Recombinant HCV E2 glycoprotein
09598467 ยท 2017-03-21
Assignee
Inventors
Cpc classification
A61K39/00
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
C12N2770/24222
CHEMISTRY; METALLURGY
C12N2770/24234
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
A61P1/16
HUMAN NECESSITIES
A61K2039/545
HUMAN NECESSITIES
International classification
Abstract
The invention provides modified hepatitis C virus (HCV) E2 glycoproteins comprising the HCV-E2 receptor-binding domain (RBD) including the HVR1, HVR2 and igVR variable regions wherein in at least one of said variable regions at least a part of the variable region is replaced with a flexible linker sequence. The invention also provides vaccine compositions comprising the modified glycoproteins as well as methods of use thereof.
Claims
1. An isolated modified hepatitis C virus (HCV) E2 glycoprotein comprising a modification in the HCV-E2 receptor-binding domain (RBD) ranging from amino acid residues 384 to 661, wherein, in the modified glycoprotein, at least the intergenotypic variable region (igVR) of the HCV-E2 receptor-binding domain is deleted, and wherein the modified glycoprotein binds to the HCV receptor CD81.
2. A modified glycoprotein according to claim 1, wherein the HVR1 variable region also is deleted and is optionally replaced with a flexible linker sequence.
3. A modified glycoprotein according to claim 1, wherein the HVR2 variable region also is deleted and is optionally replaced with a flexible linker sequence.
4. A modified glycoprotein according to claim 1, wherein the variable regions HVR1 and HVR2 also are deleted and each optionally is replaced with a flexible linker sequence.
5. A modified glycoprotein according to claim 2, wherein the HVR1 variable region is replaced with a flexible linker sequence.
6. A modified glycoprotein according to claim 3, wherein the HVR2 variable region is replaced with a flexible linker sequence.
7. A modified glycoprotein according to claim 4, wherein the variable regions HVR1 and HVR2 are replaced with flexible linker sequences.
8. A modified glycoprotein according to claim 5, wherein the flexible linker sequence comprises a Gly-Ser-Ser-Gly (GSSG) sequence (SEQ ID NO: 95).
9. A modified glycoprotein according to claim 5, wherein the flexible linker sequence, comprises a Glu-Thr-His-Gly-Ser-Ser-Gly (ETHGSSG) sequence (SEQ ID NO: 109).
10. A composition comprising a modified HCV E2 glycoprotein according to claim 1, together with a pharmaceutically acceptable carrier or diluent.
11. A composition according to claim 10, further comprising an adjuvant.
12. An agent for eliciting an immune response in a patient, which comprises a modified HCV E2 glycoprotein according to claim 1.
13. An agent for therapeutic treatment of HCV infection in a patient, which comprises a modified HCV E2 glycoprotein according to claim 1.
14. A method of eliciting an immune response in a patient, which comprises administration to the patient of an effective amount of a modified HCV E2 glycoprotein according to claim 1.
15. A method according to claim 14, wherein the patient is a human.
16. A method for therapeutic treatment of HCV infection in a patient, which comprises administration to the patient of an effective amount of a modified HCV E2 glycoprotein according to claim 1.
17. A method according to claim 16, wherein the patient is a human.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
DETAILED DESCRIPTION OF THE INVENTION
(37) The modified E2 core structure of the HCV virion in which at least one of the variable regions, and in particular the variable region igVR identified by the inventors, has been modified by removal or deletion of at least a part of the variable region, and optional insertion of a linker sequence, has practical use as a vaccine that can elicit broadly neutralizing antibodies to diverse strains of HCV. The binding efficiency of the modified E2 glycoprotein exhibits wild-type binding to the HCV receptor CD81, and the modified E2 glycoprotein provides a means of treating HCV infection by mimicking complex conformational changes of the E2 ectodomain required for effective CD81 binding, and thereafter initiating an immune response without cell invasion.
(38) In one aspect, the present invention provides a modified hepatitis C virus (HCV) E2 glycoprotein comprising the HCV-E2 receptor-binding domain (RBD) including the HVR1, HVR2 and igVR variable regions, wherein in at least one of said variable regions at least a part of the variable region is replaced with a flexible linker sequence.
(39) In another aspect, the present invention provides a modified hepatitis C virus (HCV) E2 glycoprotein comprising the HCV-E2 receptor-binding domain (RBD) including the HVR1, HVR2 and igVR variable regions, wherein at least a part of the HVR2 variable region is removed or is replaced with a flexible linker sequence.
(40) In yet another aspect, the present invention provides a modified hepatitis C virus (HCV) E2 glycoprotein comprising the HCV-E2 receptor-binding domain (RBD) including the HVR1, HVR2 and igVR variable regions, wherein at least a part of the igVR variable region is removed or is replaced with a flexible linker sequence.
(41) References herein to the HVR1 and HVR2 variable regions are to be understood as references to the two variable regions HVR1 (384-410) and HVR2 (461-481), while references herein to the igVR variable region are to be understood as references to the intergenotypic variable region igVR (570-580) identified by the inventors.
(42) The term flexible linker sequence is used herein to refer to a short, flexible, polypeptide sequence which permits disulfide bond linkages between cysteine residues in the modified glycoprotein leading to retention of the native or wild-type disulfide linkages, and in particular retention of the ability to bind to the HCV CD81 receptor and conformation-dependent antibodies. Suitable linker sequences are discussed in review articles by George and Heringa, 2002, and Argos, 1990, and may consist of up to 20 amino acid residues such as Gly and Ser, and include, and comprise amino acids selected from the sequence group consisting of Gly, Ser, Ala, Thr and Arg, more particularly Gly- and Ser-Ser-Gly (GSSG) (SEQ ID NO: 95). Suitable linker sequences include, by way of example, the sequences (Gly).sub.2-Ala-(Gly).sub.2 (SEQ ID NO: 96), (Gly).sub.5 (SEQ ID NO: 97) or (Gly).sub.8 (SEQ ID NO: 98) (see Sabourin et al., 2007), (Gly).sub.6 (SEQ ID NO: 99), (Gly).sub.7 (SEQ ID NO: 100) or (Gly).sub.10 (SEQ ID NO: 101) (see Yang and Gruebele, 2006), Gly-Ser-Gly-Ser-Gly (SEQ ID NO: 102) (see Dipti et al., 2006), (Gly).sub.4 (SEQ ID NO: 103) (see Anandarao et al., 2006), Gly-Ala-Gly (see Wyatt et al., 1995), (Gly).sub.2-Arg-(Gly).sub.2-Ser (SEQ ID NO: 104) (see Bellamy-McIntyre et al., 2007), (Gly-Gly-Gly-Gly-Ser).sub.n=34 (SEQ ID NO: 105) (see Arai et al., 2006), and Ser-(Gly).sub.2-Ser-Gly (SEQ ID NO: 106) (see Bahrami et al., 2007).
(43) A preferred sequence is the sequence Gly-(Ser).sub.2-Gly (SEQ ID NO: 95) disclosed herein. It will be understood that selection of suitable polypeptide linker sequences is a matter of routine experimentation for a person skilled in this field, and the modified HCV E2 glycoproteins of the present invention are not limited to the particular linker sequences disclosed herein. Without wishing to be bound by any theory, by replacing HVR1, HVR2 and igVR with short flexible linkers, disulfide-bond formation between Cys-569 to Cys-581 and between Cys-459 to Cys-486, for example, and the intrinsic folding of conserved E2 core domain, is substantially retained in the modified glycoproteins.
(44) References in this specification to deletion of at least part of one of the variable regions of the HCV E2 receptor-binding domain are to be understood as references to deletion or removal of at least part of the sequence of the variable region and optional insertion of a flexible linker sequence to replace the deleted sequence.
(45) The modified HCV E2 glycoproteins of the present invention may be prepared by any suitable method, including in particular preparation of the modified glycoproteins in the form of recombinant products by expression of appropriate DNA deletion constructs as described in the Examples herein.
(46) Preferably at least one of the second and third variable regions of the core E2 receptor-binding domain, HVR2 and igVR, is modified by removal of at least a portion of the residue within the region and inserting a flexible linker sequence. It has been found that deletion of at least part of the HVR2 region, in combination with other variable region deletions, substantially reduces E1E2 heterodimerisation.
(47) In a further embodiment, all three of the variable regions are modified by removal of at least a portion of the residues within these regions and inserting a linker sequence.
(48) Deletion of intergenotypic variable region (igVR) from the E2 glycoprotein that already contains deletions of HVR1 and HVR2 improves binding to CD81 relative to simultaneous deletions of HVR1 and HVR2 alone.
(49) It has been found by the inventors that HVR1, HVR2, and igVR are all required for E1E2-pp mediated viral entry into Huh7 cells. E1E2-pp containing deletions of at least each of HVR1, HVR2, and igVR have been found to retain wild-type levels of recombinant CD81 binding. This represents a significant improvement in the ability to (a) mimic cell binding of the HCV virion, and (b) initiate an immune response without exposing a patient to highly variable immunodominant regions that may be immune decoys.
(50) In a preferred embodiment, all three variable regions can be deleted and retain the core E2 folding domain which is required to assemble at least three discontinuous binding elements involved in the CD81-binding site. A further advantage of various combined deletions of HVR1, HVR2, and igVR from the E2 receptor-binding domain is that a soluble form of the E2 core domain is obtainable, which is suitable for use as an immunogen.
(51) The present invention also provides a composition comprising a modified HCV E2 glycoprotein as broadly described above, together with a pharmaceutically acceptable carrier or diluent.
(52) Such a composition may be formulated as a vaccine composition, preferably including an adjuvant.
(53) Conventional pharmaceutically acceptable carriers, excipients, buffers or diluents, may be included in vaccine compositions of this invention. Generally, a vaccine composition in accordance with the present invention will comprise an immunologically effective amount of the modified HCV E2 glycoprotein, and optionally an adjuvant, in conjunction with one or more conventional pharmaceutically acceptable carriers and/or diluents. An extensive though not exhaustive list of adjuvants can be found in Cox and Coulter, Advances in Adjuvant Technology and Application, in Animal Parasite Control Utilizing Biotechnology, Chapter 4, Ed. Young, W. K., CRC Press 1992, and in Cox and Coulter, AdjuvantsA Classification and Review of Their Modes of Action, Vaccine 15(3), 248-256, 1997. As used herein pharmaceutically acceptable carriers and/or diluents include any and all solvents, dispersion media, aqueous solutions, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents and the like. The use of such media and agents for pharmaceutical active substances is well known in the art and is described by way of example in Remington's Pharmaceutical Sciences, 18.sup.th Edition, Mack Publishing Company, Pennsylvania, U.S.A.
(54) In yet another aspect, the present invention also provides a method of eliciting an immune response in a patient, which comprises administration to the patient of an effective amount of a modified HCV E2 glycoprotein as broadly described above.
(55) In this aspect, the invention includes a method for prophylactic or therapeutic treatment of HCV infection in a patient, which comprises administration to the patient of an effective amount of a modified HCV E2 glycoprotein as broadly described above.
(56) Reference herein to treatment is to be understood in its broadest context. Accordingly, the term prophylactic treatment includes treatment to protect the patient against infection or to reduce the likelihood of infection. Similarly, the term therapeutic treatment of infection does not necessarily imply that the patient is treated until total recovery from infection, and includes amelioration of the symptoms of infection as well as reducing the severity of, or eliminating, the infection.
(57) The modified HCV E2 glycoprotein of this invention is administered in an effective amount. An effective amount means an amount necessary at least partly to attain the desired response, or to delay the onset or inhibit progression or halt altogether, the onset or progression of the infection. The amount varies depending upon the health and physical condition of the individual to be treated, the racial background of the individual to be treated, the degree of protection desired, the formulation of the composition, the assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials. If necessary, the administration of an effective amount may be repeated one or several times. The actual amount administered will be determined both by the nature of the infection which is being treated and by the rate at which the active immunogen is being administered.
(58) Preferably, the patient is a human, however the present invention extends to treatment and/or prophylaxis of other mammalian patients including primates and laboratory test animals (e.g. mice, rabbits, rats, guinea pigs).
(59) In accordance with the present invention, the modified HCV E2 glycoprotein is preferably administered to a patient by a parenteral route of administration. Parenteral administration includes any route of administration that is not through the alimentary canal (that is, not enteral), including administration by injection, infusion and the like. Administration by injection includes, by way of example, into a vein (intravenous), an artery (intraarterial), a muscle (intramuscular) and under the skin (subcutaneous). The modified HCV E2 glycoprotein may also be administered in a depot or slow release formulation, for example, subcutaneously, intradermally or intramuscularly, in a dosage which is sufficient to obtain the desired pharmacological effect.
(60) Compositions suitable for parenteral administration conveniently comprise a sterile aqueous preparation of the active component which is preferably isotonic with the blood of the recipient. This aqueous preparation may be formulated according to known methods using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example as a solution in a polyethylene glycol and lactic acid. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution, suitable carbohydrates (e.g. sucrose, maltose, trehalose, glucose) and isotonic sodium chloride solution. In addition, sterile, fixed oils are conveniently employed as a solvent or suspending medium. For this purpose, any bland fixed oil may be employed including synthetic mono- or di-glycerides. In addition, fatty acids such as oleic acid find use in the preparation of injectables.
(61) In a further aspect, this invention provides the use of a modified HCV E2 glycoprotein as broadly described above in, or in the manufacture of a medicament for, eliciting an immune response in a patient.
(62) In a further aspect, this invention includes the use of a modified HCV E2 glycoprotein as broadly described above in, or in the manufacture of a medicament for, prophylactic or therapeutic treatment of HCV infection in a patient.
(63) In this further aspect, this invention provides an agent for eliciting an immune response in a patient, which comprises a modified HCV E2 glycoprotein as broadly described above.
(64) In this further aspect, the invention includes an agent for prophylactic or therapeutic treatment of HCV infection in a patient, which comprises a modified HCV E2 glycoprotein as broadly described above.
(65) In one embodiment of the invention, it has been found that recombinant E2 glycoprotein in which at least region igVR is subject to deletion of residues in the region and replacement with a flexible linker sequence improves recognition by conformational-dependent antibodies. In addition, it has been found that, in a comparative study with wild-type E2 glycoprotein, modification of the region igVR alone and in various combinations with HVR1 and HVR2 show binding to full-length CD81-LEL (large extracellular loop of human tetraspanin CD81) approaching that of the wild-type.
(66) It has been shown by the inventors that alignment of diverse E2 glycoprotein sequences across the six major genotypes identified a novel third variable region, igVR, between residues 560 and 581. It is suggested that igVR is not strictly a hypervariable region as it exhibits its greatest variability across different genotypes, whereas it is relatively conserved within a genotype and is thus unlikely to be under immune selection pressure. Furthermore, it consists of a series of insertions or deletions that shifts, but always maintains, the glycosylation site located within this region. The inventors have also observed that both variable regions HVR2 and igVR are flanked by conserved cysteine residues and proposed that these regions may form solvent-exposed loops stabilised by disulfide-bonding between these residues.
(67) The inventors have proposed that the hypervariable regions form flexible solvent-exposed subdomains that enable the E2 glycoprotein to move between open and closed conformations, the former being more competent for CD81 binding by exposing the conserved CD81-binding determinants located within the core E2 domain as delineated within this study. Indeed, conformational changes within the E2 glycoprotein have been previously observed upon CD81-binding. In addition, binding of non-neutralizing antibodies to the E2 glycoprotein has been demonstrated to reduce its susceptibility to neutralizing antibodies and is consistent with a model where the non-neutralizing antibodies inhibit the flexibility of these surface-exposed hypervariable regions thus blocking access to the conserved epitopes located within the E2 core domain.
