Broadly neutralizing anti-HIV-1 antibodies and methods of use thereof
12534515 ยท 2026-01-27
Assignee
Inventors
- Michel Nussenzweig (New York, NY)
- Natalia T. Freund (New York, NY, US)
- Pamela J. Bjorkman (Altadena, CA, US)
- Louise Scharf (Porter Ranch, CA, US)
Cpc classification
A61K39/21
HUMAN NECESSITIES
C07K16/114
CHEMISTRY; METALLURGY
A61K2039/507
HUMAN NECESSITIES
International classification
Abstract
This invention relates to broadly neutralizing and potent anti-HIV-1 antibodies, kits, and methods of use thereof.
Claims
1. A bispecific anti-HIV-1 antibody comprising: a. a first antigen-binding domain that comprises three heavy chain complementarity determining regions (CDRH 1, CDRH 2, and CDRH 3) and three light chain complementarity determining regions (CDRL 1, CDRL 2, and CDRL 3), wherein the CDRH 1, CDRH 2, CDRH 3, CDRL 1, CDRL 2 and CDRL 3 comprise the respective sequences of a CDR set selected from the group consisting of SEQ ID NOs: 2-4 and 6, 7 (RDR), and 8; SEQ ID NOs: 10-12 and 14, 15 (RSS), and 16; SEQ ID NOs: 18-20 and 22, 23 (RDR), and 24; SEQ ID NOs: 26-28 and 30, 31 (RTS), and 32, and SEQ ID NOs: 34-36 and 38, 39 (RDR), and 40; SEQ ID NOs: 42-44 and 46, 47 (RDR), and 48; SEQ ID NOs: 50-52 and 54, 55 (RDR), and 56; SEQ ID NOs: 58-60 and 62, 63 (RDR), and 64; SEQ ID NOs: 66-68 and 70, 71 (RDR), and 72; SEQ ID NOs: 82-84 and 86, 87 (QSW), and 88; and SEQ ID NOs: 90-92 and 94, 95 (ESS), and 96; and b. a second anti-HIV-1 antigen-binding domain, wherein the second antigen-binding domain comprises three heavy chain complementarity determining regions and three light chain complementarity determining regions that comprise the sequences of SEQ ID NOs: 74-76 and SEQ ID NOs: 78, 79 (ESS), and 80.
2. The bispecific anti-HIV-1 antibody of claim 1, wherein the CDRH 1, CDRH 2, CDRH 3, CDRL 1, CDRL 2 and CDRL 3 of the first antigen-binding domain comprise the sequences of SEQ ID NOs: 10-12 and SEQ ID NOs: 14, 15 (RSS), and 16, respectively.
3. The bispecific anti-HIV-1 antibody of claim 1, wherein the first antigen-binding domain comprises the sequences of SEQ ID NOs: 10-12 and SEQ ID NOs: 14, 15 (RSS), and 16, respectively and the second first antigen-binding domain comprises the sequences of SEQ ID NOs: 74-76 and SEQ ID NOs: 78, 79 (ESS), and 80.
4. The bispecific anti-HIV-1 antibody of claim 1, wherein the first antigen-binding domain and the second antigen-binding domain bind to two different antigens or two different epitopes.
5. The bispecific anti-HIV-1 antibody of claim 1, wherein the first antigen-binding domain is human, humanized, or chimeric.
6. The bispecific anti-HIV-1 antibody of claim 1, wherein the antibody comprises chemically linked Fabs.
7. The bispecific anti-HIV-1 antibody of claim 1, wherein the second antigen-binding domain recognizes the CD4 binding site (CD4bs) of HIV gp120 protein.
8. A pharmaceutical composition comprising the bispecific anti-HIV-1 antibody of claim 1 and a pharmaceutically acceptable carrier.
9. The pharmaceutical composition of claim 8, further comprising a second anti-HIV-1 antibody.
10. A vaccine composition comprising the bispecific anti-HIV-1 antibody of claim 1.
11. A method of treating an HIV-1 infection comprising: identifying a subject in need thereof, and administering to said subject a first therapeutic agent comprising a therapeutically effective amount of a first bispecific anti-HIV-1 antibody of claim 1.
12. The method of claim 11, further comprising administering a second therapeutic agent.
13. The method of claim 12, wherein the second therapeutic agent is selected from the group consisting of a non-nucleoside reverse transcriptase inhibitor, a protease inhibitor, an entry or fusion inhibitor, an integrase inhibitor, and a second anti-HIV-1 antibody or antigen binding portion thereof.
14. The method of claim 13, wherein the second anti-HIV-1 antibody is selected from the group consisting of NC37, NC133, NC102, AC40, AC41, AC72, 3BNC117, and VRC01.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4) The bNAbs are indicated on the left and the time points when the samples were collected are indicated above the charts. The bars below the pies show when antibody transcripts were detected by PCR.
