Antibody-binding peptide
09605029 ยท 2017-03-28
Assignee
Inventors
Cpc classification
C07K1/22
CHEMISTRY; METALLURGY
International classification
C07K14/00
CHEMISTRY; METALLURGY
Abstract
Polypeptides which have binding activity to an Fc region of immunoglobulin G and can be favorably used in detecting, purifying, immobilizing or removing an antibody, immunoglobulin G or a protein containing an Fc region of immunoglobulin G, are described. Methods for detecting, purifying, immobilizing or removing an antibody, immunoglobulin G or a protein containing an Fc region of immunoglobulin G, by using the peptide, are also described.
Claims
1. A polypeptide exhibiting binding activity to an Fc region of immunoglobulin G, wherein the polypeptide comprises the amino acid sequence represented by the following formula 1: TABLE-US-00040 (SEQIDNO:1) Y-D-P-x-T-G-T-W-R-S-x-[IL] (1) where x represents any amino acid residue; and amino acid residues within the square brackets indicate that any one of the amino acid residues is selected.
2. The polypeptide according to claim 1, consisting of: a) the amino acid sequence represented by formula 1; b) the amino acid sequence represented by any one of SEQ ID NOs: 2 to 6: TABLE-US-00041 (SEQIDNO:2) YDPRTGTWRSSIAYGGG (SEQIDNO:3) YDPGTGTWRSYLRFGGG (SEQIDNO:4) YDPYTGTWRSSIWVLSG (SEQIDNO:5) YDPGTGTWRSWLSFNVG (SEQIDNO:6) YDPWTGTWRSFIWGGGG; or c) an amino acid sequence having addition of one or several amino acid residues in the amino acid sequence represented by any one of SEQ ID NOs: 2 to 6.
3. The polypeptide according to claim 1, consisting of the amino acid sequence represented by the following formula 2: TABLE-US-00042 (SEQIDNO:10) R-[QRS]-x-x-[GS]-Y-D-P-R-T-G-T-W-R-S-S-I-A-Y- G-G(2) where x represents any amino acid residue; and amino acid residues within the square brackets indicate that any one of the amino acid residues is selected.
4. The polypeptide of claim 3, consisting of: a) the amino acid sequence represented by any one of SEQ ID NOs: 11 to 14; TABLE-US-00043 (SEQIDNO:11) GVVRQWSGYDPRTGTWRSSIAYGGG (SEQIDNO:12) AGSRRAHGYDPRTGTWRSSIAYGGG (SEQIDNO:13) ASVRSWSSYDPRTGTWRSSIAYGGG (SEQIDNO:14) SWRRRGSSYDPRTGTWRSSIAYGGG; b) an amino acid sequence obtained by addition of one or several amino acid residues in the amino acid sequence represented by SEQ ID NOs: 11 to 14; or c) the amino acid sequence represented by any one of SEQ ID NOs: 15 to 19, 158-160 and 163: TABLE-US-00044 (SEQIDNO:15) TGRGRSARYDPRTGTWRSSIAYGGG (SEQIDNO:16) HWVNGRSGYDPRTGTWRSSIAYGGG (SEQIDNO:17) ERWITWSGYDPRTGTWRSSIAYGGG (SEQIDNO:18) GSVVRWRGYDPRTGTWRSSIAYGGG (SEQIDNO:19) GAVYRRSFYDPRTGTWRSSIAYRGG (SEQIDNO:158) GVVRRWSGYDPRTGTWRSSIAYGGG (SEQIDNO:159) GVVRQAQSGYDPRTGTWRSSIAYGGG (SEQIDNO:160) GVVRQWAGYDPRTGTWRSSIAYGGG (SEQIDNO:163) GVVRQWSGYDPRTGTWRSAIAYGGG.
5. A polypeptide exhibiting binding activity to an Fc region of immunoglobulin G, wherein the polypeptide is a tandem polypeptide formed by linking a second polypeptide to an amino terminal or a carboxyl terminal or both terminals of the polypeptide according to claim 1.
6. The polypeptide according to claim 5, which is a tandem polypeptide formed by linking a second polypeptide to an amino terminal or a carboxyl terminal or both terminals of the polypeptide of any one of SEQ ID NOs: 2 to 9, 11 to 19, 21, 22, 24 to 55, 57 to 81, 158 to 164 and 174 to 178.
7. A protein exhibiting binding activity to an Fc region of immunoglobulin G, wherein the protein is a fusion protein formed by binding a protein to the amino terminal or carboxyl terminal or both terminals of the polypeptide according to claim 1.
8. The protein according to tai claim 7, which is a fusion protein formed by binding a protein to the amino terminal or carboxyl terminal or both terminals of the polypeptide of any one of SEQ ID NOs: 2 to 9, 11 to 19, 21, 22, 24 to 55, 57 to 81, 158 to 164 and 174 to 178, or any one of SEQ ID NOs: 82 to 119.
9. A kit for detecting, purifying, immobilizing or removing an antibody, immunoglobulin G or a protein containing an Fc region of immunoglobulin G, comprising the polypeptide according to claim 1.
10. A polypeptide exhibiting binding activity to an Fc region of immunoglobulin G, wherein the polypeptide consists of the amino acid sequence represented by any one of SEQ ID NOs: 7 to 9: TABLE-US-00045 (SEQIDNO:7) YDPRTGTWLLYASRLLG (SEQIDNO:8) YDPVTGTWTSSIASWMG (SEQIDNO:9) YDPRTGTWRRSSLSYSG.
11. A polypeptide exhibiting binding activity to an Fc region of immunoglobulin G, wherein the polypeptide consists of the amino acid sequence represented by any one of SEQ ID NOs: 15 to 19 and 158 to 164: TABLE-US-00046 (SEQ ID NO: 15) TGRGRSARYDPRTGTWRSSIAYGGG (SEQ ID NO: 16) HWVNGRSGYDPRTGTWRSSIAYGGG (SEQ ID NO: 17) ERWITWSGYDPRTGTWRSSIAYGGG (SEQ ID NO: 18) GSVVRWRGYDPRTGTWRSSIAYGGG (SEQ ID NO: 19) GAVYRRSFYDPRTGTWRSSIAYRGG (SEQ ID NO: 158) GVVRRWSGYDPRTGTWRSSIAYGGG (SEQ ID NO: 159) GVVRQAQSGYDPRTGTWRSSIAYGGG (SEQ ID NO: 160) GVVRQWAGYDPRTGTWRSSIAYGGG (SEQ ID NO: 161) GVVRQWSGYDPRTGTWASSIAYGGG (SEQ ID NO: 162) GVVRQWSGYDPRTGTWRASIAYGGG (SEQ ID NO: 163) GVVRQWSGYDPRTGTWRSAIAYGGG (SEQ ID NO: 164) GVVRQWSGYDPRTGTWRSSAAYGGG.
Description
BRIEF DESCRIPTION OF DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14) The specification contains the content described in the specification of Japanese Patent Application No. 2013-13217 based on which the priority right of the present application was claimed.
DESCRIPTION OF EMBODIMENTS
(15) The present invention relates to a polypeptide exhibiting binding activity to immunoglobulin G and an Fc region thereof and a method for detecting, immobilizing, purifying or removing immunoglobulin G and an Fc region thereof by use of the polypeptide.
(16) A preferred embodiment of the polypeptide of the present invention is a polypeptide containing, as a common sequence, an amino acid sequence represented by SEQ ID NO: 1:
(17) TABLE-US-00016 Y-D-P-x-T-G-T-W-R-S-x-[IL]
where x represents any amino acid residue; and amino acid residues within the square brackets indicate that any one of the amino acid residues is selected;
and more preferably, a polypeptide containing an amino acid sequence represented by any one of SEQ ID NOs: 2 to 6. The polypeptide of the present invention includes a polypeptide consisting of an amino acid sequence, which basically contains the common sequence (SEQ ID NO: 1) and may have addition, deletion, substitution or insertion of several amino acid residues (e.g., 1 to 6, preferably 1 to 3, more preferably 1 or 2) as long as the binding activity thereof to an Fc region of immunoglobulin G is not damaged, like polypeptides represented by any one of SEQ ID NOs: 7 to 9 in Example 1 described later. The number of amino acid residues in the polypeptide sequence is not limited as long as the above amino acid sequence is contained. As shown in Example 1, 6) described later, a recombinant phage displaying the polypeptide on the surface layer and obtained by transformation with a nucleic acid encoding the polypeptide also has the binding activity to an Fc region of immunoglobulin G. In short, the present invention includes a polypeptide having the above amino acid sequence, a fusion protein containing the polypeptide and a transformant having a nucleic acid encoding the polypeptide or the fusion protein.
(18) Another preferred embodiment is a polypeptide containing, as a common sequence, an amino acid sequence represented by SEQ ID NO: 10:
(19) TABLE-US-00017 R-[QRS]-x-x-[GS]-Y-D-P-R-T-G-T-W-R-S-S-I-A-Y-G-G
where x represents any amino acid residue; and amino acid residues within the square brackets indicate that any one of the amino acid residues is selected;
and more preferably, a polypeptide containing an amino acid sequence represented by any one of SEQ ID NOs: 11 to 14. The polypeptide of the present invention includes a polypeptide consisting of an amino acid sequence, which basically contains the common sequence (SEQ ID NO: 1) and may have addition, deletion, substitution or insertion of several amino acid residues (e.g., 1 to 10, preferably 1 to 6, more preferably 1 to 3) as long as the binding activity thereof to an Fc region of immunoglobulin G is not damaged, like a polypeptide represented by any one of SEQ ID NOs: 15 to 21 in Example 1 described later. The number of amino acid residues in the polypeptide sequence is not limited as long as the above amino acid sequence is contained. As shown in Example 1, 5) and 6) described later, the fusion protein having the polypeptide and also a recombinant phage displaying the polypeptide on the surface layer and obtained by transformation with a nucleic acid encoding the polypeptide have the binding activity. In short, the present invention includes a polypeptide having the above amino acid sequence, a fusion protein containing the polypeptide and a transformant having a nucleic acid encoding the polypeptide or the fusion protein.
(20) Another preferred embodiment is a polypeptide containing, as a common sequence, an amino acid sequence represented by SEQ ID NO: 23:
(21) TABLE-US-00018 D-A-A-W-H-L-G-E-L-V-W-A-T-Y-Y-D-P-E-T-G-T-W-x-P-D- W-x-x-M
where x represents any amino acid residue;
and more preferably a polypeptide containing an amino acid sequence represented by any one of SEQ ID NOs: 24 to 54. The polypeptide of the present invention includes a polypeptide consisting of an amino acid sequence, which basically contains the common sequence (SEQ ID NO: 23) and may have addition, deletion, substitution or insertion of several amino acid residues (e.g., 1 to 10, preferably 1 to 6, more preferably 1 to 3) as long as the binding activity thereof to an Fc region of immunoglobulin G is not damaged, like a polypeptide represented by SEQ ID NO: 55 in Example 2 described later. The number of amino acid residues in the polypeptide sequence is not limited as long as the above amino acid sequence is contained. As shown in Example 2, 5) and 6) described later, the fusion protein having the polypeptide and also a recombinant phage displaying the polypeptide on the surface layer and obtained by transformation with a nucleic acid encoding the polypeptide have the binding activity. In short, the present invention includes a polypeptide having the above amino acid sequence, a fusion protein and a transformant having a nucleic acid encoding the polypeptide and/or the fusion protein.
(22) Another preferred embodiment is a polypeptide containing, as a common sequence, an amino acid sequence represented by SEQ ID NO: 56:
(23) TABLE-US-00019 [RSG]-[AGV]-x-Y-D-P-E-T-G-T-W-Y-D-A-A-W-H-L-G-E-L- V-W-A-T-Y-Y-D-P-E-T-G-T-W-E-P-D-W-Q-R-M-L-G-Q
where x represents any amino acid residue; and amino acid residues within the square brackets indicate that any one of the amino acid residues is selected;
and more preferably a polypeptide containing an amino acid sequence represented by any one of SEQ ID NOs: 57 to 72. The polypeptide of the present invention includes a polypeptide consisting of an amino acid sequence, which basically contains the common sequence (SEQ ID NO: 56) and may have addition, deletion, substitution or insertion of several amino acid residues (e.g., 1 to 10, preferably 1 to 6, more preferably 1 to 3) as long as the binding activity thereof to an Fc region of immunoglobulin G is not damaged, like a polypeptide represented by any one of SEQ ID NOs: 73 to 81 in Example 2 described later. The number of amino acid residues in the polypeptide sequence is not limited as long as the above amino acid sequence is contained. As shown in Example 2, 5) and 6) described later, the fusion protein having the polypeptide and also a recombinant phage displaying the polypeptide on the surface layer and obtained by transformation with a nucleic acid encoding the polypeptide have the binding activity. In short, the present invention includes a polypeptide having the above amino acid sequence exhibiting binding activity to an Fc region, a fusion protein and a transformant having a nucleic acid encoding the polypeptide and/or the fusion protein.
