are then thawed, either by removal of the aAPCs from the low-temperature material and exposure to ambient room temperature conditions, or by a facilitated thawing process in which a lukewarm water bath or warm hand is employed to facilitate a shorter thawing time. Additionally, aAPCs may be frozen and stored for an extended period of time prior to thawing. Frozen aAPCs may also be thawed and then lyophilized before further use. Preferably, preservatives that might detrimentally impact the freeze-thaw procedures, such as dimethyl sulfoxide (DMSO), polyethylene glycols (PEGs), and other preservatives, are absent from media containing aAPCs that undergo the freeze-thaw cycle, or are essentially removed, such as by transfer of aAPCs to media that is essentially devoid of such preservatives.
[0095] In other preferred embodiments, xenogeneic nucleic acid and nucleic acid endogenous to the aAPCs, may be inactivated by crosslinking, so that essentially no cell growth, replication or expression of nucleic acid occurs after the inactivation. In one embodiment, aAPCs are inactivated at a point subsequent to the expression of exogenous MHC and assisting molecules, presentation of such molecules on the surface of the aAPCs, and loading of presented MHC molecules with selected peptide or peptides. Accordingly, such inactivated and selected peptide loaded aAPCs, while rendered essentially incapable of proliferating or replicating, retain selected peptide presentation function. Preferably, the crosslinking also yields aAPCS that are essentially free of contaminating microorganisms, such as bacteria and viruses, without substantially decreasing the antigen-presenting cell function of the aAPCs. Thus crosslinking maintains the important APC functions of aAPCs while helping to alleviate concerns about safety of a cell therapy product developed using the aAPCs. For methods related to crosslinking and aAPCs, see for example, U.S. Patent Application Publication No. 20090017000, which is incorporated herein by reference.
V. KITS OF THE INVENTION
[0096] Any of the compositions described herein may be comprised in a kit. In some embodiments, CAR-binding antibodies are provided in the kit, which also may include reagents suitable for expanding the cells, such as media, aAPCs, growth factors, antigens, other antibodies (e.g., for sorting or characterizing CAR T-cells) and/or plasmids encoding CARs or transposase.
[0097] In a non-limiting example, a CAR-binding antibody, a chimeric receptor expression construct (or reagents to generate a chimeric receptor expression construct), reagents for transfection of the expression construct, and/or one or more instruments to obtain allogeneic cells for transfection of the expression construct (such an instrument may be a syringe, pipette, forceps, and/or any such medically approved apparatus) are provided in a kit. In some aspects, the kit comprises reagents or apparatuses for electroporation of cells.
[0098] The kits may comprise one or more suitably aliquoted compositions of the present invention or reagents to generate compositions of the invention. The components of the kits may be packaged either in aqueous media or in lyophilized form. The container means of the kits may include at least one vial, test tube, flask, bottle, syringe, or other container means, into which a component may be placed, and preferably, suitably aliquoted. Where there is more than one component in the kit, the kit also will generally contain a second, third, or other additional container into which the additional components may be separately placed. However, various combinations of components may be comprised in a vial. The kits of the present invention also will typically include a means for containing the chimeric receptor construct and any other reagent containers in close confinement for commercial sale. Such containers may include injection or blow molded plastic containers into which the desired vials are retained, for example.
VI. EXAMPLES
[0099] The following examples are included to demonstrate preferred embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
Example 1CD19 CAR-Targeting Monoclonal AntibodyMethods
[0100] Ethics Statement.
[0101] All experimental procedures pertaining to the use of animals were performed according to the U.T. MD Anderson Cancer Center Institutional Animal Care and Use Committee (IACUC) guidelines and were carried out by the MD Anderson Hybridoma core lab (IACUC approval no. 11-071-2533). All efforts were made to reduce suffering to the animals caused by any experimental procedure. Isoflurane (2-5%) were used as anesthesia whenever required. Details of animal care, anesthesia use and sample collection are provided in separate paragraph. For the peripheral blood mononuclear cells (PBMC) used in the study, blood samples were obtained from healthy volunteers under the protocol title Acquisition of peripheral blood from healthy volunteers that aimed to investigate the immunobiology of lymphocytes such as T cells in general and genetically modified T cells in particular (approval obtained from U.T. MD Anderson Cancer Center Institutional Review Board protocol no. LAB07-0296). Healthy volunteers donated blood only after written consent was obtained and the study objectives were explained.
[0102] Cells.
[0103] Cell lines were obtained from American Type Culture Collection (ATCC) unless otherwise stated. L cells, (a mouse adherent fibroblast cell line derived from C3H/An strain; ATCC no. CRL-2648), Jurkat cells (ATCC no. CRL-1990), NS0 cells (Sigma Aldrich no. 85110503), NALM-6 pre-B ALL cell (DSMZ no. ACC 128), EL4 murine lymphoma T cell line (ATCC no. TIB-39), CD19.sup.+ EL4 (genetically modified to express truncated human CD19) (Torikai et al., 2012), and Daudi cells co-expressing EGFP and ?.sub.2-microglobulin (Daudi ?.sub.2m; Rabinovich et al. 2008), were all cultured in complete media (CM) defined as RPMI 1640 (Hyclone) supplemented with heat inactivated 10% fetal bovine serum (FBS) (Hyclone) and 2 mM L-Glutamine (Gibco-Invitrogen). Genetically modified cells were selected in various cytocidal concentrations of neomycin sulfate G418 (Invivogen) at 0.8 mg/mL for NS0 cells, 0.9 mg/mL for L cells, and 1 mg/mL for Jurkat cells (Singh et al., 2008). K562 were transduced with lentivirus to co-express CD64, CD86, CD137L and a membrane-bound IL-15 (mIL-15) to generate artificial antigen presenting cells (aAPC clone no. 4) (O'Connor et al., 2012; Singh et al., 2008; Manuri et al., 2009; Singh et al., 2011; Maiti et al., 2013). Primary human T cells from PBMC were genetically modified to express CD19RCD28 CAR using the Sleeping Beauty (SB) transposon/transposase system and propagated ex vivo in a CAR-dependent manner on CD19.sup.+ aAPC (K562, clone no. 4) in CM supplemented with soluble recombinant IL-2 (Novartis/Chiron) at 50 IU/mL and IL-21 at 30 ng/mL (Peprotech) (Singh et al., 2011; Huls et al., 2012).