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
DETAILED DESCRIPTION
A. Definitions
(14) An anti-HIV-1 antibody may take one of numerous forms in the art, as disclosed herein. Antibodies are in part defined by the antigens to which they bind, thus, an anti-HIV-1 antibody is any such antibody which specifically binds at least one epitope found on the viral envelope of human immunodeficiency virus 1 (HIV-1), e.g. within gp120 and/or gp140, as described herein. It is understood in the art that an antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof. A heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH1, CH2 and CH3). A light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL). The variable regions of both the heavy and light chains comprise framework regions (FWR) and complementarity determining regions (CDR). The four FWR regions are relatively conserved while CDR regions (CDR1, CDR2 and CDR3) represent hypervariable regions and are arranged from NH2 terminus to the COOH terminus as follows: FWR1, CDR1, FWR2, CDR2, FWR3, CDR3, FWR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen while, depending on the isotype, the constant region(s) may mediate the binding of the immunoglobulin to host tissues or factors. It is known in the art that it is possible to manipulate monoclonal and other antibodies and use techniques of recombinant DNA technology to produce other antibodies or chimeric molecules which retain the specificity of the original antibody. Such techniques may evolve introducing DNA encoding the immunoglobulin variable region, or CDRs, of an antibody to the constant regions, or constant regions plus framework regions, of a different immunoglobulin.
(15) The term antibody (Ab) as used herein is used in the broadest sense and specifically may include any immunoglobulin, whether natural or partly or wholly synthetically produced, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (for example, bispecific antibodies and polyreactive antibodies), and antibody fragments. Thus, the term antibody as used in any context within this specification is meant to include, but not be limited to, any specific binding member, immunoglobulin class and/or isotype (e.g., IgG1, IgG2a, IgG2b, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE) and biologically relevant fragment or specific binding member thereof, including but not limited to Fab, F(ab).sub.2, scFv (single chain or related entity) and (scFv).sub.2.
(16) The term antibody fragments as used herein may include those antibody fragments obtained using techniques readily known and available to those of ordinary skill in the art, as reviewed herein. Therefore, in addition to the definition for antibody presented supra, the term antibody may further encompass any polypeptide or protein comprising a portion of an intact antibody, such as the antigen binding or variable region of the intact antibody. These can be derived from natural sources, or they may be partly or wholly synthetically produced. Examples of antibody fragments include, but are not limited to, Fab, Fab, F(ab)2, and Fv fragments; diabodies, and linear antibodies. The terms antigen binding portion, antigen binding fragment or Fab as used herein may refer to a region on an antibody that binds to antigens. One of ordinary skill in the art will understand that Fabs are comprised of one constant one variable domain of each of the heavy and light chain of an antibody.
(17) The term monoclonal antibody or mAb as used herein may refer to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies may include but chimeric antibodies, humanized antibodies, recombinant antibodies, and human antibodies. Methods of producing monoclonal antibodies are well known in the art, with some specific examples discussed infra including hybridoma technology, recombinant antibody production, e.g. by phage display or yeast display technology, production by transgenic mice, and single B cell culture. Methods that involve amplifying heavy and/or light chains of antibody genes (e.g. a plasmid or cosmid) by PCR (or similar technology) either in vitro or in bacterial and/or mammalian and/or yeast systems are considered to be within the scope of this present invention.
(18) The terms conservative sequence modifications or conservative substitutions as used herein may refer to amino acid modifications to a target epitope of the invention that does not significantly affect or alter the binding characteristics of the anti-HIV-1 antibodies to the epitope(s). Such conservative modifications include amino acid substitutions, additions and deletions. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, one or more amino acid residues within a target epitope that the anti-HIV-1 antibodies of the invention specifically bind to, e.g. epitopes on the viral envelope of HIV-1, e.g. epitopes on gp120 and/or gp140, can be replaced with other amino acid residues from the same side chain family and the antibodies of the present invention can be tested against the target epitope can be tested, for example using functional assays described herein or otherwise known in the art.
(19) The term biological sample refers to a sample obtained from an organism (e.g., patient) or from components (e.g., cells) of an organism. The sample may be of any biological tissue, cell(s) or fluid. The sample may be a clinical sample which is a sample derived from a subject, such as a human patient. Such samples include, but are not limited to, saliva, sputum, blood, blood cells (e.g., white cells), bodily fluids, lavages, pancreatic juices, gastric juices, discharges, CSF, lymph amniotic fluid, plasma, semen, bone marrow, and tissue or fine needle biopsy samples, urine, stool, peritoneal fluid, and pleural fluid, or cells therefrom, and any combinations thereof. Biological samples may also include sections of tissues such as frozen sections taken for histological purposes. A biological sample may also be referred to as a patient sample. A biological sample may also include a substantially purified or isolated protein, membrane preparation, or cell culture.
(20) The term bispecific antibody refers to artificial immunoglobulin constructs that are comprised of fragments of two different monoclonal antibodies that bind to two different antigens. There are several distinct types of bispecific antibodies, including but not limited to trifunctional antibodies and chemically linked Fabs. The anti-HIV-1 antibodies of the present invention may comprise bispecific antibodies, and include fragments of one or more different anti-HIV-1 antibodies, including one or more different anti-HIV-1 antibodies of the present invention, e.g. BG18 and BG1, or one or more anti-HIV-1 antibodies of the present invention and known anti-HIV-1 antibodies, e.g. BG18 and 3BNC117 (described in US 2014/0328862), or BG18 and VRC01, described in U.S. Pat. No. 8,637,036. Bispecific anti-HIV bNabs and methods of making and use thereof are described in PCT/US16/64713, hereby incorporated by reference.