(24) The polypeptide and protein of the present invention may have a label. More specifically, the present invention may include a modified polypeptide or modified protein prepared by binding an organic compound or an inorganic compound or both of an organic compound and inorganic compound to the above polypeptide or fusion protein as long as the binding activity to an Fc region of immunoglobulin G is not damaged. Owing to binding of the above organic compound and the like, immobilization, purification, detection or removal (which is an example of use of the present invention as described below) of an antibody, immunoglobulin G or a protein containing an Fc region of immunoglobulin G, can be efficiently performed. Preferred examples of the organic compound and the like to be used may include biotin, fluorescent organic compounds such as fluorescein, a stable isotope, a phosphoric acid group, an acyl group, an amide group, an ester group, an epoxy group, polyethylene glycol (PEG), a lipid, a sugar chain, and a nucleic acid; and fluorescent inorganic compounds such as a quantum dot; and colloidal gold (Basle E, Joubert N, Pucheault M, Protein chemical modification on endogenous amino acids. Chem Biol. 2010, 17(3), 213-27.); however, other compounds, as long as they are technically applicable, may not be excluded.
(25) Use of the polypeptide of the present invention is not limited as long as the binding activity of the polypeptide molecule to an Fc region of immunoglobulin G is used. Generally, an artificially prepared immunoglobulin G-binding polypeptide or an immunoglobulin G-binding protein derived from a microorganism is used for immobilization, purification, detection or removal of an antibody, immunoglobulin G or a protein containing an Fc region of immunoglobulin G (Non Patent Literature 14, Non Patent Literature 15, Patent Literature 1, Patent Literature 3, Non Patent Literature 6 and Non Patent Literature 9). Accordingly, examples of use of the polypeptide of the present invention may include not only uses to which the above immunoglobulin G-binding molecule is actually applied but also all uses known to those skilled in the art, to which the present invention is technically applicable. In Examples described later, detection, purification and removal of immunoglobulin G are mentioned; however, other uses may not be excluded.
(26) Of the polypeptides of the present invention, a polypeptide having an amino acid sequence represented by SEQ ID NO: 10 as the common amino acid sequence exhibits a specific binding activity to immunoglobulin G and an Fc region having a non-native structure, as shown in Example 1, 7) described later and thus can be used in immobilization, purification, detection or removal of immunoglobulin G and an Fc region having a non-native structure. The non-native structure used herein is a general term which refers to not a natural structure but a structure produced by e.g., an acid treatment, a heat treatment, a treatment with a chemical denaturant, a treatment with a reducing agent and physical impact such as shearing and stirring.
(27) The acid treatment herein refers to a treatment in which a polypeptide is exposed to a condition of preferably pH 4.0 or less and more preferably pH 1.5 to 2.0. For example, it is reported that if immunoglobulin G is treated with a buffer (10 mM Glycine-HCl, 150 mM NaCl, pH 2.0), a non-native structure (which differs from a general natural structure) called alternatively folded state (AFS), is formed (Non Patent Literature 16, Non Patent Literature 17 and Non Patent Literature 18).
(28) It is generally known that the conformation of a protein is changed not only by an acid treatment but also other chemical treatments or physical treatments. It is most generally known that a conformational change easily occurs by heat or a chemical denaturant such as guanidine hydrochloride (Non Patent Literature 19). More specifically, in an Fc region of immunoglobulin G, it is reported that AFS is formed by heat denaturation in the proximity of 75 C. (Non Patent Literature 20). As the other chemical treatments and physical treatments, a treatment with a reducing agent and physical impact such as shearing and stirring are widely known. The treatment with a reducing agent herein refers to a treatment by which disulfide bonds within a molecule or between molecules are wholly or partly cleaved, more specifically, refers to a treatment of adding a reducing agent (such as DTT, -mercaptoethanol and 2-mercaptoethylamine) to cleave disulfide bonds. In Examples described later, a reduction treatment was performed with 50 mM 2-mercaptoethylamine for 90 minutes. However, the reagent causing reductive conditions is not limited to this. The physical impact such as stirring and shearing is not limited. For example, it is reported that oxidization of an amino acid residue and conformational change of a protein occur to aggregate the protein by rotating an immunoglobulin G solution by a stirrer at a rate of 700 rpm (Non Patent Literature 21 and Non Patent Literature 22). In Example 1, 7) described later, the measurement results of binding activity to immunoglobulin G and an Fc region treated with acid and/or heat, or a reducing agent and treated under the condition where AFS is formed with acid, are described. Of the non-native structures of immunoglobulin G and an Fc region, to which the polypeptide of the present invention is to be bound, non-native structures other than this are not excluded.
(29) It is conceivable that the polypeptide according to the present invention can be used for immobilization, purification, detection or removal of immunoglobulin and an Fc region under e.g., a reductive condition. The immunoglobulin G-binding polypeptide of the present invention does not depend upon cyclization through disulfide crosslinkage and resultant functionalization/stabilization. Accordingly, the binding function can be exhibited even under reductive conditions where disulfide crosslinkage is not easily formed. The reductive conditions where disulfide crosslinkage is not easily formed are conceivably as follows: (1) a cytoplasmic environment, (2) an environment where a reducing agent is added in order to convert the thiol group of a cysteine residue of target immunoglobulin G or Fc region to a free radical for e.g., chemical modification. In Example 1, 7) described later, an Fc region was treated under a reductive condition using a reducing agent, i.e., 2-mercaptoethylamine (Thermo Scientific Pierce) and the reductive condition was maintained in the presence of a chelating agent, i.e., ethylenediaminetetraacetate (Non Patent Literature 23); however, other conditions are not excluded as long as disulfide crosslinkage is not formed.
(30) In the present invention, the synthesis method for a polypeptide and the embodiment to be used are not limited. As a method for preparing a polypeptide whose amino acid sequence has been identified, various synthesis methods are reported including a synthesis method in an organic chemical manner, a method based on gene recombination (reference literature: Kenji Kangawa, Peptide and Drug Development, Medical Do) and an expression method of a polypeptide in the form of a fusion protein by linking to any protein (reference literature: Tatsuya Moriyama, Protein Purification and Know-how of Handling, YODOSHA Co., Ltd.). Likewise, a polypeptide whose amino acid sequence is specified can be easily prepared by applying an existing synthesis technology. In Examples described later, a preparation by synthesis in an organic chemical manner, a preparation by cellular expression of a fusion protein, a preparation of a desired polypeptide by cleavage of a fusion protein with protease and a preparation of a recombinant phase displaying a polypeptide on a surface layer by transformation with a nucleic acid encoding the polypeptide are disclosed. Other methods including the aforementioned techniques are not excluded.
(31) The present invention also relates to a solid phase carrier to which the polypeptide of the present invention is to be immobilized. Examples of a preferred solid phase carrier herein may include, but are not limited to, resins such as a polystyrene and a polyester; bio-polymers such as dextran and agarose; and inorganic materials such as a metal and glass. These solid phase carrier may have any shape such as a particle, a plate, a film, a chip and a test tube. A polypeptide can be immobilized to these solid phase carriers by a covalent bonding method, a physical adsorption method, an ion bonding method or an intramolecular interaction method. In Examples described later, immobilization to a sensor chip of a surface plasmon resonance measurement apparatus by the covalent bonding method and immobilization to polymer particles used in an affinity chromatography column are mentioned; however, other support carriers and immobilization methods are not excluded, as described above. The polypeptide of the present invention and the molecules containing the polypeptide, such as a fusion protein can be favorably used for immobilization, purification or removal of immunoglobulin G and an Fc region by immobilizing them to a solid phase carrier. In Examples described later, it is stated that immunoglobulin G was purified by affinity chromatography using a column in which a fusion protein containing a polypeptide is immobilized, and that Fab was purified by removing an Fc region from a product obtained by digesting immunoglobulin G with an enzyme, papain. Form of a solid phase carrier and an immobilization method are not limited to this. Protein purification means known to those skilled in the art such as particles (e.g., magnetic particles) and filter membranes can be favorably used. As the target molecule to be purified, other than immunoglobulin G, a fusion protein produced by linking any protein (such as a cytokine and an enzyme) and an Fc region can be also used.
(32) Examples of a method for measuring the binding activity of a polypeptide may include Enzyme Linked Immuno-Sorbent Assay (ELISA), a surface plasmon resonance method (SPR), isothermal titration calorimetry (ITC), quartz crystal microbalance (QCM) method, an atomic force microscopic (AFM) method (for these, see Non Patent Literature 24), a pull-down method (Non Patent Literature 25), an electrophoresis method (Non Patent Literature 26) and a fluorescence polarization measurement method (Non Patent Literature 27). In Examples described later, Enzyme Linked Immuno-Sorbent Assay and a surface plasmon resonance method are described as examples; however, other methods including the above techniques are not excluded.
(33) An antibody, immunoglobulin G or Fc region-containing protein having a non-native conformation in a sample can be detected and separated (purified or removed) by use of the polypeptide and the fusion protein of the present invention.
(34) A method for detecting an antibody, immunoglobulin G or Fc region-containing protein having a non-native conformation in a test sample may include the following steps of:
(35) (1) bringing a test sample into contact with the polypeptide, protein, transformant, recombinant phage or recombinant virus of the present invention, or the polypeptide immobilized or the protein immobilized, and
(36) (2) determining whether a bond is formed or not between the test sample and the polypeptide, protein, transformant, recombinant phage or recombinant virus, or the polypeptide immobilized or the protein immobilized.
(37) Examples of the method for use in the step of determining whether a bond is formed or not may include ELISA, SPR, ITC, a QCM method, an AFM method, a pull-down method, an electrophoresis method, a fluorescence polarization measurement method, a fluorescence resonance energy transfer method (FRET), column chromatography and immunochromatography. In Examples described later, a surface plasmon resonance method is disclosed as an example; however, other technically applicable methods including the aforementioned techniques are not excluded.
(38) The method for purifying an antibody, immunoglobulin G or Fc region-containing protein having a non-native conformation may include the following steps of:
(39) (1) bringing a sample containing an antibody, immunoglobulin G or Fc region-containing protein having a non-native conformation into contact with the polypeptide, protein, transformant, recombinant phage or recombinant virus of the present invention, or the polypeptide immobilized or the protein immobilized to allow the antibody, immunoglobulin G or Fc region-containing protein having a non-native conformation to bind to the polypeptide, protein, transformant, recombinant phage or recombinant virus, or the polypeptide immobilized or the protein immobilized, and
(40) (2) a step of recovering the antibody, immunoglobulin G or Fc region-containing protein having a non-native conformation bound to the polypeptide, protein, transformant, recombinant phage or recombinant virus, or the polypeptide immobilized or the protein immobilized from the sample.
(41) Examples of the method for use in the recovering step from the sample may include affinity chromatography, an affinity beads method, an affinity filter method and an immunoprecipitation method. In Examples described later, affinity chromatography is used as an example; however, other technically applicable methods including the above techniques are not excluded.
(42) The method for removing an antibody, immunoglobulin G or Fc region-containing protein having a non-native conformation may include the following steps of:
(43) (1) bringing a sample containing an antibody, immunoglobulin G or Fc region-containing protein having a non-native conformation into contact with the polypeptide, protein, transformant, recombinant phage or recombinant virus of the present invention, or the polypeptide immobilized or the protein immobilized to allow the antibody, immunoglobulin G or Fc region-containing protein having a non-native conformation to bind to the polypeptide, protein, transformant, recombinant phage or recombinant virus, or the polypeptide immobilized or the protein immobilized, and
(44) (2) removing the antibody, immunoglobulin G or Fc region-containing protein having a non-native conformation bound to the polypeptide, protein, transformant, recombinant phage or recombinant virus, or the polypeptide immobilized or the protein immobilized from the sample.