[0104] Cell Surface Expression of CD19-Specific scFv.
[0105] V.sub.L (amino terminus) and V.sub.H (carboxyl terminus) regions were derived from anti-human CD19-specific mAb clone FMC63 (Nicholson et al., 1997). The scFv was formed by joining the V.sub.L and V.sub.H with the 18 amino acid (AA) Whitlow peptide linker (GSTSGSGKPGSGEGSTKG; SEQ ID NO: 26) (Whitlow et al., 1993). This binding domain, denoted as CD19scFv, was then fused in frame with mouse CD8? extra-cellular domain (AA 28-196) and transmembrane domain (AA 197-217) (Swiss-Prot No. P01731 www.expasy.org) to create the fusion protein CD19scFvmCD8?. The cDNA representing the fusion protein was mouse codon optimized and synthesized by a commercial vendor (
[0106] Animal Care, Immunization, Lymphocyte Collection.
[0107] All the experiments pertaining to the animal use were performed as per the recommendations of the U.T. MD Anderson Cancer Center Institutional Animal Care and Use Committee (IACUC approval no. 11-071-2533). Two BALB/c mice (NCI, Frederick) were immunized in the footpads, each with 5?10.sup.6 L cells expressing CD19scFv-mCD8? (clone no. 12) suspended in 50 ?L PBS. No adjuvant was used for immunization. The mice were restrained manually (for less than 2 minutes) for cell injection or anesthetized by isoflurane (2-5%) whenever required. Each mouse received a total of 6 injections at 3 day intervals. At the end of 5.sup.th immunization, mice were anesthetized by isoflurane (2-5%) inhalation and then blood was drawn from the tail vein. Sera were used to evaluate the antibody titer in an indirect ELISA. On Day 18 a mouse with highest titer was chosen for lymphocyte collection and fusion. Mice were euthanized by CO.sub.2 inhalation and then popliteal lymph nodes were dissected for collection of lymphocytes.
[0108] Generation of Hybridomas.
[0109] A schematic outlining the steps involved for development and isolation of a mAb with specificity for the CD19scFv region in CD19RCD28 CAR is shown in
[0110] Screening Hybridoma Clones.
[0111] A solid phase ELISA was used to determine the titer for the immune sera and to screen for hybridoma clones producing mAb specific for CD19scFv. Monoclonal antibodies were purified by standard protein G or protein A columns. One hybridoma clone (no. 136.20.1) was selected for characterization.
[0112] Flow Cytometry.
[0113] For detecting surface expression of CAR, about 0.25?10.sup.6 cells were suspended in 0.1 mL of FACS buffer (2% FBS in 1?PBS) and stained with antibodies conjugated to fluorochromes (Table 1). Following blocking for 30 minutes at 4? C. with 2% normal mouse sera (Jackson ImmunoResearch) in FACS buffer and washing twice with FACS buffer, the samples were incubated on ice with primary antibodies or conjugated antibodies for 30 minutes. Data were acquired on a FACSCALIBER? cell analysis platform (BD Biosciences) using CELLQUEST? software, version 3.3 (BD Biosciences). Dot plot analyses or MFI (median fluorescence intensity) was calculated by either FCS EXPRESS? software version 3.00.007 (Thornhill) or FLOWJO? software (version 7.6). To determine the sensitivity of anti-CD19scFv mAb (clone no. 136.20.1), CD19-specific CAR.sup.+ T cells were mixed with PBMC obtained from healthy donors (CAR.sup.neg cells) at varying cell ratios (1:10-1:10,000 CAR.sup.+ T cell to PBMC). ALEXA FLUOR? 647 dye conjugated mAb (clone no. 136.20.1) was used to detect CAR.sup.+ T cells by flow cytometry.
TABLE-US-00001 TABLE 1 Antibodies used for flow cytometry analysis Amount Antibody (?L) Cat no. Vendor Rat Anti-mouse 1 553033 Becton and Dickinson, CD8? San Jose, CA Goat anti-mouse 1 115-096-071 Jackson IgG Fcg fragment ImmunoResearch, specific PE West Grove, PA Goat F(Ab)2 anti-human 2.5 H10104 Invitrogen, IgGg R-PE Carlsbad, CA Anti-CD19.sup.+ CAR Fc 1 NA Cooper Lab, MDACC specific (2D3) Anti-CD19.sup.+ CAR 1 NA Cooper Lab, MDACC Idiotype 136.20.1- ALEXA FLUOR? 647 dye-ALEXA FLUOR? 488 dye Anti-CD3 PE 1 555333 Becton and Dickinson, San Jose, CA Anti-CD4 APC 2.5 555349 Becton and Dickinson, San Jose, CA Anti-CD4 PercP Cy5.5 2 341654 Becton and Dickinson, San Jose, CA Anti-CD8 PercP Cy5.5 2 341051 Becton and Dickinson, San Jose, CA Anti-CD8 Pacific blue 1 558207 Becton and Dickinson, San Jose, CA
[0114] Binding Assay.
[0115] Binding activity of purified anti-CD19scFv mAb (clone no. 136.20.1) was determined by an indirect ELISA. In brief, wells of a 96-well plate (Thermo Scientific Nunc) were coated with 100 ng of one of the following mAbs: anti-human CD19 mAb (clone FMC63, Millipore), anti-human CD19 mAb (clone MHCD1900, Gibco-Invitrogen), anti-human CD20 mAb (clone no. 1F5.1D4.1 derived by us from clone 1F5, clone no. HB-9645, ATCC), or human IgG (Jackson ImmunoResearch), in 0.1 mL of coating buffer (100 mM NaHCO.sub.3 pH 8.6). The plates were incubated at 37? C. for 1 h and then washed three times with PBST (1?PBS with 0.05% tween-20). Blocking was achieved with 300 ?L of 5% BSA in PBST. A dose curve was generated using different concentrations of purified anti-CD19scFv primary mAbs (2-30 ?g/mL) and detected by secondary antibody goat anti-mouse IgG Fc HRP (Sigma-Aldrich). Absorbance was read at 450 nm using a microplate reader (Victor 2030, Perkin Elmer).