(21) The terms effective amount or therapeutically effective amount as used herein may refer to an amount of the compound or agent that is capable of producing a medically desirable result in a treated subject. The treatment method can be performed in vivo or ex vivo, alone or in conjunction with other drugs or therapy. A therapeutically effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
(22) The terms specific binding, selective binding, selectively binds, and specifically binds, may refer to antibody binding to an epitope on a predetermined antigen but not to other antigens. Typically, the antibody binds with an equilibrium dissociation constant (K.sub.D) of approximately less than 10.sup.6 M, such as approximately less than 10.sup.7 M, 10.sup.8 M, 10.sup.9 M or 10.sup.10 M or even lower when determined by, e.g., equilibrium dialysis or surface plasmon resonance (SPR) technology in a BIACORE 2000 surface plasmon resonance instrument using the predetermined antigen, e.g., an epitope on the viral envelope of HIV-1, e.g. gp120, as the analyte and the antibody as the ligand, or Scatchard analysis of binding of the antibody to antigen positive cells, and (ii) binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen.
(23) The term homology as used herein may refer to the existence of shared structure between two compositions. The term homology in the context of proteins may refer to the amount (e.g. expressed in a percentage) of overlap between two or more amino acid and/or peptide sequences. In the context of nucleic acids, the term may refer to the amount (e.g. expressed in a percentage) of overlap between two or more nucleic acid sequences. As used herein, the percent (%) homology between two sequences is equivalent to the percent identity between the two sequences. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % homology=# of identical positions/total # of positions100), taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. Such homology is well-represented in the art via local alignment tools and/or algorithms, e.g. BLAST and/or BLAST 2.0, and may include pairwise alignment, multiple sequence alignment methods, structural alignment methods, and/or phylogenetic analysis methods.
(24) The terms co-administration, co-administered, and in combination with as used herein may refer to the administration of at least two agents or therapies to a subject. In some embodiments, the co-administration of two or more agents/therapies is concurrent. In other embodiments, a first agent/therapy is administered prior to a second agent/therapy. Those of skill in the art understand that the formulations and/or routes of administration of the various agents/therapies used may vary. For example, the anti-HIV-1 antibodies of the present invention may be co-administered with each other, or may be co-administered alongside other antibodies, e.g. other broadly neutralizing antibodies, such as, for example, those broadly neutralizing anti-HIV antibodies disclosed in US 2014/0328862, e.g. 3BNC117, or VRC01, described in U.S. Pat. No. 8,637,036, hereby incorporated by reference in its entirety, or optionally, co-administered with other HIV agents. Co-administration may or may not occur simultaneously, e.g. one or more anti-HIV-1 antibody of the present invention may be administered prior to or after another anti-HIV-1 antibody of the present invention (or other anti-HIV antibody or other HIV agents), or may be administered at the same or substantially similar time. One of ordinary skill in the art will appreciate that co-administration is not meant to be limiting in time as it is meant to describe administration alongside other compounds and/or therapies as part of a patient regimen.
(25) The term HIV agent as used herein may refer to a therapy for the treatment of HIV that does not, by itself, comprise an anti-HIV-1 antibody. For example, non-nucleoside reverse transcriptase inhibitors (NNRTIs), nucleoside reverse transcriptase inhibitors (NRTIs), protease inhibitors (PIs), fusion inhibitors, CCR5 antagonists/entry inhibitors, integrase strand transfer inhibitors (INSTIs), and combinations thereof, would all be considered HIV agents, as they are non-antibody based therapeutic treatments that can be co-administered with one or more anti-HIV-1 antibodies of the present invention, and/or additional anti-HIV-1 antibodies. One of ordinary skill in the art will appreciate that this list should not be considered exhaustive and as the state of the art advances and additional treatments become available, they are considered within the scope of this definition.
(26) The term carriers as used herein may include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution. Examples of physiologically acceptable carriers include, but not limited to, buffers such as phosphate, citrate, and other organic acids; antioxidants including, but not limited to, ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as, but not limited to, serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as, but not limited to, polyvinylpyrrolidone; amino acids such as, but not limited to, glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including, but not limited to, glucose, mannose, or dextrins; chelating agents such as, but not limited to, EDTA; sugar alcohols such as, but not limited to, mannitol or sorbitol; salt-forming counterions such as, but not limited to, sodium; and/or nonionic surfactants such as, but not limited to, TWEEN; polyethylene glycol (PEG), and PLURONICS.
(27) The term treating or treatment of a disease refers to executing a protocol, which may include administering one or more drugs to a patient (human or otherwise), in an effort to alleviate signs or symptoms of the disease. Alleviation can occur prior to signs or symptoms of the disease appearing as well as after their appearance. Thus, treating or treatment includes preventing or prevention of disease. The terms prevent or preventing refer to prophylactic and/or preventative measures, wherein the object is to prevent or slow down the targeted pathologic condition or disorder. For example, in the case of infection with immunodeficiency virus 1 (HIV-1), preventing or preventing may arise in a situation where a course of treatment is advanced in order to prevent or stall infection by HIV-1, such as through passive vaccination. Such preventing or prevention also arise in the case of latent infection by HIV-1, for example in those individuals who are seropositive but are not exhibiting any symptoms (i.e. has not progressed to symptoms of AIDS), in which the object would be to prevent active infection and/or clear a patient of said HIV-1 infection. In addition, treating or treatment does not require complete alleviation of signs or symptoms, does not require a cure, and specifically includes protocols that have only a marginal, yet positive, effect on the patient.
(28) The term epitope as used herein may refer to the region of an antigen to which an antibody or T cell binds, e.g. a region of the viral envelope of HIV-1, including but not limited to a glycoprotein, e.g. gp120, or a region on a glycoprotein. An antigen refers to a substance that elicits an immunological reaction or binds to the products of that reaction.