(45) Examples of the method for use in the removal step from the sample may include affinity chromatography, an affinity beads method, an affinity filter method and an immunoprecipitation method. In Examples described later, an affinity chromatography is used as an example; however, other technically applicable methods including the above techniques are not excluded.
(46) The present invention will be more specifically described by way of Examples; however, the present invention is not limited by these Examples.
Example 1
(47) In this Example, first, how to specify amino acid sequences of many polypeptides exhibiting antibody binding activity will be described and then examples of measuring binding activity of the following substances will be described:
(48) a synthetic polypeptide consisting of
(49) amino acid sequences of SEQ ID NOs: 2 to 6 containing an amino acid sequence of SEQ ID NO: 1 as a common sequence; amino acid sequences of SEQ ID NOs: 11 to 14 containing an amino acid sequence of SEQ ID NO: 10 as a common sequence;
(50) amino acid sequences of SEQ ID NOs: 7 to 9 and 15 to 21, which are obtained by addition, deletion, substitution or insertion of several amino acids to these amino acid sequences so as not to lose the binding activity to an Fc region of immunoglobulin G (IgG);
(51) an amino acid sequence of SEQ ID NO: 22, which is a partial sequence of them,
(52) fusion proteins containing these amino acid sequences, or
(53) recombinant phages transformed by nucleic acids encoding these amino acid sequences.
(54) 1) Construction of Polypeptide Library and Selection of Fc Region of Human IgG
(55) The amino acid sequence of a polypeptide exhibiting antibody binding activity was specified by a phage display method using T7 phage.
(56) First, a phage library, which displays a polypeptide consisting of an amino acid sequence:
(57) TABLE-US-00020 (SEQ ID NO: 168) Tyr-Asp-Pro-Xaa-Thr-Gly-Thr-Trp-(Xaa).sub.8-Gly
where Xaa represents any amino acid residue,
via a linker consisting of the amino acid sequence:
(58) TABLE-US-00021 (SEQ ID NO: 169) Gly-Gly-Gly-Gly-Ser
on the C terminal of coat protein g10 of T7 phage, was constructed by use of T7Select10-3 Cloning Kit (Novagen). Construction was performed completely in accordance with the procedure instructed by the accompanying T7Select (registered trade mark) System Manual (Novagen).
(59) Subsequently, using the T7 phage display library constructed, a phage bound to a target, i.e., an Fc region of human IgG was selected. First, with Streptavidin MagneSphere (registered trade mark) Paramagnetic Particles (Promega Corporation) (0.65 mL), which are avidin-immobilized magnetic beads, 20 g of an Fc region of human IgG (Jackson ImmunoResearch Laboratories, Inc.) labeled with biotin was mixed and immobilized to the magnetic beads via an avidin-biotin bond. To this, a blocking agent, SuperBlock (registered trade mark) T20 (TBS) Blocking Buffer (Thermo SCIENTIFIC) was added and allowed to stand still for one hour to block magnetic beads having the Fc region immobilized thereto. With this Fc region-immobilized magnetic beads, 1 mL of a solution of the T7 phage display library (510.sup.12 plaque forming units) was allowed to be in contact for one hour to bind the phage displaying a polypeptide exhibiting binding activity to the Fc region to the Fc region-immobilized magnetic beads. Subsequently, a complex of the phage displaying a polypeptide and the Fc region-immobilized magnetic beads was recovered by magnetic separation using MagneSphere (registered trade mark) Technology Magnetic Separation Stand (Promega Corporation). To the complex thus recovered, 1 mL of SuperBlock (registered trade mark) T20 (TBS) Blocking Buffer (Thermo SCIENTIFIC) was added. The mixture was mixed for 10 minutes and again subjected to magnetic separation. The supernatant was removed to recover the complex. This washing operation was performed 10 times. After washing, to the complex recovered by magnetic separation, TBS-T buffer (1 mL) containing 1% (w/v) sodium dodecyl sulfate (SDS) was added. The resultant solution was mixed for 10 minutes to allow the phage displaying a polypeptide having binding activity to elute from the Fc region-immobilized magnetic beads. Escherichia coli BLT5403 strain (Novagen), which was previously cultured in a 200 mL LB medium until O.D.600 reached 1.0, was infected with the phage eluted and cultured while shaking for 4 hours. The culture solution was centrifuged at 5000g for 20 minutes to recover the supernatant (of the medium) containing proliferated phages. To the supernatant, 20 mL of 5 M NaCl (Wako Pure Chemical Industries, Ltd.) and 35 mL of 50% polyethylene glycol (PEG) 8000 (Sigma-Aldrich Corporation) were added. The mixture was stirred at 4 C. for 12 hours and centrifuged at 14000g for 20 minutes. The precipitate was suspended in 2 mL of TBS-T buffer (50 mM Tris-HCl, 150 mM NaCl, 0.01% (w/v) Tween 20 (registered trade mark) pH 7.4) and filtered by a 0.22 m-diameter filter to remove aggregates. In this manner, a T7 phage solution was obtained. The aforementioned step of bringing the library into contact with a target, i.e., an Fc region of human IgG, and a step of selecting a phage bound to the Fc region of human IgG and recovering the phage were repeated five times to concentrate the phage displaying a polypeptide exhibiting binding activity.
(60) 2) Specification of Polypeptide Having Binding Activity by Binding Activity Test Based on ELISA and Sequence Analysis
(61) Next, we will describe an example where a molecule having binding activity was specified by ELISA and DNA analysis from phages concentrated.
(62) The phages displaying a polypeptide exhibiting binding activity and concentrated in Example 1, 1) were allowed to form plaques in accordance with T7Select (registered trade mark) System Manual (Novagen). From each plaque, phages displaying a single polypeptide were isolated. To MICROTEST (registered trade mark) 96 (BECTON, DICKINSON AND COMPANY) serving as a 96-well plate, a culture solution (0.2 mL) of Escherichia coli BL5403 strain, which was previously cultured in LB medium until O.D.600 reached 1.0, was poured to infect with the Escherichia coli cells 96 types of phages isolated from the plaques and allowed to stand still at 37 C. for 12 hours to proliferate phages. The culture solution (10 L) containing these phages was diluted in 90 L of TBS buffer (50 mM Tris-HCl, 150 mM NaCl, pH 7.4). The dilution solution was poured to a MEDISORP 96 well microplate (Nunc) and allowed to stand still for one hour to allow the phages to physically adsorb to the plate. After the supernatant was removed, SuperBlock (registered trade mark) T20 (TBS) Blocking Buffer (Thermo SCIENTIFIC) (150 L) was poured to the plate and allowed to stand still for one hour to block the surface of the plate. The plate was washed three times with TBS-T buffer. To the plate, TBS-T buffer (100 L) containing an Fc region (Jackson ImmunoResearch Laboratories, Inc.) (0.2 g/mL) labeled with horseradish peroxidase (HRP) was added and allowed to stand still for one hour. After the plate was washed three times with TBS-T buffer, ABTS One Component HRP Microwell Substrate (BioFX) (100 L) was poured to the plate. Presence of binding property was detected through a light-emitting reaction. The absorbance at 415 nm was measured by a microplate absorbance reader Sunrise R (TECAN GROUP LTD.). With respect to top 16 types of phages having a high binding activity, the DNA sequence of the region encoding the polypeptide was analyzed by the dideoxy method using ABI PRISM (registered trade mark) 3100 (Applied BioSystems). As a result of the analysis, amino acid sequences represented by SEQ ID NOs: 2 to 9 were specified as the polypeptides having binding activity.
(63) 3) Construction of Polypeptide Extension Library and Selection of Fc Region of Human IgG
(64) For enhancing the function of the (polypeptide) molecule specified in Example 1, 2), an 8 residue long random sequence (Xaa).sub.8 was extended from the N terminal of the amino acid sequence (SEQ ID NO: 2). A library of the extended polypeptides was constructed and selection was made.
(65) First, a library of phage, which displays a polypeptide consisting of an amino acid sequence:
(66) TABLE-US-00022 (SEQ ID NO: 170) (Xaa).sub.8-Tyr-Asp-Pro-Arg-Thr-Gly-Thr-Trp-Arg-Ser- Ser-Ile-Ala-Tyr-Gly-Gly-Gly
where Xaa represents any amino acid residue on the C terminal of coat protein g10 of T7 phage, via a linker consisting of an amino acid sequence:
(67) TABLE-US-00023 (SEQ ID NO: 169) Gly-Gly-Gly-Gly-Ser,
was constructed by T7Select10-3 Cloning Kit (Novagen). Construction was performed completely in accordance with the procedure instructed by the accompanying T7Select (registered trade mark) System Manual (Novagen).
(68) Using the phage library, the step of bringing phages into contact with an Fc region and selecting phages bound to the region to recover the phages was repeated six times in accordance with the procedure described in Example 1, 1) to concentrate phages displaying a polypeptide exhibiting binding activity to an Fc region. Subsequently, a molecule having binding activity was identified by ELISA from the concentrated phages in the same procedure as in Example 1, 2) and the DNA sequence was analyzed by the dideoxy method. As a result of the DNA sequence analysis, it was confirmed that amino acid sequences were converged on those represented by SEQ ID NOs: 11 to 19. Then, polypeptides containing the amino acid sequences of SEQ ID NOs: 11 to 19 were specified as the polypeptides having binding activity.
(69) 4) In this section, it will be stated as an example that the binding activity of polypeptides consisting of amino acid sequences represented by SEQ ID NOs: 2, 11, 21 and 22 (referred to as H6, 2A1, 2A1Gly and RSS, respectively) was measured by a surface plasmon resonance method.
(70) The polypeptides previously synthesized in an organic chemical manner were purchased from bioSYNTHESIS. Biacore T100 (GE Healthcare) was used as a surface plasmon resonance measurement apparatus. The human Fc region manufactured by Jackson ImmunoResearch Laboratories, Inc. was immobilized to Sensor Chip CM5 (GE Healthcare) in accordance with an amine coupling method using an Amine Coupling Kit (GE Healthcare). Subsequently, polypeptide (H6) was diluted with HBS-T buffer (10 mM HEPES, 150 mM NaCl, 0.05% Tween 20 (registered trade mark), pH 7.4) to have a concentration of 50, 25 or 12.5 M, polypeptide (2A1) to a concentration of 100, 80, 60, 40 or 20 nM, polypeptide (2A1Gly) to a concentration of 40, 30, 20, 10 or 5 M, and polypeptide (RSS) to a concentration of 200, 100, 50, 25 or 12.5 M. The binding activity of these polypeptides was measured at a reaction temperature of 25 C. The measurement data were processed by Biacore TOO Evaluation Software (GE Healthcare). As a result of calculation, H6, 2A1, 2A1Gly and RSS had binding activity values of 7.910.sup.5 (M), 2.210.sup.8 (M), 2.310.sup.5 (M) and 1.110.sup.4 (M), respectively in terms of equilibrium dissociation constant K.sub.D (Table 1A).
(71) TABLE-US-00024 TABLE 1A Poly- SEQ ID peptide Sequence K.sub.D (nM) NO: H6 YDPRTGTWRSSIAYGGG 79000 2 2A1 GVVRGWSGYDPRTGTWRSSIAYGGG 22 11 2A1Gly GVVRGWSGGGGSGGGGRSSIAYGGG 23000 21 RSS RSSIAYGGG 110000 22
(72) 5) In this section, it is stated as an example that thioredoxin fusion proteins containing amino acid sequences represented by SEQ ID NOs: 2 and 11 to 13 were prepared and the binding activity of the proteins was measured by a surface plasmon resonance method.