(68) Therefore, this suggests that the modified E2 core domain represents a promising vaccine candidate for eliciting neutralizing antibodies to conserved epitopes within the E2 glycoprotein, including the CD81-binding determinants, that are otherwise occluded by these surface-exposed variable regions that may act as immunological decoys at the surface of the glycoprotein complex during HCV replication.
(69) The present invention also provides an isolated antibody raised against a modified HCV E2 glycoprotein as broadly described above.
(70) The term antibody is used broadly herein to include both monoclonal and polyclonal antibodies that specifically bind to the modified HCV E2 glycoprotein, as well as antigen binding fragments of such antibodies including, for example, Fab, F(ab.sup.1).sub.2, Fd and Fv fragments of an antibody that retain specific binding activity for the modified HCV E2 glycoprotein.
(71) Antibodies having the desired specificity, both monoclonal and polyclonal, can be obtained using methods which are well known in the art (see, for example, Harlow and Lane, Antibodies, A laboratory manual, Cold Spring Harbor Laboratory Press, 1988). Methods for preparing antibodies, and antigen binding fragments thereof, are also described in International Patent Publication WO 02/22155.
(72) The invention also provides a method for prophylactic or therapeutic treatment of HCV infection in a patient, which comprises administration to the patient of an effective amount of an antibody as described above. Accordingly, this method provides passive immunotherapy of the patient.
(73) As previously described, the invention also provides the use of an antibody as described above in, or in the manufacture of a medicament for, prophylactic or therapeutic treatment of HCV infection in a patient.
(74) In this aspect also, the invention provides an agent for prophylactic or therapeutic treatment of HCV infection in a patient, which comprises an antibody as described above.
(75) Further, the invention provides the use of an antibody as broadly described above in diagnosis of HCV infection. In this aspect, the invention provides a method of detecting HCV infection in a patient, comprising contacting a biological sample from the patient with an antibody as described above under conditions which allow formation of an antibody-antigen complex, and detecting said complex, wherein formation of said complex is indicative of the presence of HCV in the sample.
(76) Preferably, the antibody is detectably labelled. Suitable labels are well known in the art and include, for example, enzymes, radioisotopes, fluorescent compounds, colloidal metals, and chemiluminescent, phosphorescent and bioluminescent compounds. Preferably, the biological sample is a sample of a body fluid from the patient, such as a blood sample.
(77) The modified HCV E2 glycoproteins of the present invention may also be used in drug discovery techniques, including for example small molecule screening techniques.
(78) The present invention is further illustrated by the following non-limiting Examples.
EXAMPLE 1
(79) Materials and methods used in this Example are described below.
(80) 1. Role of the Individual Variable Regions in E1E2 Glycoprotein Structure and Function.
(81) The results for the various variable deletion mutants are summarized in Table 1.
(82) Intracellular E1E2 Precursor Folding and Heterodimerisation
(83) To examine the role of the individual variable regions in intracellular E1E2 biosynthesis, metabolically-labelled cell lysates of 293T cells transfected with the single variable region deletion constructs were immunoprecipitated with antibodies reactive to E1 and/or E2 epitopes. These preparations were analysed under both non-reducing and reducing conditions to characterise non-covalently associated E1E2 heterodimers existing within the large intracellular population of covalently-linked aggregate as previously observed.
(84) Immunoprecipitation with the polyclonal anti-E1E2 antibody (779) detected the total intracellular population of E1 (30 kDa) and E2 (70 kDa) glycoproteins to show efficient expression and cleavage from the polyprotein occurring for each single variable region deletion construct (see
(85) The non-conformation-dependent anti-E1 monoclonal antibody (A4) precipitated an E1 doublet at 30 kDa and 27 kDa for both the mutant and the wild-type constructs under reducing and non-reducing conditions (
(86) The non-conformation dependent anti-E2 monoclonal antibody (A11) detected intracellular E2 glycoprotein expression for all the individual variable region deletion constructs (
(87) The conformation-dependent anti-E2 monoclonal antibody (H53) has been shown to recognise native E2 on the surface of HCV virions and thus the amount of E1 co-precipitating with this E2 species is a good indicator of the proportion of functional non-covalently associated E1E2 heterodimers forming. Immunoprecipitation with H53 detected intracellular E2 glycoprotein expression for all individual variable region deletion constructs (
(88) E1E2 Glycoprotein Maturation and Incorporation into Pseudotyped HIV-1 Particles
(89) To examine the role of the individual variable regions in E1E2 glycoprotein maturation, the small amount of E1 and E2 escaping from the ER to transit through the secretory pathway was enriched for by the incorporation of these complexes into pseudotyped HIV-1 particles as previously described. These metabolically-labelled E1E2-pseudotyped HIV-1 particles were lysed prior to immunoprecipitation with the conformation-dependent anti-E2 monoclonal antibody (H53) and IgG from an HIV-1 infected individual (IgG14).
(90) Immunoprecipitation with IgG14 demonstrated that none of the single variable region deletion constructs had affected processing and virion incorporation of the HIV-1 structural proteins Pr55.sup.Gag, p17.sup.MA, p24.sup.CA or p66.sup.RT (
(91) Immunoprecipitation with H53 also detected a protein species migrating at 33 kDa and another lower molecular weight band at 31 kDa initially suggesting that the virion-incorporated E1 glycoprotein also migrates as a doublet (
(92) E1E2-Mediated Entry into Huh7 Cells
(93) The formation of the functional non-covalently associated E1E2 heterodimer has been shown to be critical for E1E2-mediated entry into Huh-7 cells. In order to investigate the role of the individual variable regions in viral entry, the single deletion constructs were used to generate E1E2-pseudotyped HIV-1 particles to infect Huh7 cells as previously described. As expected, the HVR1con deletion conferred a total loss of entry due to its retarded incorporation of the E2 glycoprotein into pseudotyped HIV-1 virions as observed above (
(94) CD81-LEL Binding
(95) It has been previously demonstrated that the E2 glycoprotein alone is sufficient to mediate binding to the CD81 receptor and therefore, despite exhibiting a loss of heterodimerisation and/or viral entry, both intracellular and virion-incorporated mutant E2 glycoproteins were examined for their ability to bind to the large-extracellular loop (LEL residues 113-201) of CD81. This involved applying both cell and viral lysates to a solid-phase CD81 MBP-LEL (residues 113-201) binding assay as previously described. This data was normalized for the amount of monomeric E2 expressed from each vector as precipitated with the conformation-dependent anti-E2 monoclonal antibody H53 and observed by SDS-PAGE under non-reducing conditions;
(96) All intracellular E2 glycoprotein precursors containing the single variable region deletions exhibited CD81-LEL binding at wild-type levels, except for HVR1 con that demonstrated a total loss of binding (
(97) As expected, the virion-incorporated E2 glycoprotein containing the HVR1con deletion could not mediate CD81-LEL binding, reflecting both its reduced incorporation into E1E2-pseudotyped HIV-1 particles as well as the intracellular data above (
(98) 2. Effect of the Extended Linker on E1E2 Glycoprotein Structure and Function
(99) Intracellular E1E2 Precursor Folding and Heterodimerisation
(100) In order to enhance the folding of the E2 glycoproteins containing the individual variable region deletions, the Gly-Ser-Ser-Gly linker (SEQ ID NO: 95) was extended by reintroducing several conserved cysteine-proximal residues deleted from the original constructs. Notably, this series of modified deletion constructs does not have a HVR1 counterpart due to the highly variable nature of this region. These constructs were analysed for E1 and E2 glycoprotein expression and heterodimerisation within 293T cells by pulse-chase metabolic-labelling and immunoprecipitation.
(101) Immunoprecipitation with the anti-E1E2 polyclonal antibody (779) detected intracellular expression and cleavage of the E1 (30 kDa) and E2 (70 kDa) glycoproteins from the polyprotein occurring for each extended linker deletion construct (
(102) The anti-E1 monoclonal antibody (A4) detected the presence of the E1 doublet (30 kDa and 27 kDa) for all extended linker constructs (
(103) E1E2 Glycoprotein Maturation and Incorporation into Pseudotyped HIV-1 Particles
(104) To examine whether the extended linkers altered E1E2 glycoprotein maturation and virion incorporation, the modified single deletions were introduced into E1E2-pseudotyped HIV-1 particles prior to lysis and immunoprecipitation with the conformation-dependent anti-E2 monoclonal antibody (H53) and IgG from an HIV-1 infected individual (IgG14) as previously described.
(105) Immunoprecipitation with IgG14 indicated that none of the modified single deletion constructs affected processing and virion incorporation of the HIV-1 structural proteins (
(106) E1E2-Mediated Entry into Huh7 Cells
(107) To examine whether these extended linkers conferred E1E2-mediated entry into Huh-7 cells, these modified single deletion constructs were used to generate E1E2-pseudotyped HIV-1 particles to infect Huh7 cells as previously described. As expected, the extended linkers in the HVR1conlink and HVR2link deletion constructs did not recover any entry activity consistent with the observed failure of these mutant E2 glycoproteins to be incorporated into virions or heterodimerise, respectively (
(108) CD81-LEL Binding
(109) To examine whether the intracellular or virion-incorporated E2 glycoproteins containing these extended linkers altered CD81-LEL binding, both cell and viral lysates were applied to a solid phase CD81 MBP-LEL (residues 113-201) binding assay as previously described. This data was normalized for the amount of monomeric E2 expressed from each vector as precipitated with 1153 and observed by SDS-PAGE under non-reducing conditions;
(110) 3. Effect of Multiple Variable Region Deletions on E1E2 Glycoprotein Structure and Function
(111) Intracellular E1E2 Precursor Folding and Heterodimerisation
(112) Despite a loss of heterodimerisation with E1 and/or viral entry, the above findings indicate that HVR1, HVR2 and igVR can be individually deleted from both the intracellular and virion-incorporated E2 glycoprotein without disrupting its intrinsic folding properties as recognised by the conformation-dependent monoclonal antibody H53 and binding to the large extracellular loop (LEL) of the CD81 receptor. In order to further characterise these variable regions and delineate a conserved E2 core domain, multiple deletions were introduced into the E1E2 polyprotein and analysed within 293T cells by pulse-chase metabolic-labelling and immunoprecipitation. Precipitation with the anti-E1E2 polyclonal antibody (779) showed efficient expression and cleavage of E1 (30 kDa) and E2 (70 kDa) glycoproteins from the polyprotein occurring for each of the multiple variable region deletion constructs (
(113) In contrast, the non-conformation dependent anti-E2 monoclonal antibody (A11) did not detect the E2 glycoproteins containing these multiple variable deletions coprecipitating E1 under reducing or non-reducing conditions despite demonstrating wild-type levels of intracellular E2 glycoprotein expression for each of these deletion contructs (
(114) E1E2 Glycoprotein Maturation and Incorporation into Pseudotyped HIV-1 Particles
(115) To examine whether the multiple variable region deletions altered E1E2 glycoprotein maturation, these deletions were introduced into E1E2-pseudotyped HIV-1 particles and lysed prior to immunoprecipitation with the conformation-dependent anti-E2 monoclonal antibody H53 and IgG from an HIV-1 infected individual (IgG14) as previously described.
(116) IgG14 precipitation indicated that none of the multiple variable deletions had affected processing and virion incorporation of the HIV-1 structural proteins (
(117) E1E2-Mediated Entry into Huh7 Cells
(118) As expected, E1E2-pseudotyped HIV-1 particles containing multiple variable region deletions were not competent for entry into Huh7 cells (
(119) CD81-LEL Binding
(120) Despite a loss of heterodimerisation and E1E2-mediated viral entry, both the intracellular and virion-incorporated E2 glycoproteins containing multiple variable region deletions were examined for their ability to bind CD81-LEL by applying both cell and viral lysates to a solid-phase CD81 MBP-LEL (residues 113-201) binding assay as previously described. This data was normalized for the amount of monomeric E2 expressed from each vector as precipitated with H53 and observed by SDS-PAGE under non-reducing conditions;
(121) The intracellular E2 glycoproteins containing multiple variable region deletions all demonstrated wild-type levels of CD81-LEL binding (
(122) The virion-incorporated E2 glycoproteins containing multiple variable region deletions all maintained CD81-LEL binding (
(123) 4. Role of the Variable Regions in E2 Receptor-Binding Domain (E2 RBD.sub.661myc) Structure and Function
(124) Folding and Secretion
(125) The above results demonstrate that the simultaneous deletion of all three variable regions does not disrupt the intrinsic folding of the E2 glycoprotein as recognised by the conformation-dependent monoclonal antibody H53 or binding to the CD81-LEL strongly suggesting that this construct constitutes an E2 core domain. However, in the context of the full-length E2 glycoprotein, the presence of both the transmembrane and membrane-proximal regions would make it difficult to crystallize this core E2 structure. Therefore, both single and multiple variable region deletions were introduced into E2 receptor-binding domain (E2 RBD.sub.661myc) that is both soluble and amenable to high level expression. The E2 RBD.sub.661myc glycoproteins containing single and multiple variable region deletions were metabolically labelled within 293T cells and both the intracellular and secreted protein analysed by immunoprecipitation using the conformation-dependent anti-E2 monoclonal antibody (H53).
(126) H53 precipitated wild-type levels of intracellular E2 RBD.sub.661myc (50 kDa) for all single and multiple deletion constructs indicating that each of these mutant glycoproteins is efficiently expressed (
(127) CD81-LEL Binding
(128) To determine whether the E2 receptor-binding domain containing single and multiple variable region deletions bind to CD81-LEL, both intracellular and secreted E2 RBD.sub.661myc lysates were applied to a solid-phase CD81 MBP-LEL (residues 113-201) binding assay as previously described. This data was normalized for the amount of monomeric E2 expressed from each vector as precipitated with H53 and observed by SDS-PAGE;
(129) Both intracellular and secreted forms of the E2 RBD.sub.661myc containing the single variable region deletions demonstrated CD81-LEL binding although, as observed in the context of the full-length E2 glycoprotein, the HVR1con deletion conferred a total loss of CD81-LEL binding (
(130) 5. Binding of E2 RBD.sub.661 Bearing Simultaneous HVR Deletions to Cell Surface Expressed Full-Length CD81.
(131) The abilities of secreted E2 RBD.sub.661 proteins with multiple HVR deletions to bind cell surface expressed full length CD81 were determined. CHO-K1 cells were transfected with a vector encoding human CD81. Forty-eight hours after transfection, cells were placed on ice, and equivalent amounts of E2 added to cells. Four hours later, bound E2 was detected with radioiodinated MAb 9E10 and the amount of bound E2 quantitated. The results (
(132) 6. Ability of E2 RBD.sub.661 Bearing Simultaneous HVR Deletions to be Recognised by Human Conformation Sensitive Monoclonal Antibodies.
(133) Wildtype E2-myc and E2 123-myc was radiolabelled with .sup.35S-Met/Cys and immunoprecipitated with a panel of human conformation sensitive monoclonal antibodies (Keck et al., 2004) and analysed by non-reducing SDS-PAGE. This panel of conformation-dependent MAbs are specific to conformational epitopes representing three distinct immunogenic domains of E2A, B and C (Keck et al., 2004). The E2 123-myc protein demonstrated a similar immunogenic profile to the wild-type E2-myc protein (
(134) 7. Discussion
(135) In the course of this study, the two recognized E2 variable regions, HVR1 and HVR2, and the novel variable region igVR have been individually deleted to further investigate the role of these regions in E1E2 biosynthesis, heterodimerisation, CD81-binding and viral entry. All E2 glycoproteins containing these variable region deletions were shown to retain the intrinsic folding properties of the wild-type glycoprotein as recognized by the conformation-dependent monoclonal antibody H53. HVR2 and igVR were further shown to be required for heterodimerisation and all three variable regions were required in pre- or post-CD81-binding stages in viral entry. It has also been demonstrated that none of the individual variable regions are required for CD81-binding and that all three can be simultaneously deleted from the E2 glycoprotein with the retention of CD81-binding properties.