(29) The terms purified or isolated antibody, peptide, polypeptide, or protein refers to a peptide, polypeptide, or protein, as used herein, may refer to a peptide, polypeptide, or protein that has been separated from other proteins, lipids, and nucleic acids with which it is naturally associated. The polypeptide/protein can constitute at least 10% (i.e., any percentage between 10% and 100%, e.g., 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, and 99%) by dry weight of the purified preparation. Purity can be measured by any appropriate standard method, for example, by column chromatography, polyacrylamide gel electrophoresis, or HPLC analysis. An isolated polypeptide/protein (e.g., anti-HIV-1 antibodies) described in the invention can be produced by recombinant DNA techniques.
B. Broadly Neutralizing Anti-HIV-1 Antibodies
(30) The present invention relates to broadly neutralizing anti-HIV-1 antibodies (bNabs) and antigen-binding portions thereof. In particular, the present invention relates to several distinct monoclonal antibodies, BG18, NC37, and BG1, their antigen-binding portions including but not limited to their complementarity determining regions (CDRs), and derivatives and variants thereof, which display broad and potent neutralization of HIV-1 in vivo (see Example 1 infra). Thus, the anti-HIV-1 antibodies of the present invention possess strong therapeutic utility, either alone or in combination with one another, or with other bNabs, or with other HIV treatments, as discussed herein.
(31) Each of BG18, NC37 and BG1 has distinct, non-overlapping epitopes. NC37 recognizes the CD4bs. NC37 and its clonal variants display characteristics of both V.sub.H1-2 and V.sub.H1-46-derived bNAbs; however, structural analyses suggest that NC37 recognizes Env in a V.sub.H1-46-type manner. Without wishing to be bound by theory, the long CDRH3 of NC37 is predicted to make contacts with the adjacent protomer on the trimer, thereby recognizing a quaternary trimer epitope, the core of which overlaps with the CD4bs.
(32) BG1 binds to the V1V2 region of Env, another frequent target of bNAbs arising during natural infection. BG1 represents the first antibody in this class (bNabs) to be isolated from a Clade B-infected donor. Its potency is similar to members of the VRC26 antibody family, such as those disclosed in N. A. Doria-Rose et al., Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies. Nature 509, 55-62 (2014), but is less potent than PG9/16 and PGDM1400 bNAbs. Like other V1V2 bNAbs isolated to date, BG1 has a long, tyrosine-rich CDRH3.
(33) BG18, the most potent of each of BG18, NC37 and BG1, is directed against the Asn332.sub.gp120-centered glycan patch at the base of V3 loop. This is a heavily glycosylated region that includes carbohydrates at positions Asn332.sub.gp120, Asn301.sub.gp120, Asn386.sub.gp120, Asn392.sub.gp120, Asn137.sub.gp120, Asn156.sub.gp120. A number of monoclonal bNAbs that bind to both protein and carbohydrate components at this site have been isolated, including PGT121-124, as described in L. M. Walker et al., Broad neutralization coverage of HIV by multiple highly potent antibodies. Nature 477, 466-470 (2011) and 10-1074, as described in H. Mouquet et al., Complex-type N-glycan recognition by potent broadly neutralizing HIV antibodies. Proceedings of the National Academy of Sciences of the United States of America 109, E3268-3277 (2012). All of these bNAbs were isolated from a Clade A donor and can be sub-classified into those that rely exclusively on the Asn332.sub.gp120 glycan (10-1074 and PGT124), and those that also make contacts with surrounding glycans in the V3 glycan patch (PGT121-123). BG18 and its clonal variants resemble 10-1074 in that they rely on Asn332.sub.gp120, but BG18 is more potent than published anti-V3 bNAbs and the first to be isolated from a Clade B donor.