(73) DNA molecules encoding the polypeptides of amino acid sequences 2 and 11 to 13 were amplified by a polymerase chain reaction (PCR). PCR was carried out using KOD DNA polymerase (TOYOBO) under reaction conditions according to the accompanying manual. The amplified DNA molecules were each digested with EcoRI and HindIII and introduced to a site of pET-48b (Invitrogen) digested with EcoRI/HindIII. In this way, expression vectors containing DNA molecules (SEQ ID NOs: 120 to 123), which encode fusion proteins obtained by ligating the corresponding polypeptides to the C terminal of thioredoxin (hereinafter, these fusion proteins of the polypeptides identified above and thioredoxin will be referred to as H6_trx, 2A1_trx, 2A4_trx and 2F12_trx (SEQ ID NOs: 82 to 85)) were constructed. The expression vectors thus constructed were used to transform Escherichia coli BL21 (DE3) strain (Novagen). Escherichia coli BL21 (DE3) strain was sub-cultured in 200 mL of 2YT medium and cultured while shaking until O.D..sub.600 reached about 0.8. Expression was induced by isopropyl -D-1-thiogalactopyranoside (IPTG) of a final concentration of 1 mM and the Escherichia coli cells were cultured at 37 C. for 12 hours. Bacterial cells were collected by centrifugation at 5000g for 20 minutes and suspended in buffer of 20 mM Tris-HCl 500 mM NaCl pH 7.4. The bacterial cells were ultrasonically ground by Astrason Model 53000 (Wakenyaku Co., Ltd.) and an intracellular soluble fraction was centrifugally collected at 14000g for 20 minutes. The soluble fraction was purified by metal chelate affinity chromatography using Ni Sepharose (registered trade mark) 6 Fast Flow (GE Healthcare) to prepare a desired thioredoxin fusion protein.
(74) Subsequently, the binding activity of the thioredoxin fusion protein prepared was measured by a surface plasmon resonance method. As a measurement apparatus, Biacore T100 (GE Healthcare) was used. The Fc region manufactured by Jackson ImmunoResearch Laboratories, Inc. was immobilized to Sensor Chip CM5 (GE Healthcare) by the amine coupling method in the same procedure as in Example 1, 4). Subsequently, the thioredoxin fusion proteins (H6_trx, 2A1_trx, 2A4_trx and 2F12_trx) prepared were each diluted with a HBS-T buffer to have a concentration of 600, 500, 400, 300, 200 or 100 nM and binding activity was measured at 25 C. Data were processed by Biacore TOO Evaluation Software (GE Healthcare). The equilibrium dissociation constants K.sub.D of H6_trx, 2A1_trx, 2A4_trx and 2F12_trx calculated were 1.810.sup.7 (M), 4.210.sup.8 (M), 2.010.sup.7 (M) and 6.810.sup.8 (M), respectively (Table 1 B).
(75) TABLE-US-00025 TABLE 1B Fusion protein K.sub.D (nM) SEQ ID NO: H6_trx 180 82 2A1_trx 42 83 2A4_trx 200 84 2F12_trx 68 85
(76) 6) In this section, it will be stated as an example that the binding activity of recombinant phages transformed by nucleic acids encoding the amino acid sequences represented by SEQ ID NOs: 2 to 9 and 11 to 19 was measured by Enzyme Linked Immuno-Sorbent Assay (ELISA).
(77) DNA molecules encoding the amino acid sequences of SEQ ID NOs: 2 to 9 and 11 to 19 were amplified by a polymerase chain reaction (PCR). PCR was carried out using KOD DNA polymerase (TOYOBO) under reaction conditions according to the accompanying manual. The amplified DNA molecules were each digested with restriction enzymes EcoRI and HindIII and ligated to 3 terminal of g10 gene on T7 phage genomic DNA. Ligation to T7 phage genomic DNA was performed by use of a sample attached to T7Select10-3 Cloning Kit (Novagen) under the reaction conditions and in accordance with the procedure described in the accompanying T7Select (registered trade mark) System Manual. Using T7 phage genomic DNA ligated, T7 phage was packaged in a test tube by T7Select Packaging Kit (Novagen) under the reaction conditions in accordance with T7Select (registered trade mark) System Manual (Novagen). Subsequently, phage plaques were formed in accordance with T7Select (registered trade mark) System Manual (Novagen). From each of the plaques, a recombinant phage displaying the polypeptide was isolated. To MICROTEST (registered trade mark) 96 (BECTON, DICKINSON AND COMPANY), a culture solution (0.2 mL) of Escherichia coli BL5403 strain cultured in LB medium until O.D..sub.600 reached 1.0 was poured to infect with the Escherichia coli cells each of the recombinant phages isolated from plaques and allowed to stand still at 37 C. for 12 hours to proliferate phages. The culture solution (10 L) containing these phages was diluted in 90 L of TBS buffer (50 mM Tris-HCl, 150 mM NaCl, pH 7.4) to prepare measurement samples.
(78) The measurement samples were poured to MEDISORP 96 well microplate (Nunc) and allowed to stand still for one hour to allow the phage to physically adsorb to the plate. After the supernatant was removed, SuperBlock (registered trade mark) T20 (TBS) Blocking Buffer (Thermo SCIENTIFIC) (150 L) was poured to the plate and allowed to stand still for one hour to block the surface of the plate. The plate was washed three times with TBS-T buffer (50 mM Tris-HCl, 150 mM NaCl, 0.1% Tween 20 (registered trade mark), pH 7.4). To the plate, TBS-T buffer (100 L) containing an Fc region (Jackson ImmunoResearch Laboratories, Inc.) (0.2 g/mL) labeled with horseradish peroxidase (HRP) was added and allowed to stand still for one hour. After the plate was washed three times with TBS-T buffer, ABTS One Component HRP Microwell Substrate (BioFX) (100 L) was poured to the plate. Binding activity was detected through a color reaction. The absorbance at 415 nm (O.D..sub.415) was measured by a microplate absorbance reader Sunrise R (TECAN GROUP LTD.). TBS-T buffer containing no phages was used as a negative control in a control experiment.
(79) ELISA results of the recombinant phages displaying polypeptides containing amino acid sequences represented by SEQ ID NOs: 2 to 9 and the recombinant phages displaying polypeptides containing amino acid sequences represented by SEQ ID NOs: 11 to 19 are shown in Table 2A and Table 2B, respectively. Any one of the recombinant phages exhibited significant binding activity compared to the control.
(80) TABLE-US-00026 TABLE 2A Polypeptide sequence O.D. 415 SEQ ID NO: YDPRTGTWRSSIAYGGG 0.251 2 YDPGTGTWRSYLRFGGG 0.278 3 YDPYTGTWRSSIWVLSG 0.165 4 YDPGTGTWRSWLSFNVG 0.155 5 YDPWTGTWRSFIWGGGG 0.149 6 YDPRTGTWLLYASRLLG 0.214 7 YDPVTGTWTSSIASWMG 0.223 8 YDPRTGTWRRSSLSYSG 0.193 9 Control 0.08
(81) TABLE-US-00027 TABLE 2B Polypeptide sequence O.D. 415 SEQ ID NO: GVVRQWSGYDPRTGTWRSSIAYGGG 0.282 11 AGSRRAHGYDPRTGTWRSSIAYGGG 0.267 12 ASVRSWSSYDPRTGTWRSSIAYGGG 0.54 13 SWRRRGSSYDPRTGTWRSSIAYGGG 0.282 14 TGRGRSARYDPRTGTWRSSIAYGGG 0.396 15 HWVNGRSGYDPRTGTWRSSIAYGGG 0.373 16 ERWITWSGYDPRTGTWRSSIAYGGG 0.368 17 GSVVRWRGYDPRIGTWRSSIAYGGG 0.36 18 GAVYRRSFYDPRTGTWRSSIAYRGG 0.353 19 Control 0.101
(82) 7) In this section, an example is described in which a polypeptide (referred to as 2A1) consisting of an amino acid sequence represented by SEQ ID NO: 11, which is one of examples of an amino acid sequence represented by SEQ ID NO: 10, was confirmed to exhibit a specific binding activity to immunoglobulin G and an Fc region having a non-native structure. In this section, as an example of the non-native structure, such as an alternatively folded state (AFS), obtained by an acid treatment, described in the above section Best Mode for Carrying Out the Invention, a non-native structure of immunoglobulin G or an Fc region obtained by an acid treatment or a treatment with a reducing agent was used. The binding activity to the non-native structure of immunoglobulin G or an Fc region was measured and compared to the binding activity to a natural structure.
(83) The binding activity to a non-native structure was evaluated by a surface plasmon resonance method. 2A1 was immobilized to Sensor Chip CM5 by the amine coupling method and the binding activity to human IgG molecules or Fc regions treated under the plurality of conditions described below was measured. The following measurement samples were used.
(84) (1) human Fc region manufactured by Jackson ImmunoResearch Laboratories, Inc.;
(85) (2) human monoclonal IgG having a natural structure (no denaturation treatment was made);
(86) (3) an Fc region prepared from the IgG of (2) (an Fc region was prepared by digesting IgG with papain in accordance with the instruction attached to Pierce (registered trade mark) Fab Preparation Kit (Thermo SCIENTIFIC), purified by affinity chromatography using MabSelect SuRe (GE Healthcare), HiTrap DEAE anion exchange chromatography (GE Healthcare) and gel filtration chromatography using Superdex 200 (GE Healthcare));
(87) (4) acid-denatured IgG prepared by treating IgG of (2) with an acidic buffer (20 mM sodium acetate pH 4.5) at 50 C. for 10 days;
(88) (5) an Fc region obtained by subjecting the Fc region of (3) to a reduction treatment with 50 mM 2-mercaptoethylamine (Thermo Scientific Pierce) at 37 C. for 90 minutes, and maintained under reductive conditions in the presence of 10 mM ethylene diamine tetraacetic acid; and
(89) (6) AFS IgG prepared by treating IgG of (2) under the conditions (10 mM Gly-HCl, 150 mM NaCl, pH 2.0) under which IgG is known to take AFS.
(90) As a result of the surface plasmon resonance test, 2A1 binds to (1) human Fc region (
(91) 8) In this section, it will be stated as an example that heat inactivation resistance of a polypeptide 2A1 represented by SEQ ID NO: 11 was evaluated. Polypeptide 2A1 was synthesized in an organic chemical manner was diluted with HBS-T buffer (10 mM HEPES, 150 mM NaCl, 0.05% Tween 20 (registered trade mark), pH 7.4) so as to have a concentration of 27 M. The diluted solution was heated at 98 C. for 15 minutes. Samples treated with heat and not treated with heat were separately diluted with HBS-T buffer so as to obtain a concentration of 100, 50, 25 or 12.5 nM and evaluated for binding activity by surface plasmon resonance.
(92) As the surface plasmon resonance measurement apparatus, Biacore T100 (GE Healthcare) was used. The human Fc region having a non-native structure used herein was prepared by dialyzing a natural human Fc region against an acid buffer (10 mM Gly-HCl, 150 mM NaCl, pH 2.0). The non-native human Fc region was immobilized to Sensor Chip CM5 (GE Healthcare) by the amine coupling method using Amine Coupling Kit (GE Healthcare) and subjected to binding-activity measurement performed at a reaction temperature of 25 C. The measurement data were processed by Biacore TOO Evaluation Software (GE Healthcare). As a result of calculation, the samples treated with heat and not treated with heat had binding activity values of 2.0108 (M) and 2.2108 (M), respectively in terms of equilibrium dissociation constant KD. The total amounts of binding response of them were the same. The above results demonstrate that the binding activity of polypeptide 2A1 is not irreversibly damaged by heat treatment and suggest that polypeptide 2A1 has high resistance against heat inactivation.
Example 2
(93) In this Example, how to specify amino acid sequences of many polypeptides exhibiting binding activity to an antibody will be first described and then examples of measuring binding activity of the following samples will be described:
(94) polypeptides consisting of
(95) amino acid sequences of SEQ ID NOs: 24 to 54 containing the amino acid sequence of SEQ ID NO: 23 as a common sequence,
(96) amino acid sequences of SEQ ID NOs: 57 to 72 containing the amino acid sequence of SEQ ID NO: 56 as a common sequence, and
(97) amino acid sequences of SEQ ID NOs: 55 and 73 to 81 which may have addition, deletion, substitution or insertion of several amino acid residues in these amino acid sequences so as not to damage the binding activity to an Fc region of IgG; or
(98) fusion proteins containing these amino acid sequences; or
(99) recombinant phages transformed with nucleic acids encoding these amino acid sequences.
(100) 1) Construction of Polypeptide Library and Selection of Fc Region of Human IgG
(101) The amino acid sequence of a polypeptide exhibiting antibody binding activity was specified by a phage display method using T7 phage.