[0116] Western Blot.
[0117] Reactivity of anti-CD19ScFv mAb (clone no. 136.20.1) to SDS-denatured protein was tested by western blot analysis. Ten million CAR modified or unmodified control T cells were lysed using RIPA buffer (50 mM Tris, pH 7.5, 150 mM NaCl, 0.1% SDS, 0.5% Sodium Deoxycholate, 1% Triton?100, 1 mM PMSF) containing protease inhibitor tablets as per the manufacturer's instructions (Roche Applied Science). Protein concentration was determined by a BCA kit (Thermo Scientific Pierce). Ten micrograms of total protein obtained from each cell lysates were electrophoresed under denaturing condition on a 4-20% gradient gel (Biorad) followed by electroblotting onto a PVDF membrane using a Criterion blotter (Biorad). PVDF membrane was blocked using 5% skim milk in PBST, and then incubated with primary anti-CD19ScFv mAb (clone no. 136.20.1). Binding was detected by goat anti-mouse IgG Fc HRP (Sigma-Aldrich) enhanced with ECL WESTFEMTO? substrate (Thermo Scientific Pierce). Images of blots were acquired on a gel doc image system using versa doc QUANTITYONE? software (Biorad).
[0118] Microscopy.
[0119] For confocal microscopy, genetically modified T cells expressing CD19RCD28 CAR were fixed in 4% paraformaldehyde (EMS Inc.) and stained with ALEXA FLUOR? 647 dye conjugated anti-CD19scFv mAb (clone 136.20.1) at 1:500 using a standard protocol. Labeled cells were added with PROLONG? gold anti-fade reagent with DAPI (Gibco-Invitrogen) and viewed under a confocal microscope (Leica Microsystems). For TEM, CAR.sup.+ T cells were fixed in 1% glutaraldehyde (Sigma-Aldrich) followed by washing with PBS. The cells were then incubated in 20 mM glycine-PBS followed by washing with PBS-BSA buffer (20 mM phosphate, 150 mM NaCl, pH 7.4 containing 0.5% BSA and 0.1% gelatin). NANOGOLD? antibody conjugates were diluted 1:50 in PBS-BSA buffer and incubated with CD19-specific CAR.sup.+ T cells for 15 min followed by washing with the same buffer to remove unbound conjugates. Finally, NANOGOLD? bound cells were fixed with 1% glutaraldehyde and stored at 4? C. until further use. Before sectioning, cells were subjected to an alcohol dehydration steps (5% to 100% graded alcohol separated in 5 steps) followed by embedding in epoxy resin. The resin embedded cells were then cut into sections (1 ?M to 100 nm thickness) in an ultra-microtome (Leica Microsystem). Sections were drawn onto a formavar coated copper grid. Staining was done by 2% uranyl acetate and then air dried. Unstained samples underwent silver enhancement (Nanoprobes) so that surface bound NANOGOLD? particles could be visualized. High magnification images were acquired by a 1 k?1 k CCD camera attached to a JEM-1200 EX60KV electron microscope (JEOL).
[0120] Chromium Release Assay (CRA).
[0121] The functionality of anti-CD19scFv mAb was assessed in a CD19-specific CAR.sup.+ T cell-mediated cytolysis in a standard 4 h chromium (.sup.51Cr) release assay (CRA) employing parental CD19.sup.neg EL4, CD19.sup.+ EL4, CD19.sup.+ Daudi?.sub.2m, and CD19.sup.+ NALM-6 as targets (Singh et al., 2008; Singh et al., 2011). Effector cells (ex vivo expanded CD19RCD28 CAR.sup.+ T cells harvested on day 28) were incubated with various concentrations of purified mAb (clone 136.20.1) at 10-fold serial dilution (maximum dose at 250 ?g/mL and minimum at 1.25 ?g/mL) for 20 min at 4? C., followed by washing with RPMI 1640 to remove unbound antibodies. The antibody-bound effector cells were incubated with .sup.51Cr labeled target cells in a clear v-bottom 96-well plate (Corning) at 37? C. Release of .sup.51Cr was quantified in a micro-plate scintillation counter TopCount NXT (Perkin-Elmer). Specific lysis was calculated for effector to target cell (E:T) ratios in the presence and absence of anti-CD19scFv mAb. Data were reported as mean?standard deviation (SD).
[0122] Video Time Lapse Microscopy (VTLM).
[0123] CD19-specific T cells expressing CD19RCD28 CAR were washed in sterile 1?PBS and stained for 30 min at room temperature using ALEXA FLUOR? 647 dye-conjugated to anti-CD19ScFv mAb (clone no. 136.20.1) at 2 ?g mAb per 100,000 cells and then washed three times with 1?PBS. The CAR.sup.+ T cells were mixed together with EGFP.sup.+ Daudi?.sub.2m at an effector to target ratio of 2:1. A cell pellet was made by brief centrifugation and then re-suspended in media RPMI 1640 and put in one of the chamber of a 35 mm culture dish (Nikon). This was kept in the specimen chamber of BIOSTATION? IM cell incubator and monitoring system (Nikon) and allowed to settle for 10 min. CCD camera focal planes were fixed and the effector to target cell dynamics were assessed for 2 to 12 hours using imaging software (IM-Q, v2.1.2.136, Nikon). As control, APC-conjugated goat anti-human IgG Fc? chain specific F(ab).sub.2 fragment antibody (Jackson ImmunoResearch) was used to bind CAR.sup.+ T cells and the co-culture was set up as described.
[0124] Indirect ELISA to Detect Antibody Titer and Screen Positive Hybridoma Clones.