(136) The envelope glycoproteins E1 and E2 exhibit the greatest genetic heterogeneity in the HCV genome, especially in hypervariable region 1 (HVR1)a highly variable 27 amino-acid sequence located at the N-terminus of the E2 glycoprotein. Here, it has been demonstrated that deletion of HVR1 (polyprotein residues 387-408) results in a loss of E1E2-mediated entry despite retaining both wild-type levels of heterodimerisation and incorporation of E1E2 into pseudotyped HIV-1 particles suggesting that this region has a direct role in viral entry. However, it has also been shown that HVR1 is not required for CD81-LEL binding in the context of either the functional E1E2 heterodimer or the E2 receptor-binding domain (E2 RBD.sub.661myc) indicating that HVR1 is involved in another pre- or post-CD81-binding stage in viral entry. This is consistent with a previous study that has reported the deletion of HVR1 (polyprotein residues 384-410) to ablate E2 binding to the SR-B1 receptor suggesting that this region may be required for essential SR-B1 contacts in viral entry.
(137) However, the present findings contradict several other studies that have demonstrated HCV pseudotyped particles (HCVpp) lacking HVR1 to mediate entry into Huh7 cells, although at reduced levels, inconsistent with an essential role for this region in viral entry. It has also been reported that the enhancement of HCVpp infectivity observed in the presence of the high density lipoprotein (HDL), a natural ligand of SR-B1, is lost upon the deletion of HVR1. This suggests that HVR1 facilitates infectivity rather than being essential for this function, although whether this effect is due to the association of HCV particles with HDL remains undetermined. In addition, a recent study has found that the substitution of all the conserved basic residues within HVR1 significantly reduces HCVpp entry although these residues were not found to be involved in either CD81-LEL binding or to correlate with an HDL enhancement of SR-B1 binding. Therefore the exact role of HVR1 in viral entry remains unclear.
(138) It has also been shown that the deletion of HVR1 significantly enhances CD81-binding (approximately 4-fold) in agreement with previous studies. This suggests that HVR1 negatively modulates the accessibility of the conserved CD81-binding sites within the E2 glycoprotein despite not being required in this function. This is consistent with the recent identification of a conserved CD81-binding determinant G.sup.436WLAGLFY (SEQ ID NO: 107) located between HVR1 and HVR2. In addition, the broadly neutralizing antibody AP33 has been demonstrated to recognise a conserved epitope directly adjacent to HVR1 (polyprotein residues 412-423) and to inhibit interactions between CD81 and a range of presentations of the E2 glycoprotein. The extension of the HVR1 deletion to include the conserved I.sup.411 residue has also been shown to confer a reduction, rather than an enhancement, in CD81-binding further implicating this region in this function. Similarly, it has been demonstrated that the extension of the HVR1 deletion to include this adjacent conserved region (HVR1con, polyprotein residues 387-428) disrupts E2 glycoprotein folding and maturation critical in the formation of the CD81-binding site. Furthermore it has been demonstrated that residue W.sup.420 located in this conserved region is also involved in CD81 binding
(139) The location of these highly conserved regions adjacent to HVR1, suggests that this highly variable region performs the dual function of both mediating viral entry and modulating the accessibility of these conserved regions to the host immune system to escape recognition by broadly neutralizing antibodies such as AP33. Indeed, a previous study has found that deletion of HVR1 results in an increased sensitivity of the envelope glycoprotein complex to neutralizing antibodies and sera. Therefore, it has been proposed that HVR1 forms a solvent-exposed subdomain external to a conserved core domain of the E2 glycoprotein consistent with both its modulating role in receptor-binding and its elicitation of an immunodominant response. In order to further characterise this proposed conserved core domain, the remaining E2 variable regions, HVR2 and igVR have also been deleted. As observed for the HVR1 deletion, both E2 glycoproteins lacking the individual HVR2 and igVR regions retained the intrinsic folding properties of the wild-type glycoprotein as detected by the conformation-dependent monoclonal antibody H53.
(140) Interestingly, however, both HVR2 and igVR were shown to be required for heterodimerisation and, accordingly, the deletion of these regions demonstrated a total loss of E1E2-mediated entry in to Huh7 cells. This suggests that these regions within the E2 glycoprotein are involved in direct heterodimer contacts or, alternatively, modulate allosteric effects that are indirectly required for this function. Therefore to further investigate the role of these regions, several conserved cysteine-proximal residues were reintroduced into the HVR2 and igVR deletion constructs affecting to extend their linker motifs and thus enhance E2 glycoprotein folding. The extension of the igVR linker was found to recover wild-type levels of heterodimerisation with E1 and a significant level of E1E2-mediated entry (8-fold) although this effect was not observed for HVR2. This finding may reflect the relatively short length of the igVR deletion where two of the five glycine residues lost from this region are further compensated for by the introduction of the Gly-Ser-Ser-Gly linker motif (SEQ ID NO: 95) resulting in only a five amino-acid total deletion within this region. The role of the igVR linker in heterodimerisation is also consistent with its observed conservation within genotypes. Notably, the extended igVR linker construct still exhibited a reduction in entry activity compared to wild-type (10-fold) and is perhaps due to absence of a conserved N-linked glycosylation site within this region that has been previously observed to reduce HCVpp entry.
(141) Furthermore, it has been demonstrated that the E2 glycoprotein containing either the HVR2 or igVR deletions retains wild-type levels of CD81-binding indicating that these regions, as observed in HVR1, are not required in this function. Previous studies have shown that monoclonal antibodies targeting HVR2 inhibit E2 glycoprotein binding to CD81 and proposed that this region forms a CD81-binding determinant although, based on the present findings, it is more likely that these antibodies are creating a steric effect that occludes the G .sup.436WLAGLFY (SEQ ID NO: 107) CD81-binding determinant adjacent to this region. Therefore, despite a loss of heterodimerisation and/or viral entry, HVR1, HVR2 and igVR can all be individually deleted from the E2 glycoprotein without disrupting its intrinsic folding properties and, indeed, it has been further shown that all three variable regions can be simultaneous deleted with a retention of CD81-binding. This strongly supports the hypothesis that these variable regions form solvent-exposed subdomains external to an E2 core domain encompassing the conserved structural and functional determinants required for binding to the confirmed HCV receptor, CD81.
(142) Interestingly, it has also been observed that the E2 glycoproteins containing the HVR1 deletion in combination with either HVR2 or igVR deletions did not exhibit the dramatic enhancement in CD81-LEL binding observed for the individual HVR1 deletion. A previous study has demonstrated that the substitution of HVR1 and HVR2 with corresponding sequences from a different subtype in combination achieves either increased or decreased CD81 binding (depending on the introduced and backbone strains) that is not observed for either of the individual HVR1 or HVR2 substitutions. Together this data suggests that intramolecular interactions are occurring between these regions to modulate CD81-binding and that they are likely to adopt intrinsically flexible structures to entertain these contacts. This is further supported by both the recent identification of a conserved CD81-binding determinant G.sup.436WLAGLFY.sup.443 (SEQ ID NO: 107) located directly between HVR1 and HVR2 as well as the immunodominant responses elicited by both HVR1, and to a lesser extent, HVR2 consistent with their position as surface-exposed subdomains that may perform modulating functions in cell attachment. This same effect observed for the HVR1 and igVR double deletion suggests that the igVR region may also contribute to these cooperative interactions.
(143) One hypothesis to explain this data, proposes that the variable regions form flexible solvent-exposed subdomains that enable the E2 glycoprotein to move between open and closed conformations, the former being more competent for CD81 binding by exposing the conserved CD81-binding determinants located within the core E2 domain as delineated within this study. Indeed, conformational changes within the E2 glycoprotein have been previously observed upon CD81-binding. In addition, binding of non-neutralizing antibodies to the E2 glycoprotein has been demonstrated to reduce its susceptibility to neutralizing antibodies and is consistent with a model where the non-neutralizing antibodies inhibit the flexibility of these surface-exposed variable regions thus blocking access to the conserved epitopes located within the E2 core domain. Therefore, this suggests that the modified E2 core domain represents a promising vaccine candidate for eliciting neutralizing antibodies to conserved epitopes within the E2 glycoprotein, including the CD81-binding determinants, that are otherwise occluded by these surface-exposed variable regions that may act as immunological decoys at the surface of the glycoprotein complex during HCV replication.
(144) The observed loss of heterodimerisation in the E2 glycoproteins containing HVR2 and igVR deletions suggests that conformational changes are occurring within these glycoproteins that cannot be recognised by the single conformation-dependent monoclonal antibody H53. Therefore, a panel of conformation-dependent antibodies that have been previously used to identify the three major immunogenic regions within the E2 glycoprotein were obtained to examine more subtle alterations in glycoprotein structure and function mediated by these variable regions. The results show that in the context of E2 RBD.sub.661myc monoclonal antibodies to domain A, B and C retain wild-type levels of reactivities to the RBD containing simultaneous deletion of all three variable regions. This further suggests that the E2 123-myc123RBD construct retains the intrinsic core domain folding properties of the native E2 RBD.
(145) 8. Materials and Methods
(146) Construction of the Variable Region Deletion Mutants
(147) Vectors
(148) In order to introduce the E2 variable region deletions into the E1E2 heterodimer, the HCV-based expression vector pE1E2H77c was obtained (Drummer et al., 2003). The pE1E2H77c vector contains a DNA sequence from the full length pCV-H77c (genotype 1a) infectious clone (Yanagi et al., 1997) encoding the E1E2 polyprotein residues 165-746 as described (Drummer et al., 2003). To ensure efficient ER targeting and glycoprotein cleavage, this sequence includes the E1 signal peptide located at the C-terminus of the immature core protein and both the full-length E1 and E2 polyprotein sequences (
(149) The CD81 open reading frame was amplified by PCR from pcDM8-TAPA-1 (Levy et al., 1998)30) using the primers, 5-CCGAAGCTTCCACCATGGGAGTGGAGGGCTGC-3 and 5-GGCTCTAGATTAGTACACGGAGCTGTTCCG-3. The PCR product was cloned into pcDNA3 using HindIII and XbaI (shown in bold type) to generate the plasmid pcDNA3-CD81.
(150) To enable characterisation of the variable regions within the soluble E2 receptor-binding domain (E2 RBD.sub.661), the HCV-based expression vector pE2661 was also obtained (Drummer et al., 2002). The pE2661 vector contains a pCV-H77c DNA sequence encoding HCV polyprotein residues 384-661 as described (Drummer et al., 2006)2002). This sequence encodes an independently folding subdomain of the E2 glycoprotein that has been shown to retain both CD81 and SR-B1 receptor-binding (Pileri et al., 1998, Scarselli et al., 2002, Pileri et al., 1998). This DNA product was cloned into a pCDNA3 vector (Invitrogen) backbone at the C-terminus of a tissue plasminogen-activator (tpa) leader sequence designed to ensure efficient ER targeting and signal cleavage of the E2 RBD.sub.661 in the absence of E1 (E2-myc). This vector also contains a CMV promoter for expression in mammalian cells and an ampicillin resistance gene to facilitate selection in bacterial cells.
(151) Overlap Extension PCR
(152) Overlap extension PCR is a two step strategy that facilitates the deletion of large segments of DNA (
(153) E1E2 Variable Region Deletion Constructs
(154) The overlap extension PCR strategy was used to generate the single variable region deletions as summarized in Table 5 and represented in
(155) To enhance E2 glycoprotein folding, a second series of modified single variable region deletion constructs were generated using overlap extension PCR (
(156) In order to delineate a minimal E2 core domain, multiple HVR1, HVR2 and igVR deletions were introduced into the context of the E1E2 polyprotein as represented in
(157) E2 RBD.sub.661myc Variable Region Deletion Constructs (E2-myc)
(158) In order to characterise the single and multiple variable region deletions in the context of the soluble E2 receptor-binding domain (E2 RBD.sub.661myc), standard PCR was used to amplify polyprotein residues 384 to 661 from the full-length E1E2 constructs containing the single and multiple variable region deletions as outlined in Table 4 and represented in
(159) All PCR reactions were carried out in the Biometra Thermocycler (Biometra, Goettingen, Germany) using the Expand High Fidelity PCR system (Invitrogen) under the conditions summarized in Table 6.
(160) Agarose-Gel Electrophoresis
(161) DNA products were isolated by agarose-gel electrophoresis using Bio-Rad gel tanks (Bio-Rad Laboratories, Hercules, Calif., USA) containing TAE (0.001M EDTA and 0.04M Tris-Acetate). 1% (w/v) DNA-grade agarose in TAE was made up with ethidium bromide (0.5 g/mL) to enable DNA visualization under UV light (Sambrook and Russel, 2001). DNA samples were made up at 20% (v/v) with Orange G gel-loading dye (1% (w/v) Orange G (Sigma, St Louis, Mo., USA), 50% (v/v) glycerol). Agarose gels were run at 100V, 23 mA for 30-40 min and DNA fragment size was confirmed and quantified using the GelDOC system (Bio-Rad) in reference to a 1 kb Plus DNA Marker (Invitrogen). Confirmed DNA products were subsequently purified from PCR reactions using the Mo Bio PCR Clean-up kit (Mo Bio, Carlsbad, Calif., USA) or from agarose gels with the Mo Bio Gel-Spin kit (Mo Bio) according to the manufacturer's instructions.
(162) Restriction Endonuclease Digestion of DNA
(163) All DNA was digested with New England Biolabs restriction endonucleases according to the manufacturer's instructions (New England Biolabs, Ipswich, Mass., USA). Any digested vectors were de-phosphorylated with Shrimp Alkaline-phosphatase (Invitrogen) for 30 min at 37 C. to reduce self-annealing.
(164) Ligation and Transformation of Plasmid Constructs
(165) Digested insert and vector DNA were ligated together at approximately a 4:1 ratio using the T4 DNA-ligase system (Invitrogen) and incubated at 4 C. for 16 hrs. DNA ligation products were isolated using the sodium-acetate precipitation method (3M Na-Acetate pH 5 and 100% Ethanol) (Sambrook and Russel, 2001) and resuspended for 1 hr in sterile distilled water. Ligation products were transformed into 20 uL of electroporation-competent DH10B E. coli cells (New England Biolabs) using 1 mm electroporation cuvettes (BTX, Holliston, Mass., USA) and a Gene Pulser Electroporator (BioRad) set at 2.0V, 200 and 25 F. The electro-treated DH10B cells were then transferred into Luria Bertani Medium (LB) (1% (w/v) Tryptone, 0.5% (w/v) Yeast Extract, 0.5% (w/v) NaCl) to recover for 1 hr at 37 C. The cells were then spread-plated out onto LB-Agar plates (LB, 5% (w/v) Agar) containing 50 ug/mL ampicillin and incubated at 37 C. for 16 hrs to select for transformed cells (Sambrook and Russel, 2001).
(166) Colony PCR
(167) In order to rapidly screen for transformed colonies containing the desired DNA insert, approximately 20 colonies were selected from each LB-Agar plate for colony PCR (Sambrook and Russel, 2001). Colony PCR was performed using the Taq polymerase system (Invitrogen) and the appropriate external primers in the Biometra Thermocycler (Biometra) under the conditions specified in Table 6. The colonies containing positive inserts were identified by agarose-gel electrophoresis as described above.
(168) Small-Scale Preparation of Plasmid DNA
(169) Small-scale preparations of plasmid DNA from positive colonies were then generated using the Mo Bio Mini-prep kit (Mo Bio) using the alkaline lysis method in accordance with the manufacturer's specifications. Inserts were confirmed by restriction endonuclease digest and agarose-gel electrophoresis as described above.