(102) First, a phage library, which displays a polypeptide consisting of an amino acid sequence:
(103) TABLE-US-00028 (SEQIDNO:171) Asp-Ala-Ala-Trp-His-Leu-Gly-Glu-Leu-Val- Trp-Ala-Thr-Tyr-Tyr-Asp-Pro-Glu-Thr- Gly-Thr-Trp-(Xaa).sub.10
where Xaa represents any amino acid residue,
via a linker consisting of the amino acid sequence:
(104) TABLE-US-00029 (SEQ ID NO: 169) Gly-Gly-Gly-Gly-Ser
on the C terminal of coat protein g10 of T7 phage, was constructed by use of T7Select10-3 Cloning Kit (Novagen). Construction was performed completely in accordance with the procedure instructed by the accompanying T7Select (registered trade mark) System Manual (Novagen).
(105) Next, a step of bringing the T7 phage display library constructed into contact with a target, i.e., an Fc region of human IgG, and a step of selecting a phage bound to the Fc region of human IgG and recovering the phage. The Fc region was prepared, in accordance with the instruction attached to Pierce (registered trade mark) Fab Preparation Kit (Thermo SCIENTIFIC Pierce), by digesting human monoclonal antibody IgG with papain, followed by purifying by affinity chromatography using MabSelect SuRe (GE Healthcare), HiTrap DEAE anion exchange chromatography (GE Healthcare) and gel filtration chromatography using Superdex 200 (GE Healthcare). To the Fc region thus prepared, biotin was chemically bound via an amino group by use of D-Biotinoyl--Amino Caproic Acid N-Hydroxysuccinimide Ester (F. Hoffmann-La Roche Ltd.) in accordance with the accompanying instruction. Subsequently, in accordance with the same procedures as in Example 1, 1) and 2), a step of bringing the library into contact with the Fc region and selecting and recovering a phage bound to the library, a step of checking a phage displaying a polypeptide having binding activity by ELISA and DNA sequence analysis by the dideoxy method were performed. As a result, the amino acid sequences represented by SEQ ID NOs: 24 to 55 were specified as a polypeptide exhibiting binding activity.
(106) 2) Construction of Polypeptide Extension Library and Selection of Fc Region of Human IgG
(107) For enhancing the function of the polypeptide having binding activity specified in Example 2, 1), the N terminal of the polypeptide having each of two types of amino acid sequences (SEQ ID NO: 26 or 27) was extended and a phage library displaying the polypeptide was constructed. Selection was made by using the library. First, a phage library displaying a polypeptide consisting of the amino acid sequence:
(108) TABLE-US-00030 (SEQIDNO:172) (Xaa).sub.10-Tyr-Asp-Pro-Glu-Thr-Gly-Thr-Trp- Tyr-Asp-Ala-Ala-Trp-His-Leu-Gly-Glu-Leu- Val-Trp-Ala-Thr-Tyr-Tyr-Asp-Pro-Glu- Thr-Gly-Thr-Trp-Leu-Pro-Asp-Trp-Gln-Thr- Met-Ala-Gln-Lys,or, (SEQIDNO:173) (Xaa).sub.10-Tyr-Asp-Pro-Glu-Thr-Gly-Thr-Trp- Tyr-Asp-Ala-Ala-Trp-His-Leu-Gly-Glu-Leu-Val- Trp-Ala-Thr-Tyr-Tyr-Asp-Pro-Glu-Thr-Gly- Thr-Trp-Glu-Pro-Asp-Trp-Gln-Arg-Met- Leu-Gly-Gln
where Xaa represents any amino acid residue,
on the C terminal of the coat protein g10 of T7 phage via a linker consisting of the amino acid sequence:
(109) TABLE-US-00031 (SEQIDNO:169) Gly-Gly-Gly-Gly-Ser
was constructed by use of T7Select1-1 Cloning Kit (Novagen). Construction was performed completely in accordance with the procedure instructed by the accompanying T7Select (registered trade mark) System Manual (Novagen).
(110) The step of bringing a library into contact with an Fc region and selecting and recovering a phage bound to the Fc region was carried out by using the phage library constructed in the same manner as in Example 2, 1) and repeated 10 times. The binding activity test by ELISA and DNA sequence analysis were performed in the same manner as in Example 1, 2). As a result, the amino acid sequences represented by SEQ ID NOs: 57 to 81 were specified as a polypeptide having binding activity.
(111) 3) In this section, it will be stated as an example that the binding activity of polypeptides consisting of amino acid sequences of SEQ ID NOs: 24 to 27 (referred to as pep14, pep11, pep21 and pep24, respectively) was measured by surface plasmon resonance. The polypeptides, which were previously synthesized in an organic chemical manner were purchased from bioSYNTHESIS, were diluted with HBS-T buffer and controlled so as to have a concentration of 500, 400, 300, 200 or 100 nM. The surface plasmon resonance test was performed by using Biacore T100 (GE Healthcare). The Fc region to be immobilized to a sensor chip was prepared, by digesting human monoclonal antibody IgG with papain, in accordance with the instruction attached to Pierce (registered trade mark) Fab Preparation Kit (Thermo SCIENTIFIC), followed by purifying by affinity chromatography using MabSelect SuRe (GE Healthcare), HiTrap DEAE anion exchange chromatography (GE Healthcare) and gel filtration chromatography using Superdex 200 (GE Healthcare). The Fc region prepared was immobilized to Sensor Chip CM5 (GE Healthcare) by the amine coupling method. The binding activity of the synthesized peptides prepared was measured and equilibrium dissociation constants were determined. Data were processed by use of Biacore TOO Evaluation Software (GE Healthcare). The equilibrium dissociation constants K.sub.D of pep14, pep11, pep21 and pep24 calculated were 1.210.sup.7 (M), 5.110.sup.7 (M), 1.010.sup.7 (M) and 2.210.sup.7 (M), respectively (Table 3A).
(112) TABLE-US-00032 TABLE3A SEQ KD ID Polypeptide Sequence (nM) NO: pep14, DAAWHLGELVWATYYDPETGTWQPDWLYMT 120 24 TR pep11 DAAWHLGELVWATYYDPETGTWAPDWRLMQ 510 25 GQ pop21 DAWHLGELVWATYYDPETGTWLPDWQTMAQK 100 26 pep24 DAAWHLGELVWATYYDPETGTWEPDWQRML 220 27 GQ
(113) 4) In this section, it will be stated as an example that the binding activity of a polypeptide consisting of an amino acid sequence (referred to as p17) of SEQ ID NO: 57 was measured by surface plasmon resonance. The polypeptide was prepared by cleaving thioredoxin fusion protein p17_trx consisting of the amino acid sequence of SEQ ID NO: 86 with a protease and removing a thioredoxin portion. Since the thioredoxin fusion protein, which is produced by expression vector pET-48b (Novagen), has an HRV 3C protease cleavage site in the amino acid sequence, the desired polypeptide ligated to the C terminal can be obtained by use of protease.
(114) DNA (SEQ ID NO: 124) encoding the thioredoxin fusion protein (SEQ ID NO: 86) containing p17 was synthesized by PCR and introduced to an expression vector, pET-48b (Novagen). Using the expression vector and in accordance with the same procedure as in Example, 1, 5), the thioredoxin fusion protein was prepared. The thioredoxin fusion protein (40 mg) was digested with 100 units of HRV 3C Protease (Novagen) at 4 C. under the reaction conditions according to the accompanying manual. The digested product was diluted in a 6 M guanidine hydrochloride solution and purified by gel filtration chromatography using Superdex Peptide 10/300 GL (GE Healthcare). Subsequently reverse phase chromatography using RPC C2/C18 ST 4.6/100 (GE Healthcare) was performed to prepare a polypeptide p17 consisting of an amino acid sequence of SEQ ID NO: 57.
(115) Subsequently, the binding activity of p17 prepared was measured by surface plasmon resonance by use of Biacore T100 (GE Healthcare). Polypeptide p17 was diluted in HBS-T and controlled to have a concentration of 25, 12.5, 6.25 or 3.13 nM. The Fc region was immobilized to Sensor Chip CM5 and measurement of binding activity was performed in the same procedure as in Examples 2, 3). As a result of analysis, p17 bound to the Fc region with an equilibrium dissociation constant K.sub.D of 1.610.sup.9 (M) (Table 3B).
(116) TABLE-US-00033 TABLE3B KD SEQID Polypeptide Sequence (nM) NO: p17 GPGISAFSPGRGVYDPETGTWYDAAWH 1.6 57 LGELVWATYYDPETGTWEPDWQRMLGQ
(117) This value exhibits extremely high binding activity as the binding activity of a linear polypeptide. The binding activity values of IgG-binding proteins, protein A and protein G, conventionally used, more specifically, the binding activity value of their domains by themselves, in terms of K.sub.D are at most about 1.010.sup.8 (M) (Non Patent Literature 28) and 4.910.sup.7 (M) (Non Patent Literature 29), respectively. Even compared to that of a cyclic polypeptide whose binding activity is generally higher than that of linear polypeptide, the polypeptide p17 of the present invention has a high binding activity of the highest rank beyond the value of cyclic peptide FcBP-2 (K.sub.D=2.2 nM) (Non Patent Literature 4) reported to have a high binding activity.
(118) 5) In this section, it will be stated as an example that thioredoxin fusion proteins containing amino acid sequences represented by SEQ ID NOs: 24, 26 to 33 and 57 to 81 were prepared and the binding activity of them was measured by a surface plasmon resonance method.
(119) DNA molecules encoding polypeptides of SEQ ID NOs: 24, 26 to 33 and 57 to 81 were amplified by PCR, digested with EcoRI and HindIII and each introduced to a site of pET-48b (Invitrogen) digested with EcoRI/HindIII to construct expression vectors containing DNA (SEQ ID NOs: 125 to 133, 124, 136, 137, 139, 140, 144 to 151, 154 to 156, 134, 135, 138, 141 to 143, 152, 153 and 157) encoding fusion proteins (SEQ ID NOs: 87 to 95, 86, 98, 99, 101, 102, 106 to 113, 116 to 118, 96, 97, 100, 103 to 105, 114, 115 and 119) obtained by ligating a polypeptide to the C terminal of thioredoxin. Using the expression vectors, thioredoxin fusion proteins were prepared in the same manner as in Example 1, 5).
(120) Subsequently, the binding activity of the prepared thioredoxin fusion proteins was measured by a surface plasmon resonance method. As the measurement apparatus, Biacore T100 (GE Healthcare) was used. An Fc region was immobilized to Sensor Chip CM5 (GE Healthcare) by the amine coupling method in the same manner as in Example 2, 3). Subsequently, the prepared thioredoxin fusion proteins each were diluted with HBS-T buffer and controlled so as to have a concentration of 600, 500, 400, 300, 200 or 100 nM. The binding activity was measured at 25 C. Data were processed by Biacore TOO Evaluation Software (GE Healthcare). The values K.sub.D calculated are shown in Table 4.