[0125] The assay was performed by coating flat-bottom well of a 96-well MEDISORP? plate (Thermo Scientific Nunc) with parental L cells or L cells transfected with CD19scFvmCD8?. Approximately 250,000 cells were coated per well in 50 ?L of sodium phosphate buffer (pH 7.4). Plates were left overnight in laminar airflow hood for cell binding and drying and stored at ?20? C. until use. To block non-specific binding, 2% BSA in PBST (1?PBS containing 0.05% Tween-20) was dispensed at 300 ?L per well. Unbound cells were washed with PBST. Various dilutions of sera (1:100 to 1:3,000) or antibody supernatant (1:2-1:10) were allowed to bind with the coated cells/antigen for 1 h at room temperature (RT). After washing with PBST, secondary antibody anti-mouse IgG Fc HRP (Sigma-Aldrich) was added at 1:5,000 dilution and incubated for 45 min at room temperature. Detection of the bound antibody was performed after addition of 1?TMB/H.sub.2O.sub.2 substrate (Sigma-Aldrich). Absorbance was measured at 450 nm using a microplate reader (Victor 2030, Perkin Elmer). Cross reaction of immune sera and hybridoma supernatant with parental L cells was measured at OD.sub.450 and used as background controls. For transfected cells, wells showing OD.sub.450 values 3 times above background controls were marked positive. Random wells were viewed by microscopy before and after washing to ensure no loss of cells occurred during the process. The isotype of mAbs were determined using a mouse immunoglobulin isotyping kit (BD Biosciences). Positive clones were identified and expanded further in 1?HT (Sigma-Aldrich) supplement media. Sub-cloning was performed by standard limiting dilution method to obtain a monoclonal population. Monoclonal antibodies were purified using protein G or protein A columns (GE Life Science).
[0126] Antibody Purification and Conjugation.
[0127] One CD19scFv specific clone (no. 136.20.1) was grown and expanded further in vitro or injected in mice for ascites production (Harlan Inc.). Monoclonal antibodies from the culture supernatant or ascites were obtained by standard protein G or A (GE Life Science) purification using 0.1 M glycine (pH 2.7) as elution buffer. Affinity eluted and neutralized antibodies were dialyzed extensively against PBS and subjected to flow cytometry analysis for final validation and use in cell culture assays. Purified antibodies were conjugated to different fluorochromes viz., ALEXA FLUOR? 488 dye and ALEXA FLUOR? 647 dye (Molecular Probes-Invitrogen) using a commercially available kit that exploits the principle of conjugation through succinimidyl ester moiety to primary amines of proteins/immunoglobulins to form stable dye-protein conjugates. Fluorochrome-conjugated antibodies were subjected to gel filtration chromatography to remove unbound dye. For transmission electron microscope (TEM) studies, antibodies were conjugated to gold nanoparticles. In brief, antibodies were reduced by adding 1 mL of purified mAb (2 mg/mL) to 6 mg of mercaptoethylamine hydrochloride (MEA) (Thermoscientific-Pierce) and then purified on a gel filtration column MatrexGH25 (Millipore, Billerica, Mass.). Reduced antibodies were labeled with monomaleimido NANOGOLD? (Nanoprobes), as per the manufacturer's instructions, and purified on a gel filtration column Superdex-75 (Sigma-Aldrich) to remove unbound NANOGOLD?. The final concentration of the purified antibodies was measured by a BCA kit (Thermoscientific Pierce).
[0128] Immunohistochemistry.
[0129] CD19-specific CAR.sup.+ T cells were propagated as described. Cells were harvested, washed in 1?PBS and then fixed in formalin. Five micron paraffin-embedded sections were made and stained. In brief, sections were blocked initially with 3% hydrogen peroxide and whole goat sera blocking reagent for 5 minutes, followed by incubation with primary antibody anti-Id CAR idiotype for 30 minutes. Biotinylated goat anti-mouse IgG-HRP was used as secondary antibody at 1:500 for 30 minutes, followed by incubation with streptavidin-HRP for 15 minutes. Cells were localized with DAB (diaminobenzidine) for 5 minutes. Slides were counterstained with Mayer's hematoxylin for 5 minutes, dehydrated and mounted with a cover slip. Photographs were taken using a confocal microscope (Leica Microsystems).
[0130] Methodology to Derive Antibody Variable Region Sequence.
[0131] The antibody variable heavy chain (VH) and light chain sequences (VL) were derived after amplifying the VH and VL using sets of degenerate primers annealed to either variable heavy or light chain constant regions of monoclonal antibody (clone 136.20.1) cDNA. The PCR-amplified product was cloned into PCR4 TOPO vector (Invitrogen) and then sequenced. Consensus sequences were identified after aligning sequences obtained with T3 forward and T7 reverse primed pCR4 TOPO TA vector inserted with 136.20.1 V.sub.H or VL PCR product. Sequence alignment was performed in Vector NTI 11 (Invitrogen). CDR sequences of the monoclonal antibody were analyzed from the cDNA amplified sequences using IMGT software (on the world wide web at imgt.org/IMGT_vquest/vquest?livret=0&Option=mouseIg).
Example 2CD19 CAR-Targeting Monoclonal AntibodyResults
[0132] Generating Anti-ScFv mAb Recognizing CD19RCD28 CAR.
[0133] BALB/c mice were immunized using L cells (derived from C3H/An mouse strain) genetically modified to express the scFv region in a CD19-specific CAR (
TABLE-US-00002 TABLE2 SequenceofCD19scFv-specificmAbclone136.20.1 HeavyChainSequence LightChainSequence CDR1 CDR2 CDR3 CDR1 CDR2 CDR3 mAb Aminoacidsequence Aminoacidsequence 136.20.1 GFDFSRYW INLDSSTI ARRYDAMDY ESVDDYGISF AAP QQSKD (SEQIDNO:2) (SEQIDNO:3) (SEQIDNO:4) (SEQIDNO:6) (SEQIDNO:7) (SEQIDNO:8) LKPREVKLVESGGGLVQPGGSLKLSCAASGFDFSRYWMSWVRQ ASDIVLTQSPASLAVSLGQRATISCRASESVDDYGISFMNWFQQ APGKGLEWIGEINLDSSTINYTPSLKDKFIISRDNAKNINLDS KPGQPPKLLIYAAPNQGSGVPARFSGSGSGTDFSLNIHPMEEDD STINYTPSLKDKFIISRDNAKNTLYLQMSKVRSEDTALYYCAR TAMYFCQQSKDVRWRHQAGDQTG(SEQIDNO:5) RYDAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTL GCLVKASQ(SEQIDNO:1)
[0134] Specificity of mAb (Clone No. 136.20.1) for CD19scFv.