(34) BG18 differs from previously characterized members of this class by a surprisingly distinctive orientation of the CDRH3 and the light chain domain. In addition, BG18 differs from other members of this group of antibodies in that it has a shorter CDRH3 and no insertions or deletions, while without wishing to be bound by theory, suggests that BG18-like antibodies may be easier to elicit. In the absence of a high-resolution structure of a BG18-Env complex, it is difficult to predict how the shorter CDRH3 of BG18 interacts with Env. Structural studies of Env complexes with PGT122 and 10-1074 Fabs demonstrate that they adopt a similar angle of approach, which is approximately perpendicular to the gp120 protomers within an Env trimer. The BG18-Env EM structure, although not of sufficient resolution to resolve detailed interactions, nevertheless demonstrates that BG18 approaches Env from a different angle, which is shifted by up to 40 towards the gp120 promoter relative to the approach angles of 10-1074 and PGT122. BG18 clonal variants and derivatives, including 354BG8, 354BG18, 354BG42, 354BG33, 354BG129, 354BG188, 354BG411, and 354BG426 along with their full-length sequences, heavy and light chain complementarity-determining regions (CDRs), are set forth below in Table 1. A dendrogram of BG18 variants is set forth in
(35) TABLE-US-00001 TABLE1 SequencesofBG18variants SEQ ID Name NO: Sequence 354BG8IgH 1 EVQLRESGPRLVKPSETLSLSCDVFGDSRPSDHSWTWVRQPPGK ALEWIGDVHYNGDNTYNPSLRGRVKIDVDRSTHRFSLTLKSLTA ADTGIYFCARNVIRVFGVISLGEWFHYGMDVWGPGTAVIVSS CDR1 2 GDSRPSDHS CDR2 3 VHYNGDN CDR3 4 NVIRVFGVISLGEWFHYGMDV 354BG8IgL 5 SSELTQAPSVSVSPGQTATIACSGPPLASRYTYWYRQKPGQAPV LIIFRDRQFPSGVSGRFSASKSGTTATLTIRDVQVEDEGDYYCQ SSDTSDSYKMFGGGTTLTVL CDR1 6 PLASRY CDR2 7 RDR CDR3 8 QSSDTSDSYKM 354BG18IgH 9 QVQLRESGPGLVKPSETLSLSCTVSNDSRPSDHSWTWVRQSPGK ALEWIGDIHYNGATTYNPSLRSRVRIELDQSIPRFSLKMTSMTA ADTGMYYCARNAIRIYGVVALGEWFHYGMDVWGQGTAVTVSS CDR1 10 NDSRPSDHS CDR2 11 IHYNGAT CDR3 12 NAIRIYGWALGEWFHYGMDV 354BG18IgL 13 SSELTQPPSVSVSPGQTARITCSGAPLTSRFTYWYRQKPGQAPV LIISRSSQRSSGWSGRFSASWSGTTVTLTIRGVQADDEADYYCQ SSDTSDSYKMFGGGTKLTVL CDR1 14 PLTSRF CDR2 15 RSS CDR3 16 QSSDTSDSYKM 354BG42IgH 17 EVQLRESGPGLVKPSETLSLSCDVFGDSRPSDHSWTWVRQPPGK ALEWIGDVHYNGDTTYNPSLRGRVKIDVDRSTHRFSLTLNSLTA ADTGIYFCARNVIRVFGVISLGEWFHYGMDVWGQGTAVTVSS CDR1 18 GDSRPSDHS CDR2 19 VHYNGDT CDR3 20 NVIRVFGVISLGEWFHYGMDV 354BG42IgL 21 SSELTQAPSVSVSPGQTATIACSGPPLASRYTYWYRQKPGQAPV LIIFRDRQFPSGVSGRFSASKSGTTATLTIRDVQVEDEGDYYCQ SSDTSDSYKMFGGGTTLTVL CDR1 22 PLASRY CDR2 23 RDR CDR3 24 QSSDTSDSYKM 354BG33IgH 25 QVQLRESGPGLVKPSETLSLTCTVSNDSRPSDHSWTWVRQSPGK ALEWIGDIHYNGATTYNPSLRSRVRIELDQSIPRFSLKMTSMTA ADTGMYYCARNAIRIYGVVALGEWFHYGMDVWGQGTAVTVSS CDR1 26 NDSRPSDHS CDR2 27 IHYNGAT CDR3 28 NAIRIYGVVALGEWFHYGMDV 354BG33IgL 29 SSELTQPPSVSVSPGQTAKITCSGAALTSRFTYWYRQKPGQAPV LIISRTSQRSSGWSGRFSASWSGTTVTLTIRGVQADDEGDYYCQ SSDTSDSYKMFGGGTKLTVL CDR1 30 ALTSRF CDR2 31 RTS CDR3 32 QSSDTSDSYKM 354BG129IgH 33 EVQLRESGPGLVKPSGNMALTCTISGDSRPSDHSWTWVRQSPGK ALEWIGDIHYGGDITYNPSLRSRVKLEVDTSTNRFFLKMTSLTV ADTGIYFCARNVIRVFGVIALGEWFHYGMDVWGQGTAITVSP CDR1 34 GDSRPSDHS CDR2 35 IHYGGDI CDR3 36 NVIRVFGVIALGEWFHYGMDV 354BG129IgL 37 SSELTQTPSVTVSPGETARIACSGPPLASRYCYWYRQKPGQAPV LIIFRDRQFSSGMSGRFASSHSGTTVTLTIRDVRVEDEADYYCQ SSDINDSYKMFGGGTKVTVL CDR1 38 PLASRY CDR2 39 RDR CDR3 40 QSSDINDSYKM 354BG188IgH 41 EVQLRESGPGLVKPSGNMALTCTISGDSRPSDHSWTWVRQSPGK