(121) TABLE-US-00034 TABLE4A Sequenceofpolypeptidefused SEQIDNO: SEQIDNO: withthioredoxin K.sub.D(nM) (polypeptide) (fusionprotein) DAAWHLGELVWATYYDPETGTWQPDWLYMTTR 720 24 87 DAAWHLGELVWATYYDPETGTWLPDWQTMAQK 26 26 88 DAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 120 27 89 DAAWHLGELVWATYYDPETGTWQPDWRAMSGR 200 28 90 DAAWHLGELVWATYYDPETGTWRPDWKWMSTH 850 29 91 DAAWHLGELVWATYYDPETGTWEPDWKLMQRP 640 30 92 DAAWHLGELVWATYYDPETGTWQPDWDIMAGH 130 31 93 DAAWHLGELVWATYYDPETGTWLPDWDVMVRQ 63 32 94 DAAWHLGELVWATYYDPETGTWVPDWERMEQH 3270 33 95 GPGISAFSPGRGVYDPETGTWYDAAWHLGELVWATYYDPETG 7.8 57 86 TWEPDWQRMLGQ VISLGSDRGVYDPETGTWYDAAWHLGELVWATYYDPETGTWE 32 58 98 PDWQRMLGQ IMSVDGSSARYDPETGTWYDAAWHLGELVWATYYDPETGTWE 34 59 99 PDWQRMLGQ VDLRAHGGAVYDPETGTWYDAAWHLGELVWATYYDPETGTWE 50 60 101 PDWQRMLGQ WSRFSSRSVAYDPETGTWYDAAWHLGELVWATYYDPETGTWE 39 61 102 PDWQRMLGQ GNPSDSASAWYDPETGTWYDAAWHLGELVWATYYDPETGTWE 26 62 106 PDWQRMLGQ SNFVRSPSAWYDPETGTWYDAAWHLGELVWATYYDPETGTWE 24 63 107 PDWQRMLGQ IPYGFPGRGEYDPETGTWYDAAWHLGELVWATYYDPETGTWE 14 64 108 PDWQRMLGQ
(122) TABLE-US-00035 TABLE4B Sequenceofpolypeptidefused SEQIDNO: SEQIDNO: withthioredoxin K.sub.D(nM) (polypeptide) (fusionprotein) GPYNIPDSAVYDPETGTWYDAAWHLGELVWATYYDPETGTWE 14 65 109 PDWQRMLGQ WPLNAPSSAFYDPETGTWYDAAWHLGELVWATYYDPETGTWE 25 66 110 PDWQRMLGQ VPPRFSSSAQYDPETGTWYDAAWHLGELVWATYYDPETGTWE 8.8 67 111 PDWQRMLGQ FLVGLHAGAVYDPETGTWYDAAWHLGELVWATYYDPETGTWE 32 68 112 PDWQRMLGQ VVRVDHSSAVYDPETGTWYDAAWHLGELVWATYYDPETGTWE 30 69 113 PDWQRMLGQ WMEFYPGRGVYDPETGTWYDAAWHLGELVWATYYDPETGTWE 11 70 116 PDWQRMLGQ DGVGPGSRGVYDPETGTWYDAAWHLGELVWATYYDPETGTWE 23 71 117 PDWQRMLGQ FVSSLPNSAMYDPETGTWYDAAWHLGELVWATYYDPETGTWE 17 72 118 PDWQRMLGQ GRAFSGSRRWYDPETGTWYDAAWHLGELVWATYYDPETGTWA 39 73 96 PDWRLMQGQ VMATEVVRGVYDPETGTWYDATWHLGELVWATYYDPETGTWE 110 74 97 PDWQRMLGQ MMVRPPRLGVYDPEPGTWYDATWHLGELVWATYYDPETGTWE 85 75 100 PDWQRMLGQ ERHLVSDYLHYDPETGTWYDAAWHLGELVWATYYDPETGTWE 27 76 103 PDWQRMLGQ FSDLDSFGVSYDPETGTWYDAAWHLGELVWATYYDPETGTWE 240 77 104 PDWQRMLGQ LEDNKLKHASYDPETGTWYDAAWHLGELVWATYYDPETGTWE 44 78 105 PDWQRMLGQ GSCKFSSSCHYDPETGTWYDAAWHLGELVWATYYDPETGTWE 35 79 114 PDWQRMLGQ LIPPGGISPWYDPETGTWYDAAWHLGELVWATYYDPETGTWE 38 80 115 PDWQRMLGQ LNDFLTPTAWYDPETGTWYDAAWHLGELVWATYYDPETGTWL 14 81 119 PDWQTMAQK
(123) 6) In this section, it will be stated as an example that the binding activity of recombinant phages transformed by nucleic acids encoding amino acid sequences represented by SEQ ID NOs: 26, 27, 30 to 55, 57, 63 to 72 and 79 to 81 was measured by Enzyme Linked Immuno-Sorbent Assay (ELISA).
(124) DNA molecules encoding amino acid sequences of SEQ ID NOs: 26, 27, 30 to 55, 57, 63 to 72 and 79 to 81 were amplified by a polymerase chain reaction (PCR) using KOD DNA polymerase (TOYOBO) under the reaction conditions according to the accompanying manual. Each of the amplified DNA was digested with restriction enzymes EcoRI and HindIII, and ligated to the 3 terminal of g10 gene on T7 phage genomic DNA. Ligation to T7 phage genomic DNA was performed by use of a sample attached to T7Select10-3 Cloning Kit (Novagen) under the reaction conditions and in accordance with the procedure described in T7Select (registered trade mark) System Manual. Using T7 phage genomic DNA ligated, T7 phage was packaged in a test tube by T7Select Packaging Kit (Novagen) under the reaction conditions in accordance with T7Select (registered trade mark) System Manual (Novagen). Subsequently, phage plaque was formed in accordance with T7Select (registered trade mark) System Manual (Novagen). From each of the plaques, a recombinant phage displaying the polypeptide was isolated. To MICROTEST (registered trade mark) 96 (BECTON, DICKINSON AND COMPANY), a culture solution (0.2 mL) of Escherichia coli BL5403 strain cultured in LB medium until O.D..sub.600 reached 1.0 was poured to infect with the Escherichia coli cells each of the recombinant phages isolated from plaques and allowed to stand still 37 C. for 12 hours to proliferate phages. The culture solution (10 L) containing these phages was diluted in 90 L of TBS buffer (50 mM Tris-HCl, 150 mM NaCl, pH 7.4) to prepare measurement samples.
(125) The measurement samples were poured to MEDISORP 96 well microplate (Nunc) and allowed to stand still for one hour to allow the phage to physically adsorb to the plate. The supernatant was removed and SuperBlock (registered trade mark) T20 (TBS) Blocking Buffer (Thermo SCIENTIFIC) (150 L) was poured to the plate and allowed to stand still for one hour to block the surface of the plate. The plate was washed three times with TBS-T buffer (50 mM Tris-HCl, 150 mM NaCl, 0.1% Tween 20 (registered trade mark), pH 7.4). To the plate, TBS-T buffer (100 L) containing an Fc region (Jackson ImmunoResearch Laboratories, Inc.) (0.2 g/mL) labeled with horseradish peroxidase (HRP) was added and allowed to stand still for one hour. After the plate was washed three times with TBS-T buffer, ABTS One Component HRP Microwell Substrate (BioFX) (100 L) was poured to the plate. The binding activity was detected through a light-emitting reaction. The absorbance at 415 nm (O.D..sub.415) was measured by a microplate absorbance reader Sunrise R (TECAN GROUP LTD.). TBS-T buffer containing no phages was used as a negative control in a control experiment.
(126) ELISA results of the recombinant phages displaying polypeptides containing amino acid sequences represented by SEQ ID NOs: 26, 27 and 30 to 55 and the recombinant phages displaying polypeptides containing amino acid sequences represented by SEQ ID NOs: 57, 63 to 72 and 79 to 81 are shown in Table 5A and Table 5B, respectively. Any one of recombinant phages exhibited significant binding activity compared to the control.
(127) TABLE-US-00036 TABLE5A Polypeptidesequence O.D.415 SEQIDNO: DAAWHLGELVWATYYDPETGTWLPDWQTMAQK 0.43 26 DAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.289 27 DAAWHLGELVWATYYDPETGTWEPDWKLMQRP 0.287 30 DAAWHLGELVWATYYDPETGTWQPDWDIMAGH 0.295 31 DAAWHLGELVWATYYDPETGTWLPDWDVMVRQ 0.352 32 DAAWHLGELVWATYYDPETGTWVPDWERMKQH 0.305 33 DAAWHLGELVWATYYDPETGTWEPDWSKMRPQ 0.281 34 DAAWHLGELVWATYYDPETGTWRPDWAVMATP 0.32 35 DAAWHLGELVWATYYDPETGTWKPDWRMMGVP 0.287 36 DAAWHLGELVWATYYDPETGTWLPDWDYMSSK 0.235 37 DAAWHLGELVWATYYDPETGTWMPDWDRMLRR 0.29 38 DAAWHLGELVWATYYDPETGTWTPDWNAMSQR 0.273 39 DAAWHLGELVWATYYDPETGTWQPDWKRMTSR 0.251 40 DAAWHLGELVWATYYDPETGTWQPDWGRMNSK 0.274 41 DAAWHLGELVWATYYDPETGTWAPDWNRMRDFNRSFREV 0.273 42 DAAWHLGELVWATYYDPETGTWVPDWDAMSSR 0.813 43 DAAWHLGELVWATYYDPETGTWIPDWTRMQTW 0.243 44 DAAWHLGELVWATYYDPETGTWKPDWQRMKLH 0.249 45 DAAWHLGELVWATYYDPETGTWLPDWSQMRPQ 0.243 46 DAAWHLGELVWATYYDPETGTWLPDWDTMTPR 0.255 47 DAAWHLGELVWATYYDPETGTWQPDWSVMKSL 0.373 48 DAAWHLGELVWATYYDPETGTWVPDWDTMHAAINRSFREV 0.346 49 DAAWHLGELVWATYYDPETGTWIPDWRAMSQF 0.244 50 DAAWHLGELVWATYYDPETGTWLPDWNLMGQH 0.265 51 DAAWHLGELVWATYYDPETGTWRPDWARMEPM 0.25 52 DAAWHLGELVWATYYDPETGTWKPDWQVMSPVSNRSFREV 0.279 53 DAAWHLGELVWATYYDPETGTWQPDWEIMRPF 0.258 54 EAWHLGELVWATYYDPETGTWRPDWSRMSGR 0.252 55 Control 0.11
(128) TABLE-US-00037 TABLE5B Polypeptidesequence O.D.415 SEQIDNO: GPGISAFSPGRGVYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.229 57 SNFVRSPSAWYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.272 63 IPYGFPGRGEYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.213 64 GPYNIPDSAVYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.291 65 WPLNAPSSAFYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.182 66 VPPRFSSSAQYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.25 67 FLVGLHAGAVYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.186 68 VVRVDHSSAVYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.201 69 WMEFYPGRGVYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.189 70 DGVGPGSRGVYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.219 71 FVSSLPNSAMYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.229 72 GSCKFSSSCHYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.329 79 LIPPGGISPWYDPETGTWYDAAWHLGELVWATYYDPETGTWEPDWQRMLGQ 0.215 80 LNDFLTPTAWYDPETGTWYDAAWHLGELVWATYYDPETGTWLPDWQTMACK 0.235 81 Control 0.098
Example 3
(129) In this Example, it will be stated as an example that non-nativenon-native IgG contained in a small amount in a natural IgG sample was quantitatively detected by using synthetic peptide 2A1 represented by SEQ ID NO: 11. Generally in a quality control step of antibody drugs, chromatographic technique such as size exclusion chromatography is frequently used as a rapid and simple technique for evaluating heterogeneity (Non Patent Literature 30). In the Example, usefulness of a detection technique using the polypeptide of the present invention was demonstrated by comparing to general method, i.e., size exclusion chromatography.
(130) Non-nativeNon-native IgG was obtained by dialyzing a human monoclonal antibody against 10 mM Glycine-HCl, 150 mM NaCl, pH 2.0 by which AFS is known to be produced, for 18 hours. The prepared non-nativenon-native IgG was neutralized by Tris-HCl (pH 8.0) and mixed with natural IgG (6.7 M) diluted in HBS-T buffer at predetermined dilution rates (10, 5, 1, 0.1, 0.01, 0.001%), which were used as measurement samples.
(131) Subsequently, measurement samples were analyzed by use of surface plasmon resonance and size exclusion chromatography. Both analysis methods were compared with respect to detection sensitivity of non-nativenon-native IgG. The surface plasmon resonance test was performed by use of the measurement apparatus and sensor chip described in Example 1, 7).
(132) Measurement data of prepared samples were analyzed by Bicore T100 Evaluation Software (GE Healthcare), an amount of contaminant, i.e., non-native IgG, was determined as a binding response (
(133)
Example 4
(134) In this Example, it will be stated as an example that an affinity column was prepared by immobilizing thioredoxin fusion protein p17_trx (SEQ ID NO: 86) prepared by fusing an IgG-binding polypeptide, and the affinity column was used in removing and purifying an Fc region and in purifying human IgG. As described in Example 2, 4), the polypeptide of the present invention binds to an Fc region of IgG with an equilibrium dissociation constant of the order of nM and thus has a binding activity corresponding to those of a conventional IgG-binding protein and IgG-binding polypeptide or beyond them. Based on the high binding activity, the polypeptide of the present invention was applied to an affinity column, which can be favorably used for selectively removing an Fc region or IgG purification.