[0135] The specificity of mAb (clone no. 136.20.1) towards CD19scFv was initially evaluated by an indirect ELISA with wells coated with purified mAbs. Except for parental anti-human CD19 mAb (FMC63) all other antibodies exhibited negligible cross reactivity to CD19scFv specific mAb (
[0136] The anti-CD19scFV mAb (clone no. 136.20.1) could be used in multi-parameter flow cytometry analysis to characterize CAR.sup.+ cells selectively propagated on K562-derived aAPC (Jena et al. 2013). CAR-modified T cells were numerically expanded in the presence of irradiated aAPC and cytokines (IL-2 and IL-21) for 4 weeks as previously reported (Singh et al., 2011). The anti-CD19scFV mAb (clone 136.20.1) could detect both CD4.sup.+ and CD8.sup.+ CAR.sup.+ T cells (
[0137] Persistence of adoptively transferred CAR.sup.+ T cells in patients correlates with efficacy in eradicating tumor. The inventors desired that clone no. 136.20.1 be used in correlative studies pertaining to clinical trials that infuse CAR.sup.+ T cells and thus wanted to check if this mAb could detect CAR.sup.+ cells preserved in various harsh organic solvent fixatives. CARs could be detected by immunocytochemistry and TEM. At day 28 of culture CD19-specific CAR.sup.+ T cells were harvested and fixed by paraformaldehyde.
[0138] Anti-CD19scFv mAb can Block the Effector Function of CAR.sup.+ T Cells.
[0139] The inventors evaluated functional properties of anti-CD19scFv mAb (clone no. 136.20.1) based on its ability to prevent lysis mediated by CD19-specific CAR.sup.+ T cells. Previously, the inventors developed and validated an approach for ex vivo expansion of genetically modified CAR.sup.+ T cells on artificial antigen presenting cells (K562 clone #4). CAR.sup.+ T cells receive proliferative signals from the TAA (CD19) coordinated with co-stimulatory molecules (CD86, CD137L, membrane bound IL15) cloned onto the surface of K562 cells (
Example 3a Novel CAR-Targeting Functional Monoclonal Antibody (2D3) Amenable for CAR-Mediated Gene Therapy
[0140] Targeting tumor antigens through gene modified immune cells has increasingly been adopted by clinical oncologists, thanks to the ability of these cells to eradicate tumors that have been otherwise refractory to conventional therapies. The clinical trials conducted so far showed encouraging results. There is an increasing demand to place specific reagents so that isolation, activation, and functional characterization of these gene modified cells are possible. In this context, the inventors developed a Chimeric Antigen Receptor (CAR)-specific monoclonal antibody (2D3) that possesses unique ability to detect all chimeric antigen receptor (all CAR)-modified immune cells (
[0141] A novel and promising form of cancer therapy genetically modifies a patient's own T cells in peripheral blood to target and kill their cancer using a chimeric antigen receptor (CAR) directed against a tumor associated antigen (TAA). Growing a therapeutic number of CAR.sup.+ T cells to treat cancer patients requires an artificial antigen presenting cell (aAPC) to express the TAA that the CAR.sup.+ T cell targets. Antigen-specific growth using a cell based system requires at least a month of intensive monitoring for outgrowth of unwanted cell types. Here, the inventors provide a system that decreases the high cost and time associated with manufacturing a different aAPC for each TAA and decreases the time and effort needed to develop, validate, and manufacture large numbers of CAR.sup.+ T cells. An HLA-null K562 (HnK) was modified to surface express a chimeric antibody receptor that could bind to spacer domain present in all to all other CARs produced by the inventor's lab which are G4CAR. In another aspect, the specified spacer domain (Hinge-CH2-CH3) may also be used for CAR expression. When peripheral blood mononuclear cells (PBMC) are genetically modified to express a CAR containing this domain, those CAR.sup.+ PBMC can be co-cultured with G4CAR.sup.+ HnK (G4HnK) to specifically grow CAR.sup.+ T cells independent of TAA. Utilizing G4HnKs to grow CAR.sup.+ T cells generates a sufficient number of CAR.sup.+ T cells for therapy in half the amount of time typically needed utilizing antigen-specific aAPC. The T cells consistently grow without competition to a pure population within 2 weeks (>80% CAR.sup.+ T cells), and this level of infusion product purity is rarely achieved using current aAPC before one month of T cell co-culture with standard aAPC. Also unique to this system is the capacity to expand antigen non-specific CAR.sup.+ T cells as a means of antibody-independent T cell growth without tissue targeting. This provides a novel method of expanding CAR modified T cells developed on a common backbone but targeted to alternate tumor antigens. In conclusion, the inventors have made a single aAPC cell line capable of expanding any CAR.sup.+ T cell independent of a CAR-specific antigen.
TABLE-US-00003 TABLE3 SequenceofAllCARmAb2D3 HeavyChainSequence LightChainSequence CDR1 CDR2 CDR3 CDR1 CDR2 CDR3 mAb Aminoacidsequence Aminoacidsequence 2D3 GYTFTSYW IYPGNSDT TRVNWDGYSTMDY QSLVHSNGNTY KVS CSQTTHVPYTF (SEQID (SEQID (SEQID (SEQID (SEQID (SEQID NO:10) NO:11) NO:12) NO:14) NO:15) NO:16) PREXKLEQSGTVLARPGASVKMSCKTSGYTFT STLSLPVLSGDQASISCRSSQSLVHSNGNTYF SYWMHWVIQRPGQGLEWIGAIYPGNSDTNYNQ HWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGS KFKVKAKLTAVTSTSTAYMELSSLTDEDSAVY GSGTNFTLKISRVEAEDLGVYFCSQTTHVPYT YCTRVNWDGYSTMDYWGQGTSVTVSSAKTTPP FGGGTELEIKRADAAPTVS SVYASQRANSRP (SEQIDNO:13) (SEQIDNO:9)
Example 4Universal Artificial Antigen Presenting Cells to Selectively Propagate T Cells Expressing Chimeric Antigen Receptor Independent of Specificity
[0142] Cells and Culture Conditions.