(170) DNA Sequencing
(171) The sequences of all plasmid DNA inserts were confirmed using the relevant sequencing primers and the PRISM BigDye Terminator Mix (version 3.1) (Applied Biosystems, Foster City, Calif., USA) according to the Micromon Reaction Set-Up Protocol (Micromon, Victoria, Australia). All sequencing reactions were run in a Biometra Thermocycler (Biometra) under the conditions outlined in Table 6 and the resulting DNA prepared according to the Micromon Reaction Clean-Up Protocol (Micromon). Sequence analysis was performed in a 3730S Genetic Analyser (Applied Biosystems) at the Micromon sequencing facility.
(172) Large-Scale Preparation and Quantification of Plasmid DNA
(173) Plasmid DNA from confirmed clones was then isolated on a larger scale using the Qiagen Midi-prep Kit (Qiagen, Hilden, Germany) based on the alkaline lysis method in accordance with the manufacturer's specifications. These large scale plasmid DNA preparations were purified using phenol-chloroform (1:1) and centrifuged at 10 000g for 3 min to obtain an upper phase containing the DNA and repeated with chloroform (50% (v/v)). Purified DNA was concentrated using sodium-acetate (10% (v/v) and 2.5 volumes of 100% ethanol at 70 C. for 30 min. DNA was pelleted at 10 000g for 15 mins prior to washing twice in 70% precipitation method and resuspended in 100 uL of TE. All DNA concentrations were determined using a Biophotometer at 260 nm (Eppendorf, Hamburg, Germany).
(174) During this study, all bacterial work utilised an orbital-shaker (Ratek Instruments, Victoria, Australia) or an incubator (Memmet, Schwabach, Germany) set at 37 C.
(175) Biochemical and Functional Assays
(176) Cell Culture
(177) 293T human embryo kidney cells (HEK 293T) from a human fibroblast cell line was used in this study to ensure high transfection efficiency and to achieve good levels of cellular protein expression. The human liver hepatocyte is the primary target cell for HCV and thus the human hepatocellular carcinoma cell line, Huh7, was used as a model liver cell system in this study. Furthermore, the Huh7 cell line has been demonstrated to support subgenomic HCV replicons, is highly permissive to HCVpp entry and can support cell culture grown HCV (HCVcc) suggesting that it contains all the cellular factors required for HCV tropism in vivo (ZhongBartosch et al., 2005, Wakita et al., 20052003a, Lindenbach et al., 2005b, Lohmann et al., 1999, LindenbachWakita et al., 2005a, Zhong et al., 2005, Bartosch et al., 2003a).
(178) All cells were maintained in DMF10: Dulbecco's minimal essential medium (Invitrogen), 10% (v/v) heat-inactivated foetal bovine serum (Invitrogen), 2 mM L-glutamine (GE Healthcare, Bukinghamshire, UK), 1M HEPES buffer solution (Invitrogen), Gentamycin (GE Healthcare) and 2 ug/mL minocycline-hydrochloride salt (Sigma). The cells were subcultured every 3-4 days in 75 cm.sup.2 or 150 cm.sup.2 Falcon flasks (Becton Dickenson, Franklin Lakes, N.J., USA) using 0.025% (v/v) Trypsin in PBS-EDTA (phosphate buffered saline (PBS)-ethylenediaminetetraacetic acid (EDTA)) to detach the monolayer. All cells were incubated in a Thermo Direct Heat CO.sub.2 incubator at 37 C. with 5% CO.sub.2 (Thermo, Waltham, Mass., USA). During this study, all vectors were transfected into HEK 293T cells seeded in 6-well culture dishes (Nalge Nunc, Rochester, N.Y., USA) using the FuGene6 transfection reagent (Roche) as previously described (Drummer et al., 2003).
(179) Antibodies
(180) The non-conformational anti-E1 monoclonal antibody A4 and non-conformational anti-E2 monoclonal antibody A11 were gifts from Drs. Jean Dubuisson and Harry Greenberg (Dubuisson et al., 1994). The anti-E2 conformation-dependent monoclonal antibody, H53, was also a gift from Dr. Jean Dubuisson (Deleersnyder et al., 1997). The anti-E1E2 polyclonal antibody, 779, purified from the plasma of an HCV genotype 1a-infected individual was obtained (Drummer and Poumbourios, unpublished). Immunoglobulin G from an HIV-1 infected individual (IgG14) and the anti-myc monoclonal antibody 9E10 were also obtained (Drummer et al., 2002, Drummer et al., 2003). A panel of conformation-dependent human MAbs, specific to conformational epitopes representing three distinct immunogenic domains of E2 A, B and C, were obtained from Dr. Steven Foung (Keck et al., 2004).
(181) E1E2 Pseudotyped HIV-1 Particle Entry Assay
(182) The incorporation and display of functional HCV envelope glycoproteins by heterologous retro- or lentiviral core particles, called pseudotyping, provides a relatively rapid and simple method for characterising mutant E1E2 glycoproteins without introducing these mutations into the full-length HCV genome (Drummer et al., 2003, Bartosch et al., 2003b)2003a, Drummer et al., 2003). This strategy involves the co-transfection of both an E1E2 expression vector and a retroviral or lentiviral expression vector lacking its native envelope gene and containing a reporter construct (
(183) 293T cells were seeded at 350 000 cells/well in 6-well culture dishes (Nalge Nunc) and co-transfected with 1 ug of NL4-3.LUC.R.sup.E.sup. and 1 ug of either pE1E2H77c (wild-type), pHVR E1E2 or the empty pCDNA4HisMax vector (negative control). After three days incubation, the tissue culture fluid containing E1E2-pseudotyped HIV-1 particles was collected and filtered using Minisart 0.45 um sterile syringe filters (Sartorius, Goettingen Germany). The filtered product was then used to infect Huh-7 cells seeded at 30 000 cells/well in 48-well culture plates (Nalge Nunc) in triplicate. Following 4 hr incubation at 37 C., the innoculum was removed and the cells cultured in DMF10 for a further 3 days before being lysed with cell culture lysis reagent (Promega, Madison, Wis., USA). Cell lysates were clarified of cellular debris prior to being transferred into white 96-well plates (BMG Labtech, Offenburg, Germany) to be analysed for luciferase activity using the Steady-Glo luciferase reagent system (Promega) and a Fluostar (BMG Labtech) fitted with luminescence optics. The average luciferase activity (relative light units) was calculated from triplicate infections and the standard deviation calculated accordingly.
(184) Radioimmunoprecipitation (RIP)
(185) Radiolabelling
(186) In order to analyse the role of the variable regions in intracellular E1E2 biosynthesis, 293T cells seeded at 500 000 cells/well in 6-well culture dishes (Nalge Nunc) were transfected with 2 ug of either pE1E2 (wild-type), pE1E2 containing one or more variable region deletions or empty pCDNA4 vector (negative control). 24 hours post-transfection, cells were pulse-chase metabolically labelled for 30 min at 37 C. with 150 Ci Trans-.sup.35S-label/well (Santa Cruz Biotechnology, Santa Cruz, Calif., USA) in L-cysteine and L-methionine deficient DMF10: DMEM (MP Biomedicals), 10% (v/v) heat-inactivated fetal bovine serum (Invitrogen) and 2 mM L-glutamine (GE Healthcare). The cells were then chased for 4 hrs in DMF10 at 37 C. prior to being washed in PBS and lysed in RIP lysis buffer (0.6 M KCl, 0.05 M Tris pH 7.4, 1 mM EDTA, 0.02% sodium azide, 1% Triton X-100). The cell lysates were clarified of any remaining cell debris by centrifugation for 10 min at 4 C. in a refrigerated bench-top centrifuge (Heraeus, Hanau, Germany).
(187) To enrich for mature E1E2 heterodimers as incorporated into pseudotyped HIV-1 particles, 293T cells seeded at 350 000 cells/well in 6 well-culture dishes were transfected with 1 ug of pNL4-3.LUC.RE plus 1 ug of either pE1E2 (wild-type), pE1E2 containing one or more variable region deletions or empty pCDNA4 vector (negative control). 24 hrs hours post-transfection, the cells were metabolically labelled with 75 Ci Trans-.sup.35S label/well (Santa Cruz Biotechnology) in L-cysteine and L-methionine deficient DMF10 for 16 hrs at 37 C. The tissue culture fluid was then collected and filtered through a Minisart 0.2 um syringe filter (Sartorius) prior to being enriched for virions through a sucrose gradient (25% sucrose (v/v) in PBS) using the Beckman L-90 ultracentrifuge (SW41 rotor, Beckman Coulter, Fullerton, Calif., USA) at 25 000g for 2 hrs at 4 C. The supernatant was removed prior to lysis of the virions in RIP lysis buffer.
(188) To characterise the role of the variable regions in the context of the E2 receptor-binding domain (E2 RBD.sub.661myc), metabolically labelled 293T cells seeded at 350 000 cells/well in 6-well culture dishes (Nalge Nunc) were transfected with 2 ug of either the E2-myc (wild-type), E2-myc containing one or more variable region deletions por empty pCDNA3 vector (negative control). 6 hrs post-transfection, cells were pulse-chase metabolically labelled with 75 Ci Trans-.sup.35S-label/well (Santa Cruz Biotechnology) for 1 hr at 37 C. and chased in OptiMEM serum reduced media (Invitrogen) for 16 hrs to accumulate secreted protein. This tissue culture fluid was then collected and lysed in RIP lysis buffer prior to clarification by centrifugation at 10,000g at 4 C. The cell monolayer was also washed in PBS, lysed in RIP lysis buffer and clarified as described above.
(189) Immunoprecipitation
(190) Radioimmunoprecipitation was used as a conformational-sensitive strategy to analyse protein expression. All protein preparations above were pre-cleared with Sepharose (GE Healthcare) coupled to BSA (Sigma) in the presence of the relevant antibody for 16 hrs at 4 C. The BSA-Sepharose was pelleted at 8 000g for 10 min to remove any non-specific protein species. The supernatant containing antibody-bound proteins was then precipitated using 30% (v/v) Protein-G Sepharose (GE Healthcare) in RIP lysis buffer for 1 hr at room temperature and isolated by centrifugation as above prior to washing three times in RIP wash buffer (0.5 M NaCl, 0.05 M Tris pH 7.4, 1 mM EDTA, 0.02% sodium azide and 1% Triton-X 100) and once in PBS.
(191) SDS-Polyacrylamide Gel Electrophoresis (SDS-PAGE) Protein Separation and Analysis
(192) All immunoprecipitates were resuspended in sample loading buffer (0.5 M Tris pH 6.8, 5% (v/v) SDS, 10% (v/v) glycerol, 0.05% (w/v) bromophenol blue). Intracellular lysates were run under either reducing (+3% (v/v) -mercaptoethanol) or non-reducing conditions (no -mercaptoethanol) to identify non-covalently associated E1E2 species within the large amounts of intracellular covalently-linked E1E2 aggregate as previously observed (Dubuisson et al., 1994). Metabolically-labelled virion-incorporated E1E2 in viral lysates were run under non-reducing conditions, while the HIV-1 structural proteins were run under reducing conditions. All samples were denatured at 100 C. for 5 min prior to separation on 10-15% SDS-PAGE polyacrylamide gradient gels (except IgG14 samples that were separated on a 7.5-15% gradient) using the Miniprotean II SDS-PAGE system (BioRad) in reference to a pre-stained broad-range protein marker (BioRad). Electrophoresis was conducted at 100V, 23 mA for 1.5 hrs in 1 electrode buffer (0.2M Tris-HCl and 2M Glycine). The SDS-PAGE gels were then submerged in 10% (v/v) acetic acid and 10% (v/v) methanol to fix the samples prior to drying at 80 C. using a vacuum slab-gel dryer (Hoefer Scientific, San Francisco, Calif., USA). The broad-range marker positions were marked with .sup.35S-Trans label (Santa Cruz Biotechnology) prior to protein analysis and quantification using the FLA-2000 Phosphoimager and Software (Fuji Film, Tokyo, Japan).
(193) Solid-Phase CD81-LEL Binding Assay
(194) The large extracellular loop of CD81 has been demonstrated to be sufficient to mediate E2 glycoprotein binding (Pileri et al., 1998, Petracca et al., 2000, Pileri et al., 1998) and contains all the residues that form the E2 interaction site and contains all the residues that form the E2 interaction site (Drummer et al., 2002). Therefore, to rapidly screen for the CD81-LEL binding ability in the variable region deletion mutants, we used a solid-phase binding assay constructed using a chimera composed of the maltose-binding protein (MBP) linked to the CD81 large-extracellular loop residues 113-201 (MBP-LEL) as previously described (Drummer et al., 2002).
(195) Briefly, 96-well maxisorb enzyme linked immunosorbant plates (Nalge Nunc) were coated with 5 ug/mL of dimeric CD81 MBP-LEL in PBS and incubated for 16 hrs at 4 C. The MBP-LEL was removed prior to blocking with BSA.sub.10PBS (10 mg/mL BSA (Sigma) in PBS) for 2 hrs at 37 C. to reduce non-specific binding. The plates were then washed four times in PBST (0.05% Tween-20 (Sigma) in PBS) prior to the addition of all the protein lysate preparations at twelve two-fold serial dilutions in BSA.sub.5PBST (5 mg/mL BSA in PBST). Plates were incubated for 2 hrs at room temperature, washed again, and probed for bound E2 with the conformation-dependent anti-E2 monoclonal antibody H53 for 1 hr (1:1000 dilution in BSA.sub.5PBST). After further washing in PBST, the antibody-bound E2 complexes were detected using a rabbit anti-mouse immunoglobulinhorseradish peroxidise conjugate (DAKO) (1:1000 dilution in BSA.sub.5PBS/Tween) and developed with a tetra-methylbenzidine substrate (Sigma) according to the manufacturer's instructions. The resulting absorbance values (optical density) were read at 450 nm-620 nm (background) on the Fluostar (BMG technologies). This data was then normalized against monomeric E2 as detected by conformation-dependent antibody H53, visualized and quantified in the previous sections.
(196) E2.sup.Myc-CD81 Cell Surface-Binding Assays.
(197) CHO-K1 cells were seeded in 12-well culture plates at 1.2510.sup.5 cells/well and transfected with 2 g pcDNA3-CD81 24 h later. At 48-h post transfection the CD81 transfected CHO-K1 cells were chilled on ice and incubated with serial dilutions of wild-type or E2-myc protein containing variable region deletions in BSA.sub.10PBS for 4 h on ice. The cells then were washed twice in BSA.sub.10PBS prior to a 1 h incubation with .sup.125I-MAb 9E10 (10.sup.6 cpm) that had been precleared with 10.sup.7 CHO-K1 cells for 2 h on ice. After 4 further washes with BSA.sub.10PBS, the cells were lysed in 1% SDS in PBS and counted in a Packard Auto-Gamma counter.