(135) (1) In this section, it will be stated as an example that the polypeptide of the present invention was applied to a case where removal of an Fc region is required, more specifically, a case where a Fab region was purified from papain digestion product of IgG. A thioredoxin fusion protein was prepared in the same manner as in Example 2, 5). Thioredoxin fusion protein p17_trx (12 mg/mL) prepared was immobilized to HiTrap NHS-activated HP (GE Healthcare) via an amino group under the conditions and a method according to the accompanying manual. The amount of immobilized fusion protein calculated was about 10.8 mg.
(136) Subsequently, human monoclonal IgG was digested with papain by use of Pierce Fab Preparation Kit (Thermo SCIENTIFIC) in accordance with the accompanying manual. The papain digestion product of IgG prepared was purified by p17_trx immobilization column. More specifically, to AKTA purifier (GE Healthcare) used as a chromatographic apparatus, a papain digestion product was applied in the presence of a running buffer (50 mM Tris-HCl, 150 mM NaCl, pH 7.4) and elution was made by an elution buffer (100 mM Gly-HCl, pH 2.0). The obtained chromatogram is shown in
(137) (2) In this section, it will be stated as an example that p17_trx immobilization column was applied to purification of human monoclonal IgG. To the column prepared in the previous section, human monoclonal IgG was applied in the presence of a running buffer (50 mM Tris-HCl, 150 mM NaCl, pH 7.4) and IgG was eluted by pH gradient prepared by mixing 50 mM sodium citrate (pH 7.0) and 0.5 M acetic acid (pH 2.5). The obtained chromatogram is shown in
Example 5
(138) In this section, it will be stated as an example that the binding activity of variants (SEQ ID NOs: 158 to 164), which were obtained by introducing a mutation of 1 amino acid residue to the amino acid sequence of polypeptide 2A1 represented by SEQ ID NO: 11, was measured by surface plasmon resonance to evaluate the effect of each amino acid residue on binding.
(139) Seven types of variant polypeptides, 2A1_Q5R (SEQ ID NO: 158), 2A1_W6A (SEQ ID NO: 159), 2A1_S7A (SEQ ID NO: 160), 2A1_R17A (SEQ ID NO: 161), 2A1_S18A (SEQ ID NO: 162), 2A1_S19A (SEQ ID NO: 163) and 2A_I20A (SEQ ID NO: 164) previously synthesized in an organic chemical manner, were purchased from bioSYNTHESIS. As the surface plasmon resonance measurement apparatus, Biacore T100 (GE Healthcare) was used. The human Fc region having a non-native structure used herein was prepared by dialyzing a natural human Fc region against an acid buffer (10 mM Gly-HCl, 150 mM NaCl, pH 2.0). The non-native human Fc region was immobilized to Sensor Chip CM5 (GE Healthcare) by the amine coupling method using Amine Coupling Kit (GE Healthcare). Subsequently, polypeptide Q5R was diluted with HBS-T buffer (10 mM HEPES, 150 mM NaCl, 0.05% Tween 20 (registered trade mark), pH 7.4) to have a concentration of 62.5, 31.3 or 15.6 nM, W6A to a concentration of 500, 250 or 125 nM; S7A a concentration of 1000, 500 or 250 nM, R17A to a concentration of 500, 250 or 125 nM, S18A to a concentration of 125, 62.5 or 31.3 nM, S19A to a concentration of 1000, 500 or 250 nM and 120A to a concentration of 500, 250 or 125 nM. The binding activity was measured at a reaction temperature of 25 C.
(140) Measurement data were processed by Biacore TOO Evaluation Software (GE Healthcare) to calculate equilibrium dissociation constant K.sub.D values of Q5R, W6A, S7A, R17A, S18A, S19A and 120A (Table 6). As a result, it was found that binding activity increases 2.5 times by changing the glutamine residue at the 5-position to an arginine residue. Furthermore, the amino acid residues which significantly reduce binding activity by changing each of them to an alanine residue were identified. It was confirmed that a tryptophan residue at the 6-position reduces the binding activity about ; the serine residue at the 7-position about , the arginine residue at the 17-position about 1/16, the serine residue at the 19-position about 1/10 and the isoleucine residue at the 20-position about 1/50. The results show that these residues are greatly involved in expression of binding activity.
(141) TABLE-US-00038 TABLE6 SEQ ID Polypeptide Sequence K.sub.D(nM) NO: 2A1_Q5R GVVRRWSGYDPRTGTWRSSIAYGGG 8.7 158 2A1_W6A GVVRQASGYDPRTGTWRSSIAYGGG 180 159 2A1_S7A GVVRQWAGYDPRTGTWRSSIAYGGG 110 160 2A1_R17A GVVRQWSGYDPRTGTWASSIAYGGG 350 161 2A1_S18A GVVRQWSGYDPRTGTWRASIAYGGG 23 162 2A1_S19A GVVRQWSGYDPRTGTWRSAIAYGGG 220 163 2A1_I20A GVVRQWSGYDPRTGTWRSSAAYGGG 920 164
Example 6
(142) In this Example, it will be stated as an example that a target Fc region of human IgG was recovered from a solution containing contaminant proteins in order to evaluate the binding specificity of polypeptide 2A1 consisting of an amino acid sequence represented by SEQ ID NO: 11.
(143) Polypeptide 2A1 (0.5 mg) was dissolved in 1.5 mL of a sodium carbonate buffer (0.2 M NaHCO3, 0.5 M NaCl, pH 8.3) and immobilized to NHS-activated Sepharose (registered trade mark) (0.1 mL) (GE Healthcare) by the amine coupling method in accordance with the procedure instructed in the accompanying manual. The reaction rate of immobilization was 42%. A solution containing contaminant proteins was prepared by suspending Escherichia coli BLT5403 strain, which was obtained by culturing in 1 mL-LB medium, in 1 mL of TBS-T buffer (50 mM Tris-HCl, 150 mM NaCl, 0.05% (w/v) Tween 20 (registered trade mark), pH 7.4), subjecting the suspension solution to ultrasonic grinding, and centrifuging to obtain the supernatant. A human Fc region having a non-native structure was prepared by dialyzing natural human Fc region against glycine hydrochloric acid buffer (10 mM Glycine-HCl, 150 mM NaCl, pH 2.0). The non-native Fc region (about 5 g) was added to the above Escherichia coli ground solution (62 L) and diluted with TBS-T buffer to obtain 1 mL of a solution. This was used as a sample solution for binding specificity evaluation. As a control solution for a comparison test, an Escherichia coli ground solution containing no non-native Fc region was prepared.
(144) The sample solution prepared and Sepharose having 2A1 peptide immobilized thereto were mixed for 20 minutes. Thereafter, the mixture was washed five times with 0.5 mL of TBS-T buffer and eluted with 0.2 mL of 50 mM NaOH. The eluate was neutralized with 10 L of 3 M sodium acetate (pH 5.2). The eluate and sample solution were analyzed by SDS polyacrylamide gel electrophoresis (
Example 7
(145) In this Example, a complex of polypeptide p17 consisting of SEQ ID NO: 57 and an Fc region of human IgG was analyzed by X-ray crystal structural analysis and the conformation of the complex was determined. The analysis method and results will be described.
(146) Polypeptide p17 was prepared in the same manner as in Example 2, 4). The Fc region of human IgG was prepared in the same manner as in Example 2, 1). A complex of polypeptide p17 and the Fc region was dialyzed against a buffer (20 mM Tris-HCl, 10% (v/v) dimethylsulfoxide, pH 7.4) and concentrated by ultrafiltration to a concentration of 10 mg/mL. A crystal was obtained by using a 40% polyethylene glycol 4000, 0.1 M sodium citrate (pH 5.6) and 0.2 M ammonium acetate as a precipitator/buffer for crystallization in accordance with a sitting-drop vapor diffusion method. The crystal obtained was subjected to diffraction in a high energy accelerator research institute, Photon Factory NW-12A and diffraction data were collected. Phase determination was performed by a molecular replacement method using a search model (Protein Data Bank (PDB) code, 1DN2). The structure of the crystal was accurately analyzed by CNS (Non Patent Literature 31 Brunger A T, Adams P D, Clore G M, DeLano W L, Gros P, Grosse-Kunstleve R W, Jiang J S, Kuszewski J, Nilges M, Pannu N S, Read R J, Rice L M, Simonson T, and Warren G L. (1998) Crystallography & NMR system: A new software suite for macromolecular structure determination. Acta Crystallogr D Biol Crystallogr. 54, 905-921), CCP4 suite (Non Patent Literature 32 Winn M D, Ballard C C, Cowtan K D, Dodson E J, Emsley P, Evans P R, Keegan R M, Krissinel E B, Leslie A G, McCoy A, McNicholas S J, Murshudov G N, Pannu N S, Potterton E A, Powell H R, Read R J, Vagin A and Wilson K S. (2011) Overview of the CCP4 suite and current developments. Acta Crystallogr D Biol Crystallogr. 67, 235-242) and Coot (Non Patent Literature 33 Emsley P and Cowtan K. (2004) Coot: model-building tools for molecular graphics. Acta Crystallogr D Biol Crystallogr. 60, 2126-2132). As a result, the crystal structure of the complex was determined at a resolution of 2.9 . Four complexes, i.e., four Fc regions and eight p17 molecules were contained in an asymmetric unit.
(147) Polypeptide p17 was formed of four strands, three hairpins, a single short helix and a single loop structure (
Example 8
(148) In this Example, it will be stated as an example that a variant was prepared by substituting an amino acid residue present in the C terminal segment of p17 polypeptide (SEQ ID NO: 57) with alanine and the effect of the amino acid residue on the binding activity was evaluated by measuring the binding activity and the role of the amino acid residue was more specifically analyzed in comparison with the conformation data obtained in Example 7.
(149) DNA molecules (SEQ ID NOs: 179 to 183) encoding amino acid sequences represented by SEQ ID NOs: 174 to 178 were designed and synthesized by PCR. Thioredoxin fusion proteins were expressed and treated with protease in the same manner as in Example 2, 4) to prepare variant polypeptides, which were designated as follows: p17_P46A (SEQ ID NO: 174), p17_D47A (SEQ ID NO: 175), p17_W48A (SEQ ID NO: 176), p17_R50A (SEQ ID NO: 177) and p17_M51A (SEQ ID NO: 178).
(150) Subsequently, the binding activity of five types of polypeptides prepared above was analyzed by surface plasmon resonance. Biacore T100 (GE Healthcare) was used in measurement. An Fc region was immobilized to Sensor Chip CM5 (GE Healthcare) and binding activity was analyzed in the same manner as in Example 2, 4). The binding activity values of the polypeptides obtained by the analysis are shown in Table 7. In all variants having a substitution with alanine, decrease of binding activity was confirmed, suggesting that these residues are involved in binding activity. Particularly, the binding activity values of p17_W48A and p17_M51A having an alanine substitution decreased 100 times or more. [Table 7]
(151) TABLE-US-00039 TABLE 7 Equilibrium dissociation constant of p17 variant Variant K.sub.D (nM) SEQ ID NO: p17_P46A 5.6 174 p17_D47A 45 175 p17_W48A 200 176 p17_R50A 7.8 177 p17_M51A 180 178
(152) Next, the site substituted with alanine was discussed from a structural point of view. The direction of a main chain of the polypeptide is changed at a Pro46 site due to structural orientation specific to the proline residue, with the result that the direction of the helix present upstream the site is slightly changed appropriately (
(153) The aforementioned results experimentally demonstrate that in the amino acid sequences randomly introduced in a molecular library, a functionally and structurally favorable amino acid residue is employed as a result of functional selection, with the result that the function of the resultant polypeptide can be effectively enhanced, based on not only binding function analysis but also conformational analysis.
(154) All publications, patents and patent applications cited in the specification are incorporated in their entirety by reference.
INDUSTRIAL APPLICABILITY
(155) The present invention is useful in detection, purification, immobilization or removal of proteins including antibodies.