TLEWIGDIHYGGDITYNPSLRSRVKLEVDTSSNRFFLKMTSLTV ADTGIYFCARNVIRVFGVIALGEWFHYGMDVWGQGTAITVSP CDR1 42 GDSRPSDHS CDR2 43 IHYGGDI CDR3 44 NVIRVFGVIALGEWFHYGMDV 354BG188IgL 45 SSELTQTASVTVSPGETARIACSGPPLASRYCYWYRQKPGQAPV LIIFRDRQFSSGISGRFSSSQSGTTVTLTIRDVRVEDEADYYCQ SSDTSDSFKMFGGGTKLTVL CDR1 46 PLASRY CDR2 47 RDR CDR3 48 QSSDTSDSFKM 354BG411IgH 49 QVQLRESGPGLVKPSGNMALTCTISGDSRPSDHSWTWVRQSPGK ALEWIGDIHYGGDITYNPSLRSRVELEVDRSTNRFFLKMTSLSV ADTGMYFCARNVIRVFGVIALGEWFHYGMDVWGQGTAITVSP CDR1 50 GDSRPSDHS CDR2 51 IHYGGDI CDR3 52 NVIRVFGVIALGEWFHYGMDV 354BG411IgL 53 SSELTQAPSVTVSPGDTARIACSGPPLATRYCYWYRQKSGQAPV LIIFRDRQFSSGVSGRFSSSQSGSTVTLTIRDVRVEDEADYYCQ SSDTSDSYKMFGGGTKLTVL CDR1 54 PLATRY CDR2 55 RDR CDR3 56 QSSDTSDSYKM 354BG419IgH 57 QVQLRESGPGLVKPSETLSLSCDVFGDSRPSDHSWTWVRQPPGK ALEWIGDIHYNGDKTYNPSLRGRVKIDVDRSTHRFSLTLNSLTA ADTGMYFCARNVIRVFGVISLGEWFHYGMDVWGPGTAVTVSS CDR1 58 GDSRPSDHS CDR2 59 IHYNGDK CDR3 60 NVIRVFGVISLGEWFHYGMDV 354BG419IgL 61 SSELTQAPSVSVSPGQTARIACSGPPLASRYTYWYRQKPGQAPV LIIFRDRQFPSGVSGRFSASKSGTTGTLTIRDVQAEDEGDYYCQ SSDTSDSYKMFGGGTTLTVL CDR1 62 PLASRY CDR2 63 RDR CDR3 64 QSSDTSDSYKM 354BG426IgH 65 QVQLRESGPGLVKPSGNMALTCTISGDSRPSDHSWTWVRQSPGK ALEWIGDIHYGGDITYNPSLRSRVKLEVDTSSNRFFLKMTSLTV ADTGIYFCARNVIRVFGVIALGEWFHYGMDVWGQGTAITVSP CDR1 66 GDSRPSDHS CDR2 67 IHYGGDI CDR3 68 NVIRVFGVIALGEWFHYGMDV 354BG426IgL 69 SSELTQAPSVTLSPGETARIACSGPPLASRYCYWYRQKPGQAPV LIIFRDRQFSSGISGRFSSSQSGTTVTLTIRDVRVEDEADYYCQ SSDNSDSFKMFGGGTKLTVL CDR1 70 PLASRY CDR2 71 RDR CDR3 72 QSSDNSDSFKM
(36) TABLE-US-00002 TABLE2 SequencesofBG1variants SEQID Name NO: Sequence BG1IgH 73 AEQLVESGGGLVPPGRSLRLSCSASGFYFPDYAMAWVRQAPGQG LQWVGFMRGWAYGGSAQFAAFAVGKFAISRDDGRNVVYLDVKNP TFEDTGVYFCAREQRNKDYRYGQEGFGYSYGMDVWGRGTTVVVS T CDR1 74 GFYFPDYA CDR2 75 MRGWAYGGSA CDR3 76 EQRNKDYRYGQEGFGYSYGMDV BG1IgL 77 DIHMTQSPVSLSASVGDRVTITCRASHFIANYVNWYQQKPGKAP TLLIFESSTLQRGVPSRFSAYGDGTEFTLSINTLQPEDFASYIC QQSHSPPVTFGAGTRVDQK CDR1 78 HFIANY CDR2 79 ESS CDR3 80 QQSHSPPVT BG22IgH 81 EERLVESGGGLVPPGRSLRLSCSAFDFYFPDYAMAWVRQAPGKG LEWIGFIRGWAYGQAAQYGKSASGRMTISRDDSRRVVYLDIKSP IEEDTGAYFCAREQRGGDGRYSGDGFGYPYGMDVWGRGTMVTVS A CDR1 82 DFYFPDYA CDR2 83 IRGWAYGQAA CDR3 84 EQRGGDGRYSGDGFGYPYGMDV BG22IgL 85 DILMTQSPVSLSASIGERITITCRASHFIANYVNWYQQRPGKAP KLLIFQSWTLNRGIPSRFSGYGDGTEFTLSISALQSEDFGTYIC QQSHSPPLSFGGGTRVDQT CDR1 86 HFIANY CDR2 87 QSW CDR3 88 QQSHSPPLS BG47IgH 89 EERLVESGGGLVPPGRSLRLSCSAFDFYFPDYAMAWVRQAPGRA LEWIGFIRGWAYGQSAQYGKSASGRMTISRDDSRRVVYLDIKSP THEDTGVYFCAREQRGANGRYGGDGFGYSYGMDVWGRGTMVSVS A CDR1 90 DFYFPDYA CDR2 91 IRGWAYGQSA CDR3 92 EQRGANGRYGGDGFGYSYGMDV BG47IgL 93 DIQMTQSPFTLSASVGERVTITCRASHFIANYVNWYQQRPGRAP KLLIFESSTLNRGVPSRFSGSGDGTEFTLSISALQSEDFATYIC QQSHSPPVSFGGGTRVDQT CDR1 94 HFIANY CDR2 95 ESS CDR3 96 QQSHSPPVS
(37) One of ordinary skill in the art will appreciate that the complementarity determining regions (CDRs) of most antibodies, e.g., NC37, BG1, including all variants of BG1, and BG18, including all variants of BG18, largely determine the biological activity of the antibodies by forming the paratope on the antibody, with the CDRH3 possessing the most distinctive character. Accordingly, the antibodies of the present invention may comprise NC37, its CDRs, BG1, its CDRs, and BG18, and its CDRs, including all variants of NC37, BG1, and BG18 and their respective CDRs. One of ordinary skill in the art will also realize that the antibodies of the present invention may contain conservative substitutions, including in the CDRs, and still be within the scope of the invention. Accordingly, some embodiments of the present invention are directed to antibodies and antigen-binding portions thereof expressing the CDRs listed in Tables 1 and 2.