(198) TABLE-US-00001 TABLE 1 Summary of results obtained for variable region deletion constructs in both the context of the E1E2 polyprotein and the E2 receptor-binding domain constructs containing a myc epitope tag (E2 -myc). Heterodimeriza- H53 CD81-LEL Heterodimeriza- H53 Viral CD81-LEL Deletion tion .sup.1 Recognition Binding .sup.2 tion .sup.1 Recognition Entry .sup.3 binding .sup.2 Polyprotein Mutant Intracellular E1E2 precursors Mature virion-incorporated E1E2 pE1E2 Wild-type + + + + + + + pE1E2 1 HVR1 + + ++ + + ++ pE1E2 1con HVR1 + conserved + + reduced region pE1E2 2 HVR2 + ++ + + pE1E2 3 igVR + ++ + + pE1E2 1 HVR1 + conserved + + +/ reduced conlink region with extended linker pE1E2 2 HVR2 with + ++ + + link extended linker pE1E2 3 igVR with extended + + ++ + + +/ + link linker pE1E2 12 HVR1 and 2 + + + + pE1E2 13 HVR1 and igVR + + + + pE1E2 23 HVR2 + igVR + ++ + + pE1E2 123 HVR1, HVR2 + + + + ++ igVR E2 RBD Mutant Intracellular E2 RBD.sub.661myc Secreted E2 RBD.sub.661myc E2-myc Wild-type + + + + E2 1-myc HVR1 + ++ + ++ E2 1con- HVR1 + conserved + + myc region E2 2-myc HVR2 + +/ + + E2 3-myc igVR + +/ + + E2 12-myc HVR1 and 2 + +/ + E2 13-myc HVR1 and igVR + + + ++ E2 23-myc HVR2 + igVR + + + + E2 123-myc HVR1, HVR2 + + ++ + + igVR .sup.1 + represents heterodimerization levels similar to wild-type E1E2. represents no heterodimerization detected. +/ represents reduced heterodimerization relative to wild-type E1E2. .sup.2 + represents CD81-LEL binding levels similar to wild-type E1E2. represents no CD81-LEL binding detected. +/ represents reduced CD81-LEL binding relative to wild-type E1E2. ++ enhanced binding relative to wild-type. .sup.3 + represents viral entry at levels similar to wild-type E1E2. represents no detectable viral entry. +/ represents partially entry competent.
(199) TABLE-US-00002 TABLE2 SummaryoftheoverlapextensionPCRstrategyusedtointroducemodifiedsinglevariableregiondeletionswithlinker sequencesintotheHCVE1E2polyprotein. Round1 PCR Insert pE1E2 Template PCR RE Epitope product size MW construct Vector Product ExternalPrimer InternalPrimer Site Tag (bp) (bp) (Da) pE1E2 pE1E2H77c 5 5 ggtggaattctggcaacagggaaccttcct 5 gctttcattgcaattcaaggccgtGCC EcoR none 716 1563 36482 1conlink gg3 GCTACTACCgtgggtttccgcgtcgac I 3 pE1E2H77c 3 5 ccgtctagattacgcctccgcttgggatat 5 GGTAGTAGCGGCacggccttgaat XbaI none 993 gag3 tgcaatgaaagccttaacacc3 pE1E22link pE1E2H77c 5 5 ggtggaattctggcaaccgggaaccttcct 5 gtagtgtccagcagtagggGCCGCT EcoR none 938 1614 38071 gg3 ACTACCaaggcgtcggcagctggcca I acctctc3 pE1E2H77c 3 5 ccgtctagattacgcctccgcttgggatat 5 GGTAGTAGCGGCccctactgctgg XbaI none 816 gag3 cactaccctccaagaccttgtggc3 pE1E23link pE1E2H77c 3 5 ggtggaattctggcaacagggaaccttcct 5 gcaatcagtggggcagagcaaGCC XbaI none 1268 1656 39963 gg3 GCTACTACCgatgacacaagggggcgc tccgcacac3 pE1E2H77c 3 5 ccgtctagattacgcctccgcttgggatat 5 GGTAGTAGCGGCttgctctgcccc XbaI none 531 gag3 actgattgcttccgc3 Capitalised and underlined primer sequences represent the introduced GlySerSerGly linker motif and restriction endonuclease sites, respectively.
(200) TABLE-US-00003 TABLE3 SummaryoftheoverlapextensionPCRstrategyusedtointroducemultiplevariableregiondeletions intotheHCVE1E2polyprotein. Tem- Round1 PCR In- pE1E2 plate PCR Epi- pro- sert con- Vec- Pro- RE tope duct size MW struct tor duct ExternalPrimer InternalPrimer Site Tag (bp) (bp) (Da) pE1E2 pE1E2 5 5 ggtggaattctggcaacagggaac 5 ttggatgttctgGCCGCT EcoRI none 704 1545 35697 12 2 cttcctgg3 ACTACCgtgggtttccgcgtc gac3 pE1E2 3 5 ccgtctagattacgcctccgcttg 5 GGTAGTAGCGGCcagaac XbaI none 981 2 ggatatgag3 atccaactgatcaacacc3 pE1E2 pE1E2 5 5 ggtggaattctggcaacagggaac 5 ttggatgttctgGCCGCT EcoRI none 704 1590 37566 13 3 cttcctgg3 ACTACCgtgggtttccgcgtc gac3 pE1E2 3 5 ccgtctagattacgcctccgcttg 5 GGTAGTAGCGGCcagaac XbaI none 1041 3 ggatatgag3 atccaactgatcaacacc3 pE1E2 pE1E2 5 5 ggtggaattctggcaacagggaac 5 gtagtgccagcaGCCGCT EcoRI none 932 1578 36561 23 3 cttcctgg3 ACTACCgcagctggccaacct ctc3 pE1E2 3 5 ccgtctagattacgcctccgcttg 5 GGTAGTAGCGGCtgctgg XbaI none 810 3 ggatatgag3 cactaccctccaagaccttgt ggc3 pE1E2 pE1E2 5 5 ggtggaattctggcaacagggaac 5 gcaatcagtggggcaGCC EcoRI none 1256 1524 34962 123 12 cttcctgg3 GCTACTACCacaagggggcgc tccgcaca3 pE1E2 3 5 ccgtctagattacgcctccgcttg 5 GGTAGTAGCGGCtgcccc XbaI none 525 12 ggatatgag3 actgattgcttccgc3 Capitalized and underlined primer sequences represent the introduced GlySerSerGly linker motif and restriction endonuclease sites, respectively.
(201) TABLE-US-00004 TABLE4 SummaryofthestandardPCRstrategyusedtoconstructsingleandmultiplevariableregiondeletions intotheE2receptor-bindingdomain(residues384-661). E2- Tem- In- myc plate Epi- sert con- Vec- RE tope Size MW struct tor Externalsenseprimer Externalanti-senseprimer Sites Tag (bp) (Da) E2 pE1E2 5 ccagctagcgaaacccac 5 ccgtctagactaattcagatcctcttctgagat NheI/ myc 783 29,385 1con- 1con ggtagtagcggc3 gagtttttgttcagtactctcggactgtccct XbaI myc gtc3 E2 pE1E2 5 caagctagcgaaacccac 5 ccgtctagactaattcagatcctcttctgagat NheI/ myc 843 31,623 1- 1 ggtagtagcggc3 gagtttttgttcagtactctcggacctgtccct XbaI myc gtc3 E2 pE1E2 5 ccagctagcgaaacccac 5 ccgtctagactaattcagatcctcttctgagat NheI/ myc 831 31,282 2- 2 gtcaccgggggaaatgc3 gagtttttgttcagtactctcggacctgtccct XbaI myc gtc3 E2 pE1E2 5 caagctagcgaaacccac 5 ccgtctagactaattcagatcctcttctgagat NheI/ myc 876 33,139 3- 3 gtcaccgggggaaatgc3 gagtttttgttcagtactctcggacctgtccct XbaI myc gtc3 E2 pE1E2 5 caagctagcgaaacccac 5 ccgtctagactaattcagatcctcttctgagat NheI/ myc 777 28,865 12- 12 ggtagtagcggc3 gagtttttgttcagtactctcggactgtccct XbaI myc gtc3 E23 pE1E2 5 caagctagcgaaacccac 5 ccgtctagactaattcagatcctcttctgagat NheI/ myc 822 30,624 13- 13 ggtagtagcggc3 gagtttttgttcagtactctcggacctgtccct XbaI myc gtc3 E2 pE1E2 5 ccagctagcgaaacccac 5 ccgtctagactaattcagatcctcttctgagat NheI/ myc 811 30,381 23- 23 gtcaccgggggaaatgc3 gagtttttgttcagtactctcggacctgtccct XbaI myc gtc3 E2 pE1E2 5 caagctagcgaaacccac 5 ccgtctagactaattcagatcctcttctgagat NheI/ myc 756 27,964 123- 123 ggtagtagcggc3 gagtttttgttcagtactctcggacctgtccct XbaI myc gtc3 Underlined primer sequences represent introduced restriction endonuclease sites.
(202) TABLE-US-00005 TABLE5 SummaryoftheoverlapextensionPCRstrategyusedtointroducesinglevariableregiondeletions intotheHCVE1E2polyprotein. Tem- Round1 PCR In- pE1E2 plate PCR Epi- pro- sert con- Vec- Pro RE tope duct site MW struct tor duct ExternalPrimer InternalPrimer Site Tag (bp) (bp) (Da) pE1E2 pE1E2- 5 5 ggtggaattctggcaaca 5 gctttcattgcaGCCGCTACT EcoRI none 704 1551 36083 1con H77c gggaaccttcctgg3 ACCgtgggtttccgcgtcgac3 pE1E2- 3 5 ccgtctagattacgcctc 5 GGTAGTAGCGGCtgcaatgaa XbaI none 981 H77c cgcttgggatatgag3 agccttacaccc3 pE1E2 pE1E2- 5 5 ggtggaattctggcaaca 5 GGTAGTAGCGGCcagacatc EcoRI none 704 1611 38301 1 H77c gggacccttcctgg3 caactgatcaacacc3 pE1E2- 3 5 ccgtctagattacgcctc 5 GGTAGTAGCGGCcagaacatc XbaI none 1041 H77c cgcttgggatatgag3 caactgatcaacacc3 pE1E2 pE1E2- 5 5 ggtggaattctggcaaca 5 gtagtgccagcaGCCGCTACT EcoRI none 932 1599 37386 2 H77c gggaaccttcctgg3 ACCgcagctggccaacctctc3 pE1E2- 3 5 ccgtctagattacgcctc 5 GGTAGTAGCGGCtgctggcac XbaI none 810 H77c cgcttgggatatgag3 tatcctccaagaccttgtggc3 pE1E2 pE1E2- 5 5 ggtggaattctggcaaca 5 gcaatcagtggggcaGCCGCT EcoRI none 1256 1644 39255 3 H77c gggaaccttcctgg3 ACTACCacaagggggcgctcctca cac3 pE1E2- 3 5 ccgtctagattacgcctc 5 GGTAGTAGCGGCtgccccact XbaI none 525 H77c cgcttgggatatgag3 gattgcttccgc3 Capitalized and underlined oligonucleotide sequences represent the introduced GlySerSerGly linker motif and restriction endonuclease sites, respectively.
(203) TABLE-US-00006 TABLE 6 Polymerase chain reaction (PCR) amplification reaction conditions. Overlapping: Round 1 95 C. 2 min 92 C. 30 sec 65 C. 30 sec {close oversize brace} X 29 72 C. 2 min 72 C. 10 min Overlapping: Round 2 95 C. 2 min 92 C. 30 sec 55 C. 30 sec {close oversize brace} X 29 72 C. 4 min 72 C. 10 min Standard 95 C. 2 min 92 C. 30 sec 55 C. 30 sec {close oversize brace} X 29 72 C. 2 min 72 C. 10 min Colony 94 C. 2 min 94 C. 30 sec 55 C. 30 sec {close oversize brace} X 29 72 C. 1 min 72 C. 10 min Sequencing 96 C. 1 min 96 C. 20 sec 50 C. 15 sec {close oversize brace} X 29 60 C. 4 min 4 C. 10 min
EXAMPLE 2
1. Antigenic Structure of E2-Myc and E2 123-myc Probed with a Panel of Sera Obtained from HCV-Infected Individuals
(204) A panel of sera obtained from HCV-infected individuals was used to compare the global antigenic profiles of biosynthetically labeled E2-myc and E2 123-myc by immunoprecipitation. The sera were screened for the presence of neutralizing antibodies towards H77c E1E2 pseudotyped retroviral particles as described previously (Grollo et al., 2006), with 50% neutralization titers ranging from 0 to 1,600 observed (Figure. 24, lower panel). The antibody reactivity pattern of E2-myc (
2. CD81 Binding Properties of E2-myc Wild Type and Variant Proteins
(205) The abilities of the secreted E2-myc proteins to interact with the large extracellular loop (LEL) of the HCV cellular receptor CD81 was examined. In this assay, CD81-E2-myc binding was detected using a conformation-dependent E2 monoclonal antibody (H53) in an ELISA employing solid-phase maltose binding protein fused to the large extracellular loop of CD81 (residues 113-201; CD81-LEL). E2-myc proteins containing one or more deletions of the variable regions displayed wild-type levels of CD81-LEL binding, again indicating that the E2 global fold was not detectably affected by the deletions (
3. Abilities of E2-myc Wild Type and Variant Proteins to Interact with Full-Length CD81 Expressed in CHO-K1 Cells
(206) The abilities of E2-myc proteins to interact with full-length CD81 receptor were determined by a cell surface binding assay using CHO-K1 cells transfected with a full-length CD81 expression vector as previously described (Drummer et al., 2002). The secreted E2-myc wild type and variant proteins were serially diluted and incubated with CD81-transfected CHO-K1 cells on ice. After washing, the bound E2-myc proteins were detected by using .sup.125I-labeled monoclonal antibody 9E10, directed to the C-terminal c-myc epitope tag. The specificity of the assay was confirmed by the lack of binding by E2 L441M-myc, containing the L441M CD81 binding site mutation, to wild-type-CD81-transfected CHO-K1 cells (
(207) The results shown in
(208) Although variations in binding to recombinant CD81-LEL for singly and multiply deleted E2-myc constructs were not detected in
4. Materials and Methods
(209) Neutralization Assays
(210) The abilities of immune and control human sera to neutralize a single cycle of infection by HCV glycoprotein-pseudotyped HIV-1 luciferase reporter viruses were determined as follows. HCV glycoprotein-pseudotyped HIV-1 luciferase reporter viruses were prepared by cotransfection of HEK-293T monolayers (350,000 cells per well of 6-well culture dishes) with pE1E2 and pNL4.3LUCRE plasmids (Drummer et al., 2003). After 3 days incubation at 37 C. in a humidified atmosphere containing 5% CO.sub.2, the culture supernatants were filtered through 0.45 m sterile syringe filters (Sartorius). Serial dilutions of heat-inactivated immune and control human sera were preincubated with HCV glycoprotein-pseudotyped HIV-1 luciferase reporter viruses (1 h) and then added to quadruplicate Huh7 cell monolayers in 48-well tissue culture plates. Following a 4 h incubation (37 C., 5% CO.sub.2) the cells were washed with PBS and fresh medium replaced. After an additional 3-day incubation (37 C. in 5% CO.sub.2), the cells were lysed, the lysates clarified by centrifugation and then assayed for luciferase activity (Promega) in a Fluostar (BMG) fitted with luminescence optics. The neutralization titres of individual sera were determined as the serum dilution giving 50% neutralization compared to HCV glycoprotein-pseudotyped HIV-1 luciferase reporter virus preincubated with medium alone.
(211) Radioimmunoprecipitation.