[0143] K562 cells (European Collection of Cell Cultures through Sigma-Aldrich, St. Louis, Mo.; Cat. No. 89121407), noted for expression of desired endogenous adhesion molecules and the absence of most HLA class I and all class II molecules, (Suhoski et al. 2007) were used to derive CD19.sup.+ and CARL.sup.+ K562 that served as aAPC. Immortalized tumor targets CD19.sup.neg, GD2.sup.+ EL-4 murine thymoma (Cat. No. TIB-40) and CD19.sup.+, GD2.sup.neg NALM-6 (pre-B cell leukemia, Cat. No. CRL-1567) were purchased from American Type Culture Collection (ATCC, Manassas, Va.). Identity of cell lines was validated by the MDACC Cancer Center Support Grant Characterized Cell Line Core using short tandem repeat DNA fingerprinting. Peripheral blood was donated by consenting healthy volunteer adults at Gulf Coast Regional Blood Center (Houston, Tex.). Peripheral blood mononuclear cells (PBMC) were isolated using Ficoll-Paque Plus density centrifugation (GE Healthcare Biosciences, Piscataway Township, N.J.; Cat. No. 17-1440-02) before freezing in a mixture of 10% DMSO (Sigma, Allentown, Pa.; Cat. No. D2650), 50% heat-inactivated fetal bovine serum (FBS-Thermo Scientific Hyclone, Bridgewater, N.J., Cat. No. SH30070.03), and 40% RPMI 1640 (Thermo Scientific Hyclone; Cat. No. SH30096.01). All cells were cultured in a 37? C. humidified incubator with complete media (CM) prepared from RPMI 1640, 10% heatinactivated FBS, and 2 mM GlutaMAX supplement (Life Technologies, Grand Island, N.Y.; Cat. No. 35050061).
[0144] DNA Expression Plasmids.
[0145] Codon-optimized CD19RCD28mZ(CoOp)/pSBSO, (Singh et al. 2008) which codes for CAR between transposition sites mediated by SB transposase, (Davies et al. 2010) was used as the vector backbone for cloning of the following transgenes. The DNA plasmid 19G4CAR (also designated CD19RCD28 [Kowolik et al. 2006]
[0146] Propagation of CAR+ T Cells (CART).
[0147] The designs of each CAR and antigen (CARL and CD19) as expressed on the respective T cell or aAPC are shown in
[0148] Flow Cytometry.
[0149] FACSCALIBER? cell analysis platform (BD Biosciences, Billerica, Mass.) was used to acquire samples prepared in FACS staining solution as previously described. (Deniger et al. 2013) After washing once in FACS staining solution, cells were stained for 30 minutes at 4? C. without blocking in FACS staining solution containing a 1:33 dilution of antibody. When anti-human Fc antibody was used, the anti-Fc stained sample was washed and re-stained for alternative surface markers before re-suspension in FACS buffer for flow cytometer analysis. Measurement of intracellular cytokine used the same protocol for cell surface staining followed by 20 min. fixation using BD CYTOFIX/CYTOPERM? kit fixative (BD Biosciences; Cat No. 554714), followed by washing twice in perm/wash buffer containing 20% FBS and staining with a 1:33 dilution of antibody in perm/wash buffer. Antibody incubation lasted 30 minutes at 4? C. before samples were washed in perm/wash buffer and resuspended in FACS staining solution for acquisition. FLOWJO? software v 10.0.5 (Tree Star Inc., Ashland, Oreg.) was used for analysis of flow cytometry data.
[0150] Chromium Release Assay (CRA).
[0151] CRA was performed as previously described. (Singh et al. 2008) In brief, on Day 21 of T-cell co-culture on aAPC, the tumor targets (i) EL-4, (ii) NALM-6, and (iii) K562 were loaded with 51Cr for 3 hours, and, after washing, co-cultured with effector T cells for 6 hours at 37? C. using a ratio of 5 T cells to 1 target cell.
[0152] Abundance and Diversity of TCR Repertoire.
[0153] The direct TCR expression assay (DTEA), as previously reported, (Zhang et al. 2012) was used to measure the abundance of mRNA transcripts coding for 45 TCR ? alleles, 46 TCR ? alleles, 13 TCR ? alleles, and 5 TCR ? alleles from RNA obtained on Day 0 (T cells in PBMC before electroporation) and Day 21 (from T cells after electroporation/propagation). Day 0 samples were negatively sorted for CD56 (Miltenyi Biotec, Cambridge, Mass.; Cat. No. 130-050-401) and then positively sorted for CD3 (Miltenyi Biotec; Cat. No. 130-050-101). The resulting CD3.sup.+CD56.sup.neg T cells (2 to 3?10.sup.6 from each sample) were snap frozen as were 2?10.sup.6 cells directly harvested at Day 21 of co-culture. RNA was extracted from thawed samples using the ALLprep DNA/RNA mini kit (Qiagen; Cat. No. 80204).
[0154] Statistics.
[0155] Statistical analysis was performed using Prism v6.0 (Graph Pad Software Inc.). Student's t-test (unpaired) was used to perform two sample comparisons. One- or two-way ANOVA F-test was used to perform group comparisons, and if found significant (p<0.05); a t-test (unpaired) was undertaken to assess and report differences. Spearman's nonparametric correlation was performed on housekeeping gene normalized DTEA transcript counts to assess the divergence of the TCR repertoire in T cells from an experimental group and autologous Day 0 PBMC. If the Spearman correlation coefficient was greater than or equal to 0.8 (??0.8) within the 95% confidence interval of the correlation coefficient, then the two TCR repertoires were considered to be highly correlated.
[0156] Results
[0157] Numeric Expansion of CAR+ T Cells Upon K562 Cells Expressing CARL or CD19.