(38) For example, some embodiments of the present invention are directed to antibodies or antigen-binding portions thereof having a heavy chain comprising one or more of SEQ ID NOs: 1, 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, and 89 or a certain degree of homology with one or more of SEQ ID NOs: 1, 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, and 89, e.g. at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, and any intervening ranges therein. One or more of SEQ ID NOs: 1, 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, and 89 may have conservative substitutions. Some embodiments of the present invention are directed to antibodies or antigen-binding portions thereof having a light chain comprising one or more of SEQ ID NOs: 5, 13, 21, 20, 37, 45, 53, 61, 69, 77, 85, and 93 or a certain degree of homology with one or more of SEQ ID NOs: 55, 13, 21, 20, 37, 45, 53, 61, 69, 77, 85, and 93, e.g. at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, and any intervening ranges therein. One or more of SEQ ID NOs: 5, 13, 21, 20, 37, 45, 53, 61, 69, 77, 85, and 93 may have conservative substitutions.
(39) IgG heavy chains are typically bout 400 to about 600 amino acids in size, more typically 450 to about 550 amino acids. The variable region of each heavy chain, irrespective of antibody class, is typically about 100-140 amino acids long, most typically about 110-130 amino acids. The light chains are typically about 210-220 amino acids long, more typically 211-217. The variable region of light chains are typically around 100-120 amino acids long.
(40) Some embodiments of the present invention are directed to antibodies or antigen-binding portions thereof having one or more CDRs within the heavy chain comprising one or more of SEQ ID NOs: 2-4, 10-12, 18-20, 26-28, 34-36, 42-44, 50-52, 58-60, 66-68, 74-76, 82-84, and 90-92 or a certain degree of homology with one or more of SEQ ID NOs: 2-4, 10-12, 18-20, 26-28, 34-36, 42-44, 50-52, 58-60, 66-68, 74-76, 82-84, and 90-92, e.g. at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, and any intervening ranges therein. One or more of SEQ ID NOs: 2-4, 10-12, 18-20, 26-28, 34-36, 42-44, 50-52, 58-60, 66-68, 74-76, 82-84, and 90-92 may have conservative substitutions.
(41) Some embodiments of the present invention are directed to antibodies or antigen-binding portions thereof having one or more CDRs within the light chain comprising one or more of SEQ ID NOs: 6, 7 (RDR), and 8, 14, 15 (RSS), and 16, 22, 23 (RDR), and 24, 30, 31 (RTS), and 32, 38, 39 (RDR), and 40, 46, 47 (RDR), and 48, 54, 55 (RDR), and 56, 62, 63 (RDR), and 64, 70, 71 (RDR), and 72, 78, 79 (ESS), and 80, 86, 87 (QSW), and 88, and 94, 95 (ESS), and 96 or a certain degree of homology with one or more of SEQ ID NOs: 6, 7 (RDR), and 8, 14, 15 (RSS), and 16, 22, 23 (RDR), and 24, 30, 31 (RTS), and 32, 38, 39 (RDR), and 40, 46, 47 (RDR), and 48, 54, 55 (RDR), and 56, 62, 63 (RDR), and 64, 70, 71 (RDR), and 72, 78, 79 (ESS), and 80, 86, 87 (QSW), and 88, and 94, 95 (ESS), and 96, e.g. at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, and any intervening ranges therein. One or more of SEQ ID NOs: 6, 7 (RDR), and 8, 14, 15 (RSS), and 16, 22, 23 (RDR), and 24, 30, 31 (RTS), and 32, 38, 39 (RDR), and 40, 46, 47 (RDR), and 48, 54, 55 (RDR), and 56, 62, 63 (RDR), and 64, 70, 71 (RDR), and 72, 78, 79 (ESS), and 80, 86, 87 (QSW), and 88, and 94, 95 (ESS), and 96 may have conservative substitutions.
(42) Furthermore, the antibodies of the present invention may be comprised of antigen binding portions, e.g. CDRs, from different individual bNabs, including but not limited to those bNabs of the present invention. Purely by way of example, an engineered derivative may comprise a light chain from one of NC37, BG1, or BG18, including any variants, and a heavy chain from a different bNab, including one of NC37, BG1, or BG18, including any variants. Or, an engineered derivative may comprise a light chain from one variant of BG18 and a heavy chain from another variant of BG18. One skilled in the art will recognize that recombinant antibody production methods allow for a significant number of recombinant antibodies, each of which is expressly considered to be within the scope of the present disclosure. Accordingly, the bNabs of the present invention may be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567. DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. The DNA also may be modified, for example, by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Such a non-immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.
(43) Once produced, recombinantly or otherwise, the anti-HIV-1 antibodies may be purified or isolated, such that the antibodies are substantially free from, for example, any serum, supernatant, or other cellular cultures or related materials. Methods of antibody purification are known in the art, and may include selective enrichment or specific isolation methods. For example, affinity purification may be used, such as class-specific affinity. Fractionation methods may also be employed at the outset to help isolate subset of sample proteins that include immunoglobulins. Typically, antigen-specific affinity is applied to isolate antibodies that bind to the antigen. The antibodies may then be combined with a carrier, buffer, diluent, solvent, and/or preservatives, etc., that serve to create pharmaceutically acceptable anti-HIV-1 antibody compositions.