(212) 293T cells seeded at 500,000 cells/well in 6-well culture dishes were transfected with E2-myc expression vectors using Fugene 6 (Roche). At 24 hours post-transfection, the cells were labelled with 150 Ci Trans-.sup.35S-label/well (Santa Cruz Biotechnology, Santa Cruz, Calif., USA) in L-cysteine and L-methionine deficient DMF10 (DMEM [MP Biomedicals], 10% (v/v) heat-inactivated fetal bovine serum [Invitrogen] and 2 mM L-glutamine [GE Healthcare]). After harvesting the cell supernatent, the labelled secreted proteins were adjusted to 0.6 M KCl, 0.05 M Tris pH 7.4, 1 mM EDTA, 0.02% sodium azide, 1% Triton X-100 and pre-cleared with CNBr-activated Sepharose (GE Healthcare) coupled to BSA (Sigma) in the presence of the relevant antibody for 16 h at 4 C. Antibody-antigen complexes within the clarified supernatants were then immunoprecipitated using 30% (v/v) Protein-G Sepharose (GE Healthcare) prior to washing three times in RIP wash buffer (0.5 M NaCl, 0.05 M Tris pH 7.4, 1 mM EDTA, 0.02% sodium azide and 1% Triton-X 100) and once in PBS. The immunoprecipitated proteins were subjected to SDS-PAGE in 10-15% polyacrylamide gradient gels under nonreducing conditions and visualized by scanning in a phosphorimager.
(213) Transient Expression of E2-myc Proteins
(214) HEK 293T cells (350,000 cells per well of 6-well culture plates) were transfected with E2-myc expression vectors using Fugene 6 (Roche). At 8-h post transfection, the transfection medium was replaced with Optimem (Invitrogen) and the cells incubated for 3 days at 37 C. in a humidified atmosphere containing 5% CO.sub.2. The tissue culture fluid was clarified through 0.45-m-pore-size filters and then concentrated by approximately 10-fold in Centricon YM30 concentrators (Amersham).
(215) Recombinant CD81 Large Extracellular Loop (CD81-LEL) Binding Properties.
(216) The abilities of the E2-myc proteins to interact with the HCV cellular receptor CD81 were examined using a solid phase enzyme immunoassay. Enzyme immunoassay plates (Nunc Maxisorb) were coated with maltose binding protein fused to the recombinant large extracellular loop of CD81 (residues 113-201) at 5 g/ml in PBS overnight at 4 C. Coating solution was removed and unoccupied sites blocked with bovine serum albumin (10 mg/ml) in PBS (BSA.sub.10PBS) for 1 h at room temperature. Plates were washed 4 times with PBS containing 0.05% Tween 20 (PBST). The secreted E2-myc proteins were serially diluted in a 50 l PBS containing 5 mg/ml bovine serum albumin (BSA.sub.5PBST) and incubated for 2 h. Bound E2-myc proteins were detected using an E2 specific monoclonal antibody followed by rabbit anti-mouse immunoglobulins coupled to horseradish peroxidase (Dako). Plates were developed using tetramethylbenzidine hydrochloride substrate and stopped by the addition of 1M HCl. Absorbance values were measured at 450 nm and the background at 620 nm subtracted in a Fluostar plate reader (BMG technologies).
(217) CD81 Binding Properties.
(218) CHO-K1 cells were seeded in 12-well culture plates at 1.2510.sup.5 cells/well and transfected with 2 g pcDNA3-CD81 24 h later. At 48-h post transfection the CD81 transfected CHO-K1 cells were chilled on ice and incubated with serial dilutions of wild-type E2-myc or E2-myc proteins containing variable region deletions in BSA.sub.10PBS for 4 h on ice. The cells then were washed twice in BSA.sub.10PBS prior to a 1-h incubation with .sup.125I-MAb 9E10 (10.sup.6 cpm) that had been precleared with 10.sup.7 CHO-K1 cells for 2 h on ice. After 4 further washes with BSA.sub.10PBS, the cells were lysed in 1% SDS in PBS and counted in a Packard Auto-Gamma counter.
EXAMPLE 3
1. SDS-PAGE Analysis of Purified E2-his Wild Type and Variant Proteins
(219) The purity of E2-his wild type and variant proteins was assessed by SDS-PAGE under reducing conditions.
2. Blue-Native PAGE of Purified E2-his Proteins
(220) The oligomerization status of the purified E2-his wild type and variant proteins was analysed using blue native polycrylamide gel electrophoresis.
3. Immunodetection of E2-his Proteins
(221) The purified E2-his wild type and variant proteins were detected by a non-conformation dependent E2 specific monoclonal antibody (H52) in a western blot. A major protein species migrating at the expected molecular mass was revealed for each E2-his protein variant (
4. CD81 Binding Properties of E2-his Wild Type and Variant Proteins
(222) The ability of the purified E2-his proteins to interact with the large extracellular loop (LEL) of the HCV cellular receptor CD81 was examined. In this assay, CD81-E2-his binding was detected using a conformation-dependent E2 monoclonal antibody (H53) in an ELISA employing solid-phase maltose binding protein fused to the large extracellular loop of CD81 (residues 113-201; CD81-LEL). E2-his proteins containing one or more deletions of the variable regions displayed wild-type levels of CD81-LEL binding, indicating that the E2 global fold was not detectably affected by the deletions (
5. Immunoreactivity Towards Homologous E2-his Antigen of Mouse Sera Obtained after 2 Immunizations with E2-his Protein Variants
(223) The immunoreactivity of mouse sera obtained after 2 immunizations with the E2-his wild type and variant proteins towards solid-phase homologous antigen (i.e. that antigen used to immunize a particular mouse group) was examined by ELISA. Substantial antibody binding activity towards the homologous solid-phase antigen was demonstrated in each of the vaccinated animals (
6. Immunoreactivity Towards E2-his and E2123-his Antigens of Mouse Sera Obtained after 2 Immunizations with E2-his Protein Variants
(224) The ability of the antibodies in immune sera from each vaccination group to bind to solid-phase E2-his (containing the three variable regions) was compared to the antibody reactivity towards solid-phase E2 123-his (lacking the three variable regions) in ELISA. Substantial binding titres against solid phase E2-his (
(225) Pair-wise statistical analyses of the antibody binding titres obtained for the various immunization groups were performed in order to determine whether apparent differences in binding titre were significant. Table 7 indicates that the antibody titres against solid-phase E2-his calculated for the E2-his-immunization group were not significantly different to those of the other immunization groups (p>0.06). However, statistically significant differences in antibody reactivity against solid-phase E2-his were observed between the E2 1-his immunization group versus E2 13-his, E2 23-his and E2 123-his (p<0.04).
(226) A pair-wise statistical analysis of antibody binding titres against solid-phase E2 123-his for the various immunization groups revealed a highly significant increase in antibody reactivity for the E2 123-his immunization group compared with the E2-his immunization group (p=0.003, Table 8). Statistically significant increases in antibody reactivity for the E2 1-his, E2 3-his, and E2 12-his immunization groups versus E2-his were observed, and also for E2 1-his relative to E2 2-his immunization groups (p<0.04).
7. Immunoreactivity Towards Homologous E2-his Antigen of Mouse Sera Obtained after 3 Immunizations with E2-his Protein Variants
(227) The immunoreactivity of mouse sera obtained after 3 immunizations with the E2-his wild type and variant proteins towards solid-phase homologous antigen (i.e. that antigen used to immunize a particular mouse group) was examined by ELISA. Substantial antibody binding activity towards the homologous solid-phase antigen was demonstrated in each of the vaccinated animals (
8. Immunoreactivity Towards E2-his and E2123-his Antigens of Mouse Sera Obtained after 3 Immunizations with E2-his Protein Variants
(228) The ability of the antibodies in immune sera from each vaccination group to bind to solid-phase E2-his (containing the three variable regions) was compared to the antibody reactivity towards solid-phase E2 123-his (lacking the three variable regions) in ELISA. Substantial binding titres against solid phase E2-his (
(229) Pair-wise statistical comparisons of the antibody binding titres obtained for the various immunization groups were performed in order to determine whether apparent differences in binding titre were significant. In contrast to the data obtained after the second immunization, Table 9 indicates that the antibody titres against solid-phase E2-his calculated for the E2-his-immunization group were significantly higher than those of 6 of 7 other immunization groups (p=0.003 to 0.04), excepting the E2 123-his (p=0.11).
(230) A pair-wise statistical analysis of antibody binding titres against solid-phase E2 123-his for the various immunization groups revealed a highly significant increase in antibody reactivity for the E2 123-his immunization group compared with the E2-his immunization group (p=0.0007, Table 10). Statistically significant differences were also observed between the E2-his versus E2 3-his, E2 12-his, and E2 23-his immunization groups, and also between the E2 1-his versus E2 3-his, E2 12-his, E2 23-his and E2 123-his immunization groups (p=0.009 to 0.022).
(231) Finally, the mean binding titres obtained for each immunization group against solid-phase wild type E2-his antigen (i.e. containing HVR1, HVR2 and IgVR) were compared with the binding titres towards solid-phase E2 123-his antigen (i.e. lacking HVR1, HVR2 and igVR and representing the conserved glycoprotein core). This analysis was performed in order to gauge the relative abilities of the immunogens to elicit antibodies reactive with the conserved core of the E2.sub.RBD. Table 11 shows significantly lower antibody titres to solid-phase E2 123-his antigen relative to solid-phase E2-his antigen for antisera elicited by E2-his immunogen (4.4-fold reduction; p=0.0009) and E2 1-his immunogen 2-fold reduction; p=0.005).
9. Immunoreactivity Towards Solid-Phase Con1 E2RBD-his and JFH1 E2RBD-Myc Antigens of Mouse Sera Obtained after 3 Immunizations with E2-his Protein Variants
(232) The abilities of the E2-his wild type and variant proteins, which are derived from the genotype 1a H77c isolate, to elicit cross-genotype reactive antibodies was determined by comparing the immunoreactivity of immune sera with solid-phase Con1 E2.sub.RBD-his (genotype 1b) and JFH1 E2.sub.RBD-myc (genotype 2a) antigens in ELISA. Substantial binding titres against solid phase Con1 E2.sub.RBD-his (
(233) A pair-wise statistical analysis of antibody binding titres against solid-phase Con1 E2.sub.RBD-his for the various immunization groups revealed significantly higher binding titres for E2 2-his, E2 3-his, E2 12-his, and E2 123-his immunization groups compared with the E2-his immunization group (p<0.05, Table 12). The Con1 E2.sub.RBD-his-binding titre elicited in the E2 123-his immunization group was also significantly higher than the Con1 E2.sub.RBD-his binding titres elicited by E2 1-his and E2 23-his (p<0.05).
(234) By contrast, a similar pair-wise statistical analysis of antibody binding titres against solid-phase JFH1 E2.sub.RBD-myc for the various immunization groups did not reveal significantly different binding titres between groups (Table 13). Despite this lack of significance, the trends observed above were also apparent in these analyses.
10. Neutralization
(235) The abilities of immune and control mouse sera to neutralize a single cycle of infection by homologous H77c strain E1E2-pseudotyped HIV-1 luciferase reporter viruses were determined. Serial 5-fold dilutions of heat-inactivated immune and control mouse sera were preincubated with E1E2-pseudotyped HIV-1 luciferase reporter viruses (1 h) and then incubated for 4 h with Huh7 cell monolayers. The cells were washed with PBS, fresh culture medium added, and after an additional 3-day incubation (37 C. in 5% CO.sub.2), the cells were lysed and assayed for luciferase activity.
11. Discussion
(236) The E2-his proteins containing one or more deletions of the three variable regions were capable of eliciting antibody reactive towards homologous antigens. The specificity of the antibody response was examined by comparing the ability of the immune sera to react towards intact wild-type E2-his protein containing three variable regions to E2 123-his protein which represents the core E2 folding unit lacking all three variable regions but retaining CD81 binding. This analysis revealed that mice immunized with E2-his protein or E2 lacking HVR1 (E2 1-his) elicited significantly less antibody reactive towards the core domain of E2. By contrast antibodies elicited in mice immunized with E2-his proteins lacking HVR1 and 2 (E2 12-his), HVR1 and igVR (E2 13-his), HVR2 and igVR (E2 23-his) or lacking all three variable regions (E2 123-his) reacted similarly towards wild-type E2-his and E2 123-his antigens. This suggests that HVR2 and the igVR may hinder antibody access to epitopes present in the underlying conserved core domain of E2. To test this hypothesis, E2.sub.RBD constructs were synthesised representing heterologous isolates of HCV from genotype 1b (Con1) and genotype 2a (JF-H1). The immunoreactivity of mouse serum obtained after the third vaccination to these heterologous E2.sub.RBD constructs revealed that mice immunized with E2 123-his, E2 12-his, E2 3-his, E2 2-his elicited significantly higher levels of cross-reactive antibody to epitopes present in the genotype 1b isolate Con1. Although cross-reactive antibody to the E2.sub.RBD of genotype 2a isolate JF-H1 were also elicited, the differences in binding titres between the immunogen groups were not statistically significant although trends similar to those above were observed. These data suggest that deletion of at least one variable region, preferably either HVR2 and/or igVR, may improve the ability of E2-his proteins to elicit cross-reactive antibodies with broader neutralization capacity.
(237) The ability of the immune serum to neutralize homologous virus was examined using HCV E1E2 pseudotyped retroviral particles. The data showed that mice vaccinated with E2 123-his or E2 23-his possessed on average 59 and 20 fold higher neutralizing antibody titres compared with E2-his lacking HVR1 alone (p=0.11 and 0.002, respectively). HVR1 has previously been shown to be an immunodominant region of the E1E2 glycoprotein complex. Deletion of HVR1 region alone may result in the removal of an important type-specific immunodominant epitope. However, the presence of HVR2 and/or the igVR regions in the HVR1 deleted construct may shield underlying cryptic neutralizing epitopes. It is therefore likely that the antibody response elicited by wild-type E2-his protein may be largely directed towards the HVR1 region and not the conserved core. This is in part reflected by (i) the lower level of antibody reactive to the E2 core domain (
(238) Together the data suggest that deletion of HVR2 and/or the igVR region is a significant improvement on the use of E2 RBD constructs lacking none of the variable regions or HVR1 alone. It is likely that E2 RBD proteins lacking at least HVR2 and/or igVR and possibly all three variable regions will elicit antibody capable of cross-neutralizing divergent HCV strains from within a genotype as well as cross-genotype neutralization. E2 RBD proteins lacking one or more variable regions may be useful tools for both therapeutic or prophylactic vaccination strategies for the prevention or treatment of HCV infection. In addition these variable region deleted E2 RBD constructs may also be useful to elicit novel specificities of antibodies directed to the conserved E2 core region that neutralize HCV for therapeutic and prophylactic use.
12. Materials and Methods
(239) Construction of Wild Type and Variant HCV E2-his cDNAs and Secreted Expression of the Encoded Proteins in Mammalian Cells.
(240) Generation of cDNA Expression Plasmids Encoding HCV E2-his Variants
(241) A synthetic gene encoding a wild type E2 protein fragment (residues 384-661; strain H77c) was constructed by Geneart AG (Regensburg, Germany). The human trypsinogen signal peptide (MNPLLILTFVAAALA) (SEQ ID NO: 63) was appended in-frame to the N-terminus of the wild type E2 mature protein in order to facilitate secretion of the mature polypeptide into the expression medium. A Kozak sequence was introduced just before the N-terminus to increase translational initiation and a (His).sub.6 sequence (SEQ ID NO: 108) was added in-frame to enable subsequent purification of the secreted proteins by immobilised metal affinity chromatography. Two stop codons were added after the His-tag at the C-terminus to ensure efficient translational termination. This construct is referred to as E2-his. The codon usage of the E2-his cDNA was adapted to the codon bias of Homo sapiens genes. An Nhe I restriction site at the 5 end of the cDNA and a Xho I restriction site was introduced at the 3 end in order to ligate the Geneart cDNA into Nhe I-Xho I digested pcDNA3.1 (Invitrogen).
(242) The cDNAs encoding seven variants of the E2-his mature protein where one or more of the variable regions were substituted by linker sequences, were constructed using standard PCR mutagenesis procedures with Accuprime Pfx DNA Polymerase (Invitrogen) according to the manufacturer's instructions and the primers shown in Table 15. The combinations of primers used to construct cDNAs of the E2-his are shown in Table 16.