[0158] Mouse mAb clone 2D3 was obtained by repeated footpad injections of NSO cells expressing 19G4CAR into BALB/c mice and blocking studies defined the specificity of the mAb to the human IgG4 exodomain of 19G4CAR. (Singh et al. 2008) It was hypothesized that this mAb may be used to cross-link CAR and activate genetically modified T cells for sustained proliferation. Therefore, the scFv of 2D3 (designated CARL) was expressed on the cell surface to compare with human truncated CD19 TAA on K562 cells. The CARL and CD19 transgenes were cloned into DNA plasmids for co-expression with drug-selection genes between SB transposable elements. The SB transposon DNA plasmids for 2D3-derived scFv or CD19 were electro-transferred with SB11 transposase DNA plasmid into K562 cells in separate experiments. Genetically modified cells were propagated under drug selection from a single cell for homogeneous expression of CARL (as detected by antibody against mouse Fab) or CD19 (
[0159] CARL.sup.+ K562 can Numerically Expand CAR.sup.+ T Cells Independent of Specificity.
[0160] The 2D3-derived scFv on aAPC was evaluated for ability to propagate not just CD19-specific T cells, but CAR.sup.+ T cells of alternative specificities. The CD19 and GD226 TAAs are not present on parental K562 cells to propagate T cells expressing GD2G4CAR, 19G4CAR, and G4CAR. Nonetheless, T cells bearing these three CARs numerically expanded on CARL+ K562. The number of total viable T cells on Day 21 of co-culture with CARL.sup.+ K562 cells did not significantly differ between 19G4CAR, G4CAR, and GD2G4CAR (p=0.16,
[0161] The Choice of aAPC does not Skew the TCR Repertoire for Numerically Expanded CART.
[0162] Each T cell in peripheral blood bears a distinct pair of ?? or ?? TCRs which can be analyzed using the direct TCR expression assay (DTEA) to determine the abundance of TCR chains. This assay was employed to determine whether CARL.sup.+ or CD19.sup.+ K562 influenced the distribution of TCR alleles after 21 days co-culture on aAPC. TCR variants were assayed on the nCounter Analysis System using a set of 111 TCR ?, ?, ?, and ? transcripts. (Deniger et al. 2013; Zhang et al. 2012) By measuring the distribution of TCR alleles we could determine if the aAPC design preferentially supported the numeric expansion of some, but not all genetically modified T cells. The starting TCR distribution of T cells on Day 0 was ranked from the most to least frequent TCR usage and the rank order compared for T cells harvested on Day 21 of co-culture with aAPC (
TABLE-US-00004 TABLE 4 Comparison of TCR abundance harvested from T cells before versus after propagation on aAPC*. Day 21 19G4CAR G4CAR & GD2G4CAR 19G4CAR & CARL.sup.+ CARL.sup.+ & CARL.sup.+ & CD19.sup.+ Day 0 K562 K562 K562 K562 Day 0 0.748 0.857 0.867 0.912 (0.65-0.82) (0.80-0.90) (0.81-0.91) (0.87-0.94) Day 21 19G4CAR & 0.752 0.805 0.706 0.734 CARL.sup.+ K562 (0.65-0.83) (0.72-0.86) (0.59-0.79) (0.63-0.81) G4CAR & 0.899 0.71 0.816 0.839 CARL.sup.+ K562 (0.85-0.93) (0.61-0.79) (0.74-0.87) (0.77-0.89) GD2G4CAR 0.825 0.72 0.801 0.881 & CARL.sup.+ (0.75-0.88) (0.61-0.80) (0.72-0.86) (0.83-0.92) K562 19G4CAR & 0.916 0.69 0.887 0.808 CD19.sup.+ K562 (0.87-0.94) (0.57-0.78) (0.84-0.92) (0.73-0.87) *Analysis DTEA data from two donors was normalized using housekeeping genes and assessed using Spearman correlation coefficient to compare distributions of TCR usage for two donors. The upper right of the table contains the correlation between experimental groups for one donor. The lower left of the table contains the second donor subjected to the same analysis. Each cell in the table contains the Spearman correlation coefficient (?) and within the brackets the 95% confidence interval. (A strong correlation is considered to be ? ? 0.8.)
[0163] All of the methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
REFERENCES
[0164] The following references, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference. [0165] Alvarez-Rueda N, Desselle A, Cochonneau D, et al. A monoclonal antibody to O-acetyl-GD2 ganglioside and not to GD2 shows potent antitumor activity without peripheral nervous system cross-reactivity. PloS One. 2011; 6(9):e25220. [0166] Brentjens et al., Safety and persistence of adoptively transferred autologous CD19-targeted T cells in patients with relapsed or chemotherapy refractory B-cell leukemias. Blood, 118:4817-4828, 2011. [0167] Brentjens et al., CD19-targeted cells rapidly induce molecular re et al missions in adults with chemotherapy-refractory acute lymphoblastic leukemia Sci. Transl. Med., 5:177ra38, 2013. [0168] Cooper et al., T-cell clones can be rendered specific for CD19: toward the selective augmentation of the graft-versus-B-lineage leukemia effect. Blood, 101:1637-1644, 2003. [0169] Cooper et al., Good T cells for bad B cells. Blood, 119:2700-2702, 2012. [0170] Davies J K, Singh H, Huls H, et al. Combining CD19 redirection and alloanergization to generate tumor-specific human T cells for allogeneic cell therapy of B-cell malignancies. Can Res. May 15 2010; 70(10):3915-3924. [0171] Deniger D C, Switzer K, Mi T, et al. Bispecific T-cells expressing polyclonal repertoire of endogenous gammadelta T-cell receptors and introduced CD19-specific chimeric antigen receptor. Mol Ther. March 2013; 21(3): 638-647. [0172] Hackett et al., A transposon and transposase system for human application. Mol. Ther., 18:674-683, 2010. [0173] Hombach et al., Adoptive immunotherapy with genetically engineered T cells: modification of the IgG1 Fc spacer domain in the extracellular moiety of chimeric antigen receptors avoids off-target activation and unintended initiation of an innate immune response. Gene Ther., 17:1206-1213, 2010. [0174] Huls