SEQUENCE LIST FREE TEXT
(156) SEQ ID NO: 1: IgG binding peptide
(157) SEQ ID NO: 2: IgG binding peptide, H6
(158) SEQ ID NO: 3: IgG binding peptide, H3
(159) SEQ ID NO: 4: IgG binding peptide, D5
(160) SEQ ID NO: 5: IgG binding peptide, E7
(161) SEQ ID NO: 6: IgG binding peptide, sC12
(162) SEQ ID NO: 7: IgG binding peptide, G3
(163) SEQ ID NO: 8: IgG binding peptide, G11
(164) SEQ ID NO: 9: IgG binding peptide, sA7
(165) SEQ ID NO: 10: IgG binding peptide
(166) SEQ ID NO: 11: IgG binding peptide, 2A1
(167) SEQ ID NO: 12: IgG binding peptide, 2A4
(168) SEQ ID NO: 13: IgG binding peptide, 2F12
(169) SEQ ID NO: 14: IgG binding peptide, 2H1
(170) SEQ ID NO: 15: IgG binding peptide, 2F2
(171) SEQ ID NO: 16: IgG binding peptide, 2F4
(172) SEQ ID NO: 17: IgG binding peptide, 2F6
(173) SEQ ID NO: 18: IgG binding peptide, 2F7
(174) SEQ ID NO: 19: IgG binding peptide, 2F9
(175) SEQ ID NO: 20: IgG binding peptide
(176) SEQ ID NO: 21: IgG binding peptide, 2A1Gly
(177) SEQ ID NO: 22: IgG binding peptide, RSS
(178) SEQ ID NO: 23: IgG binding peptide
(179) SEQ ID NO: 24: IgG binding peptide, pep14
(180) SEQ ID NO: 25: IgG binding peptide, pep11
(181) SEQ ID NO: 26: IgG binding peptide, pep21
(182) SEQ ID NO: 27: IgG binding peptide, pep24
(183) SEQ ID NO: 28: IgG binding peptide, pep3
(184) SEQ ID NO: 29: IgG binding peptide, pep9
(185) SEQ ID NO: 30: IgG binding peptide, pep7
(186) SEQ ID NO: 31: IgG binding peptide, pep25
(187) SEQ ID NO: 32: IgG binding peptide, pep27
(188) SEQ ID NO: 33: IgG binding peptide, pep31
(189) SEQ ID NO: 34: IgG binding peptide, pep1
(190) SEQ ID NO: 35: IgG binding peptide, pep2
(191) SEQ ID NO: 36: IgG binding peptide, pep3
(192) SEQ ID NO: 37: IgG binding peptide, pep4
(193) SEQ ID NO: 38: IgG binding peptide, pep5
(194) SEQ ID NO: 39: IgG binding peptide, pep6
(195) SEQ ID NO: 40: IgG binding peptide, pep10
(196) SEQ ID NO: 41: IgG binding peptide, pep12
(197) SEQ ID NO: 42: IgG binding peptide, pep29
(198) SEQ ID NO: 43: IgG binding peptide, pep15
(199) SEQ ID NO: 44: IgG binding peptide, pep16
(200) SEQ ID NO: 45: IgG binding peptide, pep17
(201) SEQ ID NO: 46: IgG binding peptide, pep18
(202) SEQ ID NO: 47: IgG binding peptide, pep19
(203) SEQ ID NO: 48: IgG binding peptide, pep20
(204) SEQ ID NO: 49: IgG binding peptide, pep22
(205) SEQ ID NO: 50: IgG binding peptide, pep23
(206) SEQ ID NO: 51: IgG binding peptide, pep26
(207) SEQ ID NO: 52: IgG binding peptide, pep28
(208) SEQ ID NO: 53: IgG binding peptide, pep29
(209) SEQ ID NO: 54: IgG binding peptide, pep30
(210) SEQ ID NO: 55: IgG binding peptide, pep11_2
(211) SEQ ID NO: 56: IgG binding peptide
(212) SEQ ID NO: 57: IgG binding peptide, p17
(213) SEQ ID NO: 58: IgG binding peptide, p6
(214) SEQ ID NO: 59: IgG binding peptide, p12
(215) SEQ ID NO: 60: IgG binding peptide, p16
(216) SEQ ID NO: 61: IgG binding peptide, p19
(217) SEQ ID NO: 62: IgG binding peptide, p36
(218) SEQ ID NO: 63: IgG binding peptide, p2_2
(219) SEQ ID NO: 64: IgG binding peptide, p4
(220) SEQ ID NO: 65: IgG binding peptide, p5
(221) SEQ ID NO: 66: IgG binding peptide, p13
(222) SEQ ID NO: 67: IgG binding peptide, p14
(223) SEQ ID NO: 68: IgG binding peptide, p15_2
(224) SEQ ID NO: 69: IgG binding peptide, p20
(225) SEQ ID NO: 70: IgG binding peptide, p26
(226) SEQ ID NO: 71: IgG binding peptide, p27
(227) SEQ ID NO: 72: IgG binding peptide, p28
(228) SEQ ID NO: 73: IgG binding peptide
(229) SEQ ID NO: 74: IgG binding peptide, p2
(230) SEQ ID NO: 75: IgG binding peptide, p15
(231) SEQ ID NO: 76: IgG binding peptide, p24
(232) SEQ ID NO: 77: IgG binding peptide, p25
(233) SEQ ID NO: 78: IgG binding peptide, p34
(234) SEQ ID NO: 79: IgG binding peptide, p24_2
(235) SEQ ID NO: 80: IgG binding peptide, p25_2
(236) SEQ ID NO: 81: IgG binding peptide, p31
(237) SEQ ID NO: 82: Thioredoxin fusion protein, H6_trx
(238) SEQ ID NO: 83: Thioredoxin fusion protein, 2A1_trx
(239) SEQ ID NO: 84: Thioredoxin fusion protein, 2A4_trx
(240) SEQ ID NO: 85: Thioredoxin fusion protein, 2F12_trx
(241) SEQ ID NO: 86: Thioredoxin fusion protein, p17_trx
(242) SEQ ID NO: 87: Thioredoxin fusion protein, pep14_trx
(243) SEQ ID NO: 88: Thioredoxin fusion protein, pep21_trx
(244) SEQ ID NO: 89: Thioredoxin fusion protein, pep24_trx
(245) SEQ ID NO: 90: Thioredoxin fusion protein, pep3_trx
(246) SEQ ID NO: 91: Thioredoxin fusion protein, pep9_trx
(247) SEQ ID NO: 92: Thioredoxin fusion protein, pep7_trx
(248) SEQ ID NO: 93: Thioredoxin fusion protein, pep25_trx
(249) SEQ ID NO: 94: Thioredoxin fusion protein, pep27_trx
(250) SEQ ID NO: 95: Thioredoxin fusion protein, pep31_trx
(251) SEQ ID NO: 96: Thioredoxin fusion protein
(252) SEQ ID NO: 97: Thioredoxin fusion protein, p2_trx
(253) SEQ ID NO: 98: Thioredoxin fusion protein, p6_trx
(254) SEQ ID NO: 99: Thioredoxin fusion protein, p12_trx
(255) SEQ ID NO: 100: Thioredoxin fusion protein, p15_trx
(256) SEQ ID NO: 101: Thioredoxin fusion protein, p16_trx
(257) SEQ ID NO: 102: Thioredoxin fusion protein, p19_trx
(258) SEQ ID NO: 103: Thioredoxin fusion protein, p24_trx
(259) SEQ ID NO: 104: Thioredoxin fusion protein, p25_trx
(260) SEQ ID NO: 105: Thioredoxin fusion protein, p34_trx
(261) SEQ ID NO: 106: Thioredoxin fusion protein, p36_trx
(262) SEQ ID NO: 107: Thioredoxin fusion protein, p2_2_trx
(263) SEQ ID NO: 108: Thioredoxin fusion protein, p4_trx
(264) SEQ ID NO: 109: Thioredoxin fusion protein, p5_trx
(265) SEQ ID NO: 110: Thioredoxin fusion protein, p13_trx
(266) SEQ ID NO: 111: Thioredoxin fusion protein, p14_trx
(267) SEQ ID NO: 112: Thioredoxin fusion protein, p15_2_trx
(268) SEQ ID NO: 113: Thioredoxin fusion protein, p20_trx
(269) SEQ ID NO: 114: Thioredoxin fusion protein, p24_2_trx
(270) SEQ ID NO: 115: Thioredoxin fusion protein, p25_2_trx
(271) SEQ ID NO: 116: Thioredoxin fusion protein, p26_trx
(272) SEQ ID NO: 117: Thioredoxin fusion protein, p27_trx
(273) SEQ ID NO: 118: Thioredoxin fusion protein, p28_trx
(274) SEQ ID NO: 119: Thioredoxin fusion protein, p31_trx
(275) SEQ ID NO: 120: Oligo DNA
(276) SEQ ID NO: 121: Oligo DNA
(277) SEQ ID NO: 122: Oligo DNA
(278) SEQ ID NO: 123: Oligo DNA
(279) SEQ ID NO: 124: Oligo DNA
(280) SEQ ID NO: 125: Oligo DNA
(281) SEQ ID NO: 126: Oligo DNA
(282) SEQ ID NO: 127: Oligo DNA
(283) SEQ ID NO: 128: Oligo DNA
(284) SEQ ID NO: 129: Oligo DNA
(285) SEQ ID NO: 130: Oligo DNA
(286) SEQ ID NO: 131: Oligo DNA
(287) SEQ ID NO: 132: Oligo DNA
(288) SEQ ID NO: 133: Oligo DNA
(289) SEQ ID NO: 134: Oligo DNA
(290) SEQ ID NO: 135: Oligo DNA
(291) SEQ ID NO: 136: Oligo DNA
(292) SEQ ID NO: 137: Oligo DNA
(293) SEQ ID NO: 138: Oligo DNA
(294) SEQ ID NO: 139: Oligo DNA
(295) SEQ ID NO: 140: Oligo DNA
(296) SEQ ID NO: 141: Oligo DNA
(297) SEQ ID NO: 142: Oligo DNA
(298) SEQ ID NO: 143: Oligo DNA
(299) SEQ ID NO: 144: Oligo DNA
(300) SEQ ID NO: 145: Oligo DNA
(301) SEQ ID NO: 146: Oligo DNA
(302) SEQ ID NO: 147: Oligo DNA
(303) SEQ ID NO: 148: Oligo DNA
(304) SEQ ID NO: 149: Oligo DNA
(305) SEQ ID NO: 150: Oligo DNA
(306) SEQ ID NO: 151: Oligo DNA
(307) SEQ ID NO: 152: Oligo DNA
(308) SEQ ID NO: 153: Oligo DNA
(309) SEQ ID NO: 154: Oligo DNA
(310) SEQ ID NO: 155: Oligo DNA
(311) SEQ ID NO: 156: Oligo DNA
(312) SEQ ID NO: 157: Oligo DNA
(313) SEQ ID NO: 158: IgG binding peptide, 2A1_Q5R
(314) SEQ ID NO: 159: IgG binding peptide, 2A1_W6A
(315) SEQ ID NO: 160: IgG binding peptide, 2A1_S7A
(316) SEQ ID NO: 161: IgG binding peptide, 2A1_R17A
(317) SEQ ID NO: 162: IgG binding peptide, 2A1_S18A
(318) SEQ ID NO: 163: IgG binding peptide, 2A1_S19A
(319) SEQ ID NO: 164: IgG binding peptide, 2A1_I20A
(320) SEQ ID NO: 165: IgG binding peptide, Fc-III
(321) SEQ ID NO: 166: IgG binding peptide
(322) SEQ ID NO: 167: IgG binding peptide
(323) SEQ ID NO: 168: IgG binding peptide library
(324) SEQ ID NO: 169: Glycine linker
(325) SEQ ID NO: 170: IgG binding peptide library
(326) SEQ ID NO: 171: IgG binding peptide library
(327) SEQ ID NO: 172: IgG binding peptide library
(328) SEQ ID NO: 173: IgG binding peptide library
(329) SEQ ID NO: 174: IgG binding peptide, p17_P46A
(330) SEQ ID NO: 175: IgG binding peptide, p17_D47A
(331) SEQ ID NO: 176: IgG binding peptide, p17_W48A
(332) SEQ ID NO: 177: IgG binding peptide, p17_R50A
(333) SEQ ID NO: 178: IgG binding peptide, p17_M51A
(334) SEQ ID NO: 179: Oligo DNA
(335) SEQ ID NO: 180: Oligo DNA
(336) SEQ ID NO: 181: Oligo DNA
(337) SEQ ID NO: 182: Oligo DNA
(338) SEQ ID NO: 183: Oligo DNA