(243) The specific PCR parameters were as follows: 2 minutes of denaturation at 95 C. was followed by 18 cycles of 95 C. for 15 seconds, 64 C. for 30 seconds and 68 C. for 2 minutes with a final 2 minute incubation at 68 C.
(244) The Geneart wild type E2-his cDNA was used as a PCR template for all the E2-his variant cDNAs. Each deletion variant was constructed using sequential overlap PCR of multiple fragments. Once each cDNA was complete, it was digested with Nhe I and Xho I and ligated into pcDNA3.1. Large scale preparations of plasmid DNA were carried out using a Qiagen Maxi Kit. The nucleotide sequences of all the plasmid constructs were verified by sequencing both strands using Big Dye Terminator v3.1 Cycle Sequencing and an Applied Biosystems Automated Sequencer.
(245) The sequences of the mature wild type and variant E2 proteins are as follows:
(246) TABLE-US-00007 E2-hismatureprotein ETHVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERL ASCRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSW GANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCPTDCFRKHPEATYSRCGSGPW ITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSE E21-hismatureprotein ETHQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCRRLTDFAQGQGPISYANGS GLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFG CTQMNSTGFTKVCGAPPCVIGGVGNNTLLCPTDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINY TIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSE E22-hismatureprotein ETHVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERL ASCGSSGCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFG CTWMNSTGFTKVCGA[[CVIGGVGNNTLLCPTDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINY TIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSE E23-hismatureprotein ATHVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERL ASCRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSW GANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCGSSGCPTDCFRKHPEATYSRCGSGPWITPRCMV DYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSE E212-hismatureprotein ETHQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCGSSGCWHYPPRPCGIVPAK SVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGG VGNNTLLCPTDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACNW TRGERCDLEDRDRSE E213-hismatureprotein ETHQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCRRLTDFAQGWGPISYANGS GLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFG CTWMNSTGFTKVCGAPPCGSSGCPTDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRM YVGGVEHRLEAACNWTRGERCDLEDRDRSE E223-hismatureprotein ETHVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERL ASCGSSGCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFG CTWMNSTGFTKVCGAPPCGSSGCPTDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRM YVGGVEHRLEAACNWTRGERCDLEDRDRSE E2123-hismatureprotein ETHQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCGSSGCWHYPPRPCGIVPAK SVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCGSSG CPTDCFRKHPEATYSRCGSGPWITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACNWTRGERCD LEDRDRSE
Cell Culture
(247) FreeStyle 293-F cells (Invitrogen) were cultured in FreeStyle Expression Medium (Invitrogen) supplemented with penicillin/streptomycin/fungizone (Invitrogen). All cells were maintained at 37 C. in humidified incubators with an atmosphere of 8% CO.sub.2.
(248) Transient Protein Expression
(249) Transient expression of each of the E2-his proteins was carried out in FreeStyle 293-F cells by transfection with the pcDNA3.1-based expression plasmids and 293fectin transfection reagent (Invitrogen) according to the manufacturer's instructions. The cells in a total volume of 180 ml were transfected at a final concentration of 110.sup.6 viable cells/ml and incubated in a sterile shaker flask (Corning) for 5 days on an orbital shaker (IKA) rotating at 150 rpm in a 37 C. humidified incubator with an atmosphere of 8% CO.sub.2. Twenty-four hours after transfection the cell cultures were supplemented with Tryptone N1 (Organotechnie, France) to a final concentration of 0.5% v/v. Typically the cell cultures were harvested 5 days after transfection. Protein expression was examined by electrophoresis of a sample of cell culture supernatant using 4-20% Tris-Glycine SDS polyacrylamide gel and the proteins visualised by staining with Coomassie Blue reagent. For protein purification, cell culture supernatants were harvested by centrifugation at 2500 rpm and then passed through a 0.45 M filter (Nalgene) prior to chromatography.
(250) Purification of Expressed Wild Type and Variant HCV E2-his Proteins.
(251) Following filtration the cell culture supernatants were subjected to immobilised metal affinity chromatography (IMAC) using Nickel sepharose to purify the wild type and variant E2-his proteins.
(252) The purification procedure is described below:
(253) 1. Buffers:
(254) Ni-MAC Buffer A
(255) 50 mM NaH.sub.2PO.sub.4 pH 8.0
(256) 300 mM NaCl
(257) 10 mM imidazole
(258) Ni-MAC Buffer B (Elution)
(259) 50 mM NaH.sub.2PO.sub.4 pH 8.0
(260) 300 mM NaCl
(261) 500 mM imidazole
(262) 2. Protocol:
(263) 1. Procedures 2 to 6 were carried out at 4-8 C. 2. 1 ml Ni Sepharose 6 Fast Flow resins (GE Healthcare) in a 10 ml Poly-Prep columns (Bio-Rad) were washed with 5 volumes of ddH.sub.2O. 3. The columns were equilibrated with 10 ml Ni-MAC Buffer A. 4. Samples were loaded onto the columns, and break-through (B/T) collected. 5. The columns were washed with 10 ml Ni-MAC Buffer A. 6. The proteins were eluted with 5 ml Ni-MAC Buffer B (Elution) and 1 ml fractions collected. 7. Peak fractions were identified using 96-well plate format Bradford Assay and Coomassie-stained SDS-polyacrylamide gel electrophoresis (SDS-PAGE) gels. 8. Peak fractions were pooled and dialysed in 1PBS overnight at 4 C. 9. Following dialysis protein concentrations were determined using 96-well plate format Bradford Assay and 1 mg/ml BSA for a standard curve.
Construction of Con1 E2.sub.RBD-his and JFH1 E2.sub.RBD-myc cDNAs and Secreted Expression of the Encoded Proteins in Mammalian Cells.
Generation of cDNA Expression Plasmids Encoding Con1 E2.sub.RBD-his and JFH1 E2.sub.RBD-myc.
(264) cDNAs encoding Con1 E2 (HCV Con1 polyprotein residues 384 to 661; Genbank accession number AJ238799) and JFH1 E2 (HCV JFH1 polyprotein residues 384 to 665; Genbank accession number AB047369), were prepared by PCR using Expand-Hifi polymerase (Roche) and the primers indicated in Table 17. The forward primers encoded an NheI restriction site for incorporation in-frame at the 5 ends of the cDNAs. The reverse primers encoded (His)6 (SEQ ID NO: 108) and c-myc epitope tags for addition in-frame to the 3 ends of Con1 and JFH1 cDNAs, respectively, and for both cases were followed by a TAG translation termination codon and an Xba1 restriction site. The specific PCR parameters were as follows: 5 minutes of denaturation at 95 C. was followed by 30 cycles of 92 C. for 1 min, 55 C. for 1 min and 72 C. for 2 minutes with a final 10 minute incubation at 72 C. The cDNAs were cloned downstream of a tissue plasminogen activator signal peptide in vector pcDNA3 to facilitate secretion of the expressed proteins. The nucleotide sequences of the cloned cDNAs were verified by using Big Dye Terminator v3.1 Cycle Sequencing and an Applied Biosystems Automated Sequencer.
(265) Transient Expression of Con1 E2.sub.RBD-his and JFH1 E2.sub.RBD-myc
(266) HEK 293T cells (350,000 cells per well of 6-well culture plates) were transfected with Con1 E2.sub.RBD-his and JFH1 E2.sub.RBD-myc expression vectors using Fugene 6 (Roche). At 8-h post transfection, the transfection medium was replaced with Optimem (Invitrogen) and the cells incubated for 3 days at 37 C. in a humidified atmosphere containing 5% CO.sub.2. The tissue culture fluid was clarified by centrifugation at 1500 rpm for 10 min followed by filtration through 0.45-m-pore-size syringe filters.
(267) Biochemical and Functional Analysis of Wild Type and Variant E2-his Proteins.
(268) BLUE-Native PAGE The oligomerization status of the purified E2-his proteins was analysed using blue native polycrylamide gel electrophoresis (BN-PAGE). Ten g of each protein was added to 10 l of solubilization buffer and 1.5 l of sample buffer and loaded onto 5-15% gradient separating gels containing a 4% stacking gel. The gels were electrophoresed at 4 C. at 100 volts until the dye front entered the stacking gel. The voltage was then increased to 200 volts until the dye front migrated to the bottom of the gel. Electrophoresis was conducted for 1.5 h with 1 cathode buffer containing 0.01% Serva G in the upper reservoir, followed by electrophoresis for 1-1.5 h in 1 cathode buffer without Serva G. The lower reservoir contained 1 anode buffer. After electrophoresis, the gels were destained overnight and scanned in an Odyssey scanner at 680 nm.
(269) The solutions used for BN-PAGE are as follows:
(270) Polyacrylamide Gels:
(271) TABLE-US-00008 4% stacker 5% separating gel 15% separating gel 40% acrylamide 0.299 ml 0.262 ml 0.787 ml 3x gel buffer 1 ml 0.7 ml 0.7 ml 75% Glycerol 0.14 ml 0.62 ml water 1.72 ml 0.978 ml 0 TEMED 6 l 2 l 2 l 5% ammonium 32 l 11 l 11 l persulphate
Other Solutions: 3 Gel Buffer. 150 mM BisTris-HCl, 0.5M 6-amino caproic acid, pH 7.0 10 Cathode buffer. 0.5M Tricine, 150 mM BisTris 5 Anode buffer. 0.25M BisTris-HCl, pH 7.0 2BisTrisACA. 200 mM BisTris-HCl, 1M 6-amino-caproic acid, pH 7.0. Sample buffer. 50 mg ServaG, 500 l 2BisTrisACA, 400 l 75% sucrose and 1000 water. Solubilization buffer. 0.5M 6-amino-caproic acid, 20 mM BisTris, 2 mM EDTA, pH 7.0, 1% Triton X-100, 10% glycerol. Destain. 10% acetic acid, 10% methanol, 80% water.
Immunodetection of E2-his Proteins.
(272) Samples of the purified E2-his proteins were subjected to reducing SDS-PAGE followed by electrophoretic transfer to nitrocellulose membrane. E2-his proteins were detected with a non-conformation dependent E2 specific monoclonal antibody followed by goat anti-mouse immunoglobulin coupled to Alexa fluor 680 nm (Invitrogen). Immunoblots were scanned in an Odyssey detection system.
(273) CD81 Binding Properties.
(274) The ability of the E2-his proteins to interact with the HCV cellular receptor CD81 was examined using a solid phase enzyme immunoassay. Enzyme immunoassay plates (Nunc Maxisorb) were coated with maltose binding protein fused to the recombinant large extracellular loop of CD81 (residues 113-201) at 5 g/ml in PBS overnight at 4 C. Coating solution was removed and unoccupied sites blocked with bovine serum albumin (10 mg/ml) in PBS (BSA.sub.10PBS) for 1 h at room temperature. Plates were washed 4 times with PBS containing 0.05% Tween 20 (PBST). 50 ng E2-his proteins were serially diluted in a 50 l PBS containing 5 mg/ml bovine serum albumin (BSA.sub.5PBST) and incubated for 2 h. Bound E2-his protein was detected using an E2 specific monoclonal antibody followed by rabbit anti-mouse immunoglobulins coupled to horse radish peroxidase (Dako). Plates were developed using tetramethylbenzidine hydrochloride substrate and stopped by the addition of 1M HCl. Absorbance values were measured at 450 nm and the background at 620 nm. subtracted in a Fluostar plate reader (BMG technologies).
(275) Immunogenicity in Mice of Wild-Type and Variant E2-his Proteins.
(276) Immunization Protocol.
(277) Groups of 10 7-8 week old female Balb/c mice were immunised with purified E2-his wild type and variant proteins formulated with ISCOMATRIX adjuvant (Pearse and Drane, 2005) (Table 18). Each mouse dose contained 10 g specific protein and 5 g ISCOMATRIX adjuvant in a 0.1 ml volume. Mice were dosed subcutaneously three times at three-weekly intervals and bleeds taken 1 day prior to the first dose and at one week after both the second and third doses.
(278) Enzyme-Linked Immunosorbent Assay (ELISA)
(279) The immune mouse sera were examined for the presence of anti-E2 antibodies in ELISA. The E2-his, Con1 E2.sub.RBD-myc or JFH1 E2.sub.RBD-myc proteins were captured on 96 well Maxisorb microtitre plates (Nunc) using Galanthis nivalis (GNA) lectin. Plates were coated with GNA lectin at 5 g/ml in PBS overnight at 4 C. Unoccupied sites were blocked with 100 l BSA.sub.10PBS for 1 h at room temperature. After washing the plates 4 times with PBST, the E2 proteins were applied in 50 l BSA.sub.5PBST and incubated for 1 h at room temperature. After washing the plates 4 times with PB ST, serial dilutions of mouse sera were applied in a 50 l volume of BSA.sub.5PBST and incubated for 1 h room temperature. Bound immunoglobulins were detected with rabbit anti-mouse immunoglobulin coupled to horseradish peroxidase and developed using tetramethylbenzidine hydrochloride substrate and stopped by the addition of 1M HCl. A Fluostar plate reader (BMG technologies) was used to measure the absorbance at 450 nm and the background at 620 nm. The background was subtracted from the absorbance to generate the binding curves.
(280) Neutralization Assays
(281) The abilities of immune and control mouse sera to neutralize a single cycle of infection by HCV glycoprotein-pseudotyped HIV-1 luciferase reporter viruses were determined as follows. HCV glycoprotein-pseudotyped HIV-1 luciferase reporter viruses were prepared by cotransfection of HEK-293T monolayers (350,000 cells per well of 6-well culture dishes) with pE1E2 and pNL4.3LUCRE plasmids (Drummer et al., 2003). After 3 days incubation at 37 C. in a humidified atmosphere containing 5% CO.sub.2, the culture supernatants were filtered through 0.45 m sterile syringe filters (Sartorius). Serial 5-fold dilutions of heat-inactivated immune and control mouse sera were preincubated with HCV glycoprotein-pseudotyped HIV-1 luciferase reporter viruses (1 h) and then added to quadruplicate Huh7 cell monolayers in 48-well tissue culture plates. Following a 4 h incubation (37 C., 5% CO.sub.2) the cells were washed with PBS and the medium replaced. After an additional 3-day incubation (37 C. in 5% CO.sub.2), the cells were lysed, the lysates clarified by centrifugation and then assayed for luciferase activity (Promega) in a Fluostar (BMG) fitted with luminescence optics. The neutralization titres of individual sera were determined as the serum dilution giving 80% neutralization compared to HCV glycoprotein-pseudotyped HIV-1 luciferase reporter virus preincubated with medium alone.
(282) TABLE-US-00009 TABLE 7 Pair-wise statistical comparison of antibody titres reactive to solid-phase E2-his antigen obtained after 2.sup.nd vaccination. Immunogen Group E2 1-his E2 2-his E2 3-his E2 12-his E2 13-his E2 23-his E2 123-his E2-his 0.06 0.96 0.25 0.26 0.37 0.6 0.08 E2 1-his 0.06 0.27 0.09 0.034 0.014 0.04 p values calculated using student's t test.
(283) TABLE-US-00010 TABLE 8 Pair-wise statistical comparison of antibody titres reactive to solid phase E2 123-his protein antigen obtained after 2.sup.nd vaccination. Immunogen Group E2 1-his E2 2-his E2 3-his E2 12-his E2 13-his E2 23-his E2 123-his E2-his 0.04 0.96 0.02 0.02 0.09 0.077 0.003 E2 1-his 0.04 0.09 0.12 0.06 0.06 0.17 p values calculated using student's t test.