et al., Clinical Application of Sleeping Beauty and Artificial Antigen Presenting Cells to Genetically Modify T Cells from Peripheral and Umbilical Cord Blood. J. Vis. Exp., doi:10.3791/50070, 2012. [0175] Jena et al., Redirecting T-cell specificity by introducing a tumor-specific chimeric antigen receptor. Blood, 116:1035-1044, 2010. [0176] Jena et al. Chimeric Antigen Receptor (CAR)-specific monoclonal antibody to detect CD19-specific T cells in clinical trial. PLoS One, 8(3):e57838, 2013 [0177] June et al., Engineering lymphocyte subsets: tools, trials and tribulations. Nat. Rev. Immunol., 9:704-716, 2009. [0178] Kalos et al., T cells with chimeric antigen receptors have potent antitumor effects and can establish memory in patients with advanced leukemia. Sci. Transl. Med., 3:95ra73, 2011. [0179] Kochenderfer et al., Eradication of B-lineage cells and regression of lymphoma in a patient treated with autologous T cells genetically engineered to recognize CD19. Blood, 116:4099-4102, 2010. [0180] Kochenderfer et al., B-cell depletion and remissions of malignancy along with cytokine-associated toxicity in a clinical trial of anti-CD19 chimeric-antigen-receptor-transduced T cells. Blood, 119:2709-2720, 2012. [0181] Kowolik et al., CD28 costimulation provided through a CD19-specific chimeric antigen receptor enhances in vivo persistence and antitumor efficacy of adoptively transferred T cells. Cancer Res., 66:10995-11004, 2006. [0182] Lamers et al. Immune responses to transgene and retroviral vector in patients treated with ex vivo-engineered T cells. Blood, 117:72-82, 2011. [0183] Ma et al., Anti-prostate specific membrane antigen designer T cells for prostate cancer therapy. Prostate, 61:12-25, 2004. [0184] Maiti et al. J Immunother. Sleeping beauty system to redirect T-cell specificity for human applications 36(2):112-23, 2013. [0185] Manuri et al., piggyBac transposon/transposase system to generate CD19-specific T cells for the treatment of B-lineage malignancies. Hum. Gene Ther., 21:427-437, 2009. [0186] Moeller et al., Adoptive transfer of gene-engineered CD4+ helper T cells induces potent primary and secondary tumor rejection. Blood, 106:2995-3003, 2005. [0187] Morgan et al., Cancer regression in patients after transfer of genetically engineered lymphocytes. Science, 314:126-129, 2006. [0188] Morgan, Adoptive cell therapy: genetic modification to redirect effector cell specificity. Cancer J., 16:336-341, 2010. [0189] Nicholson et al. Construction and characterisation of a functional CD19 specific single chain Fv fragment for immunotherapy of B lineage leukaemia and lymphoma. Mol. Immunol., 34:1157-1165, 1997. [0190] O'Connor et al., Adoptive T-cell therapy improves treatment of canine non-Hodgkin lymphoma post chemotherapy. Scientific Reports, 2, 2012. [0191] Park et al., Adoptive transfer of chimeric antigen receptor re-directed cytolytic T lymphocyte clones in patients with neuroblastoma. Mol. Ther., 15:825-833, 2007. [0192] Porter et al., Chimeric Antigen Receptor-Modified T Cells in Chronic Lymphoid Leukemia. New England Journal of Medicine, 365:725-733, 2011. [0193] Pule et al., Virus-specific T cells engineered to coexpress tumor-specific receptors: persistence and antitumor activity in individuals with neuroblastoma. Nat. Med., 14:1264-1270, 2008. [0194] Rabinovich et al. A role for the MHC class I-like Mill molecules in nutrient metabolism and wound healing. Immunol. Cell Biol. 86: 489-496, 2008 [0195] Rossig et al., Targeting of G(D2)-positive tumor cells by human T lymphocytes engineered to express chimeric T-cell receptor genes. Int. J. Cancer, 94:228-236, 2001. [0196] Rossig et al., Epstein-Barr virus-specific human T lymphocytes expressing antitumor chimeric T-cell receptors: potential for improved immunotherapy. Blood, 99:2009-2016, 2002. [0197] Savoldo et al., CD28 costimulation improves expansion and persistence of chimeric antigen receptor-modified T cells in lymphoma patients. J. Clin. Invest., 121:1822-1826, 2011. [0198] Singh et al., Redirecting specificity of T-cell populations for CD19 using the Sleeping Beauty system. Cancer Res., 68:2961-2971, 2008. [0199] Singh et al., Reprogramming CD19-specific T cells with IL-21 signaling can improve adoptive immunotherapy of B-lineage malignancies. Cancer Res., 71:3516-3527, 2011. [0200] Till et al., Adoptive immunotherapy for indolent non-Hodgkin lymphoma and mantle cell lymphoma using genetically modified autologous CD20-specific T cells. Blood, 112:2261-2271, 2008. [0201] Torikai et al., A foundation for universal T-cell based immunotherapy: T cells engineered to express a CD19-specific chimeric-antigen-receptor and eliminate expression of endogenous TCR. Blood, 119:5697-5705, 2012. [0202] Vera et al., T lymphocytes redirected against the kappa light chain of human immunoglobulin efficiently kill mature B lymphocyte-derived malignant cells. Blood, 108:3890-3897, 2006. [0203] Wang Z, Raifu M, Howard M, et al. Universal PCR amplification of mouse immunoglobulin gene variable regions: the design of degenerate primers and an assessment of the effect of DNA polymerase 3 to 5 exonuclease activity. J Immuno Methods. Jan. 13 2000; 233(1-2):167-177. [0204] Whitlow et al., An improved linker for single-chain Fv with reduced aggregation and enhanced proteolytic stability. Protein Engineering, 6:989-995, 1993. [0205] Zhang M, Maiti S, Bernatchez C, et al. A new approach to simultaneously quantify both TCR alpha- and beta-chain diversity after adoptive immunotherapy. Clin Can Res. Sep. 1 2012; 18(17):4733-4742. [0206] Zheng et al., Protein L: a novel reagent for the detection of chimeric antigen receptor (CAR) expression by flow cytometry J. Transl. Med., 10:29, 2012.