(284) TABLE-US-00011 TABLE 9 Pair-wise statistical comparison of antibody titres reactive to solid- phase E2-his protein antigen obtained after 3.sup.rd vaccination. Immunogen Group E2 1-his E2 2-his E2 3-his E2 12-his E2 13-his E2 23-his E2 123-his E2-his 0.02 0.003 0.002 0.04 0.002 0.02 0.11 E2 1-his 0.1 0.021 0.58 0.44 0.9 0.17 p values calculated using student's t test assuming unequal variances.
(285) TABLE-US-00012 TABLE 10 Pair-wise statistical comparison of antibody titres reactive to solid- phase E2 123-his protein antigen obtained after 3.sup.rd vaccination. Immunogen E2 1-his E2 2-his E2 3-his E2 12-his E2 13-his E2 23-his E2 123-his E2-his 0.64 1 0.016 0.004 0.31 0.003 0.0007 E2 1-his 0.62 0.022 0.007 0.44 0.005 0.009 p values calculated using student's t test assuming unequal variances.
(286) TABLE-US-00013 TABLE 11 Statistical comparison of relative antibody titres obtained after 3.sup.rd vaccination against E2-his antigen and E2 123-his antigen. Immunogen E2 1-his E2 2-his E2 3-his E2 12-his E2 13-his E2 23-his E2 123-his E2-his Mean antibody 1.16 0.81 0.68 1.31 .71 1.19 1.54 2.26 titre against E2-his (10.sup.5) Mean antibody 0.56 0.51 1.15 1.11 0.71 1.19 1.54 0.51 titre against E2 123-his (10.sup.5) p value 0.005 0.045 0.06 0.46 1 1 1 0.0009 p values calculated using student's t test assuming unequal variances.
(287) TABLE-US-00014 TABLE 12 Pair-wise statistical comparison of antibody titres reactive to solid- phase Con1 E2.sub.RBD-his protein antigen obtained after 3.sup.rd vaccination. E2-his E2 1-his E2 2-his E2 3-his E2 12-his E2 13-his E2 23-his E2 123-his E2-his E2 1-his 0.526 E2 2-his 0.0453 0.072 E2 3-his 0.043 0.061 0.883 E2 12-his 0.0123 0.091 0.926 0.797 E2 13-his 0.185 0.343 0.847 0.756 0.888 E2 23-his 0.173 0.568 0.284 0.238 0.217 0.534 E2 123-his 0.0123 0.028 0.259 0.325 0.197 0.251 0.0499 p values calculated using student's t test assuming unequal variances.
(288) TABLE-US-00015 TABLE 13 Pair-wise statistical comparison of antibody titres reactive to solid- phase JFH1 E2.sub.RBD-myc protein antigen obtained after 3.sup.rd vaccination. E2-his E2 1-his E2 2-his E2 3-his E2 12-his E2 13-his E2 23-his E2 123-his E2-his E2 1-his 0.609 E2 2-his 0.148 0.511 E2 3-his 0.159 0.253 0.371 E2 12-his 0.305 0.549 0.861 0.48 E2 13-his 0.392 0.624 0.916 0.484 0.970 E2 23-his 0.123 0.287 0.492 0.652 0.705 0.702 E2 123-his 0.058 0.084 0.117 0.406 0.154 0.156 0.209 p values calculated using student's t test assuming unequal variances.
(289) TABLE-US-00016 TABLE 14 Mean 80% Neutralizing antibody titres and statistical comparison. p values were calculated using student's t test assuming unequal variances. Immunogen group E2- E2 1- E2 23- E2 123- No his his his his antigen Mean neutralizing 908 7 140 413 26 antibody titre p value relative 0.044 0.08 0.29 0.048 to E2-his p value relative 0.002 0.11 0.31 to E2 1-his
(290) TABLE-US-00017 TABLE15 PrimersusedforpreparationofE2-hisproteinvariantDNA sequences. Primer designation PrimerSequence HCV-1 5 TATAGCTAGCGCCACCATGAACCCCCTGC3 HCV-2 5 CTGGATGTTCTGGTGGGTCTCGGCCAG3 HCV-3 5 GCCGAGACCCACCAGAACATCCAGCTG3 HCV-4 5 CGCTGCTGCCGCAGGAGGCGAG3 HCV-4a 5 GTAGTGCCAGCAGCCGCTGCTGCCGCAGGAGGCGAGCCTCTCGG 3 HCV-5 5 GGCAGCAGCGGCTGCTGGCACTAC3 HCV-5a 5 CTCGCCTCCTGCGGCAGCAGCGGCTGCTGGCACTACCCCCCCAGA 3 HCV-6a 5 GTCGGTGGGGCAGCCGCTGCTGCCGCAGGGAGGGGCGCCACACA C3 HCV-7a 5 GCCCCTCCCTGCGGCAGCAGCGGCTGCCCCACCGACTGCTTTAGG 3 HCV-8 5 TCTGCTCGAGTTATCAGTGGTGATGGTGGTGG3 HCV-11 5 CTCTCGTTGCAGTTCAGGGCGGTGCTG3 HCV-12 5 CAGCACCGCCCTGAACTGCAACGAGAG3
(291) TABLE-US-00018 TABLE 16 Primer combinations used for preparation of E2-his protein variant DNA sequences. E2 protein Primer combination E21-his HCV-1 HCV-3 HCV-8 E22-his HCV-1 HCV-11 HCV-12 HCV-8 E23-his HCV-1 HCV-6a HCV-7a HCV-8 E212-his HCV-1 HCV-2 HCV-3 HCV-4 HCV-5 E213-his HCV-1 HCV-6a HCV-7a HCV-8 E223-his HCV-1 HCV-5a HCV-4A HCV-6A HCV-7A HCV-8 E2123-his HCV-1 HCV-6a HCV-7a HCV-8
(292) TABLE-US-00019 TABLE17 PrimersusedforpreparationofCon1E2.sub.RBD-bisandJFH1E2.sub.RBD-mycDNAsequences E2.sub.RBD Epi- con- RE tope struct PrimerSequence site tag Con1 Forwardprimer 5-CAAGCTAGCggaacctatgtgacaggg NheI E2.sub.RBD- Reverseprimer 5-CCCTCTAGATTAGTGGTGGTGGTGGTGGTGGCCGCCCTCTGATCTGTCCCTGTC XbaI His.sub.6 bis JFH1 Forwardprimer 5 CAAGCTAGCggcaccaccaccgttggaggc NheI E2.sub.RBD- Reverseprimer 5CCGTCTAGActaattcagatcctcttctgagatgagtttttgttcagtactCTGACTCCTGTCCCTGTC XbaI myc myc
(293) TABLE-US-00020 TABLE 18 Immunisation of mice with E2-his wild type and variant proteins formulated with ISCOMATRIX.sup. adjuvant Antigens Group Protein ISCOMATRIX.sup. adjuvant 1 E21-his + 2 E22-his + 3 E23-his + 4 E2123-his + 5 E212-his + 6 E213-his + 7 E223-his + 8 E2-his + 9 +
REFERENCES
(294) 1. Anandarao, R., S. Swaminathan, S. Fernando, A. M. Jana, and N. Khanna (2006), Recombinant multiepitope protein for early detection of dengue infections. Clin. Vaccine Immunol. 13:59-67. 2. Arai, R., W. Wriggers, Y. Nishikawa, T. Nagamune, and T. Fujisawa, (2004), Conformations of variably linked chimeric proteins evaluated by synchrotron X-ray small-angle scattering. Proteins 57:829-38. 3. Argos, P. (1990), An investigation of oligopeptides linking domains in protein tertiary structures and possible candidates for general gene fusion. J. Mol. Biol. 211:943-58. 4. Bahrami, S., M. Duch, and F. S. Pedersen, (2007), Ligand presentation on a synthetic flexible hinge in Moloney murine leukemia virus SU supports entry via a heterologous receptor. Virology, B363B:303-9. 5. Bartosch, B., Bukh, J., Meunier, J. C., Granier, C., Engle, R. E., Blackwelder, W. C., Emerson, S. U., Cosset, F. L. & Purcell, R. H. (2003a) In Vitro Assay For Neutralizing Antibody To Hepatitis C Virus: Evidence For Broadly Conserved Neutralization Epitopes. Proc Natl Acad Sci USA, 100, 14199-204. 6. Bartosch, B., Dubuisson, J. & Cosset, F. L. (2003b) Infectious Hepatitis C Virus Pseudo-Particles Containing Functional E1-E2 Envelope Protein Complexes. J Exp Med, 197, 633-642. 7. Bellamy-Mcintyre, A. K., C. S. Lay, S. Baar, A. L. Maerz, G. H. Talbo, H. E. Drummer, And P. Poumbourios, (2007), Functional Links Between The Fusion Peptide-Proximal Polar Segment And Membrane-Proximal Region Of Human Immunodeficiency Virus Gp41 In Distinct Phases Of Membrane Fusion. J. Biol. Chem. 282:23104-16. 8. Deleersnyder, V., Pillez, A., Wychowski, C., Blight, K., Xu, J., Hahn, Y. S., Rice, C. M. & Dubuisson, J. (1997) Formation Of Native Hepatitis C Virus Glycoprotein Complexes. J Virol, 71, 697-704. 9. Dipti, C. A., S. K. Jain, And K. Navin, (2006), A Novel Recombinant Multiepitope Protein As A Hepatitis C Diagnostic Intermediate Of High Sensitivity And Specificity. Protein Expr. Purif. 47:319-28. 10. Drummer, H. E., Boo, I., Maerz, A. L. & Poumbourios, P. (2006) A Conserved Gly436-Trp-Leu-Ala-Gly-Leu-Phe-Tyr Motif (SW ID NO: 107) In Hepatitis C Virus Glycoprotein E2 Is a Determinant of Cd81 Binding and Viral Entry. J Virol, 80, 7844-53. 11. Drummer, H. E., Maerz, A. & Poumbourios, P. (2003) Cell Surface Expression Of Functional Hepatitis C Virus E1 And E2 Glycoproteins. Febs Lett, 546, 385-90. 12. Drummer, H. E., Wilson, K. A. & Poumbourios, P. (2002) Identification Of The Hepatitis C Virus E2 Glycoprotein Binding Site On The Large Extracellular Loop Of Cd81. J Virol, 76, 11143-7. 13. Dubuisson, J., Hsu, H. H., Cheung, R. C., Greenberg, H. B., Russell, D. G. & Rice, C. M. (1994) Formation And Intracellular Localization Of Hepatitis C Virus Envelope Glycoprotein Complexes Expressed By Recombinant Vaccinia And Sindbis Viruses. J Virol, 68, 6147-60. 14. George, R. A., And J. Heringa, (2002), An Analysis Of Protein Domain Linkers: Their Classification And Role In Protein Folding. Protein Eng. 15:871-9. 15. Grollo, L., J. Torresi, H. Drummer, W. Zeng, N. Williamson, and D. C. Jackson, (2006). Exploiting information inherent in binding sites of virus specific antibodies: design of an HCV vaccine candidate cross-reactive with multiple genotypes. Antivir. Ther. 11:1005-1014. 16. He, J. & Landau, N. R. (1995) Use Of A Novel Human Immunodeficiency Virus Type 1 Reporter Virus Expressing Human Placental Alkaline Phosphatase To Detect An Alternative Viral Receptor. J Virol, 69, 4587-92. 17. Horton, R. M., Hunt, H. D., Ho, S. N., Pullen, J. K. & Pease, L. R. (1989) Engineering Hybrid Genes Without The Use Of Restriction Enzymes: Gene Splicing By Overlap Extension. Gene, 77, 61-8. 18. Keck, Z. Y., Op De Beeck, A., Hadlock, K. G., Xia, J., Li, T. K., Dubuisson, J. & Foung, S. K. (2004) Hepatitis C Virus E2 Has Three Immunogenic Domains Containing Conformational Epitopes With Distinct Properties And Biological Functions. J Virol, 78, 9224-32. 19. Levy, S., Todd, S. C. & Maecker, H. T. (1998) Cd81 (Tapa-1): A Molecule Involved In Signal Transduction And Cell Adhesion In The Immune System. Annu Rev Immunol, 16, 89-109. 20. Lindenbach, B. D., Evans, M. J., Syder, A. J., Wolk, B., Tellinghuisen, T. L., Liu, C. C., Maruyama, T., Hynes, R. O., Burton, D. R., Mckeating, J. A. & Rice, C. M. (2005) Complete Replication Of Hepatitis C Virus In Cell Culture. Science. 21. Lohmann, V., Korner, F., Koch, J., Herian, U., Theilmann, L. & Bartenschlager, R. (1999) Replication Of Subgenomic Hepatitis C Virus Rnas In A Hepatoma Cell Line. Science, 285, 110-3. 22. Petracca, R., Falugi, F., Galli, G., Norais, N., Rosa, D., Campagnoli, S., Burgio, V., Di Stasio, E., Giardina, B., Houghton, M., Abrignani, S. & Grandi, G. (2000) Structure-Function Analysis Of Hepatitis C Virus Envelope-Cd81 Binding. J Virol, 74, 4824-30. 23. Pearse, M. J. and Drane, D, (2005). ISCOMATRIX adjuvant for antigen delivery. Adv. Drug Del. Rev. 57:465-474. 24. Pileri, P., Uematsu, Y., Campagnoli, S., Galli, G., Falugi, F., Petracca, R., Weiner, A. J., Houghton, M., Rosa, D., Grandi, G. & Abrignani, S. (1998) Binding Of Hepatitis C Virus To Cd81. Science, 282, 938-41. 25. Sabourin, M., C. T. Tuzon, T. S. Fisher, And V. A. Zakian, (2007), A Flexible Protein Linker Improves The Function Of Epitope-Tagged Proteins In Saccharomyces Cereviseae. Yeast, 24:39-45. 26. Sambrook, J. & Russel, D. (2001) Molecular Cloning, Cshl Press. 27. Scarselli, E., Ansuini, H, Cerino, R., Roccasecca, R. M., Acali, S., Filocamo, G., Traboni, C., Nicosia, A., Cortese, R. & Vitelli, A. (2002) The Human Scavenger Receptor Class B Type I Is A Novel Candidate Receptor For The Hepatitis C Virus. Embo J, 21, 5017-25. 28. Wakita, T., Pietschmann, T., Kato, T., Date, T., Miyamoto, M., Zhao, Z., Murthy, K., Habermann, A., Krausslich, H. G., Mizokami, M., Bartenschlager, R. & Liang, T. J. (2005) Production Of Infectious Hepatitis C Virus In Tissue Culture From A Cloned Viral Genome. Nat Med, 11, 791-6. 29. Wyatt, R., J. Moore, M. Accola, E. Desjardin, J. Robinson, And J. Sodroski, (1995), Involvement Of The V1/V2 Variable Loop Structure In The Exposure Of Human Immunodeficiency Virus Type 1 Gp120 Epitopes Induced By Receptor Binding. J. Virol, 69:6723-33. 30. Yanagi, M., Purcell, R. H., Emerson, S. U. & Bukh, J. (1997) Transcripts From A Single Full-Length Cdna Clone Of Hepatitis C Virus Are Infectious When Directly Transfected Into The Liver Of A Chimpanzee. Proc Natl Acad Sci USA, 94, 8738-43. 31. Yang, W. Y., And M. Gruebele, (2006). Binary And Ternary Aggregation Within Tethered Protein Constructs. Biophys. J. 90:2930-7. 32. Zhong, J., Gastaminza, P., Cheng, G., Kapadia, S., Kato, T., Burton, D. R., Wieland, S. F., Uprichard, S. L., Wakita, T. & Chisari, F. V. (2005) Robust Hepatitis C Virus Infection In Vitro. Proc Natl Acad Sci USA, 102, 9294-9.