(44) The antibodies may be monovalent antibodies. Methods for preparing monovalent antibodies are well known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy chain crosslinking. Alternatively, the relevant cysteine residues are substituted with another amino acid residue or are deleted so as to prevent crosslinking. In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly, Fab fragments, can be accomplished using routine techniques known in the art.
(45) Human monoclonal antibodies can be produced using various techniques known in the art, including phage display libraries [Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991)]. The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985) and Boerner et al., J. Immunol., 147(1):86-95 (1991)]. Similarly, human antibodies can be made by introducing of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al., Bio/Technology 10, 779-783 (1992); Lonberg et al., Nature 368 856-859 (1994); Morrison, Nature 368, 812-13 (1994); Fishwild et al., Nature Biotechnology 14, 845-51 (1996); Neuberger, Nature Biotechnology 14, 826 (1996); Lonberg and Huszar, Intern. Rev. Immunol. 13 65-93 (1995).
(46) Some embodiments of the invention are directed to vectors and vector systems containing nucleotide sequences that code for the variable regions, including but not limited to CDRs of the anti-HIV-1 antibodies of the present invention, e.g. NC37, BG1, and BG18, including any variants, and antigen-binding portions thereof. The vector may be, for example but not necessarily, a plasmid; other recombinant vectors are known in the art and may include, e.g. phage vectors such as a 2 phage vector, other viral vectors such as non-replicating adenoviral vector, cosmids, and/or artificial chromosomes. A vector system may or may not be separately inducible, i.e. have different promoter and/or repressor elements. Common to most engineered vectors are origin of replications, multicloning sites, and selectable markers, so as long as a vector (including systems of vectors, e.g. multiple plasmids) contain such a system they are considered to be covered by the scope of this invention. It is well within one of ordinary skill in the art to derive nucleic acid sequences from a given peptide sequence and clone them into a system of choice. Accordingly, some embodiments, the present invention is directed to a vector or system of vectors containing one or more nucleic acid sequences encoding one or more of SEQ ID NO: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, 65, 73, 77, 81, 85, 89, and 93. In some embodiments, the present invention is directed to a vector or system of vectors containing one or more nucleic acid sequences encoding one or more CDRs of one or more heavy and/or light chains of one or more of the anti-HIV-1 antibodies of the present invention, e.g. nucleotide sequence or sequences coding for one or more of SEQ ID NOs: 2-4, 6, 7 (RDR), and 8, 10-12, 14, 15 (RSS), and 16, 18-20, 22, 23 (RDR), and 24, 26-28, 30, 31 (RTS), and 32, 34-36, 38, 39 (RDR), and 40, 42-44, 46, 47 (RDR), and 48, 50-52, 54, 55 (RDR), and 56, 58-60, 62, 63 (RDR), and 64, 66-68, 70, 71 (RDR), and 72, 74-76, 78, 79 (ESS), and 80, 82-84, 86, 87 (QSW), and 88, 90-92, and 94, 95 (ESS), and 96 and combinations thereof. These nucleotides encoding the heavy/light chains and/or CDRs may have conservative substitutions and for those encoding the CDRs, independent of such conservative substitutions, may share a certain degree of homology (e.g. at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%) with the nucleotide sequences. The vector or vector system of the present invention may be introduced into one or more cells (i.e. the cells are transformed with the vector), and such means are known within the art.
C. Pharmaceutical Formulations and Delivery
(47) One embodiment of the present invention is directed towards pharmaceutical compositions comprising at least one anti-HIV-1 antibody or antigen-binding portion thereof of the present invention, as well as their methods of use in treating a patient in need thereof. The patient may have a latent or active infection by HIV-1. The anti-HIV-1 antibodies or antigen-binding portions thereof utilized in these compositions and methods may be any anti-HIV-1 antibody or antigen-binding portion thereof of the present invention, but of particular utility are those anti-HIV antibodies or antigen-binding portions thereof that comprise BG18 or variants, including recombinantly produced variants, and/or engineered derivatives thereof.
(48) A pharmaceutically acceptable anti-HIV-1 antibody or antigen-binding portions thereof composition suitable for patient administration will contain an effective amount of the anti-HIV-1 antibody or antibodies or antigen-binding portions thereof in a formulation which both retains biological activity while also promoting maximal stability during storage within an acceptable temperature range. The pharmaceutical compositions can also include, depending on the formulation desired, pharmaceutically acceptable diluents, pharmaceutically acceptable carriers and/or pharmaceutically acceptable excipients, or any such vehicle commonly used to formulate pharmaceutical compositions for animal or human administration. The diluent is selected so as not to affect the biological activity of the combination. Examples of such diluents are distilled water, physiological phosphate-buffered saline, Ringer's solutions, dextrose solution, and Hank's solution. The amount of an excipient that is useful in the pharmaceutical composition or formulation of this invention is an amount that serves to uniformly distribute the antibody throughout the composition so that it can be uniformly dispersed when it is to be delivered to a subject in need thereof. It may serve to dilute the antibody to a concentration which provides the desired beneficial palliative or curative results while at the same time minimizing any adverse side effects that might occur from too high a concentration. It may also have a preservative effect. Thus, for antibodies having a high physiological activity, more of the excipient will be employed. On the other hand, for any active ingredient(s) that exhibit a lower physiological activity, a lesser quantity of the excipient will be employed.
(49) The pharmaceutically acceptable composition may be in liquid form or solid form. A solid formulation is generally, but not necessarily, lyophilized and brought into solution prior to administration for either single or multiple dosing. The formulations should not be exposed to extreme temperature or pH so as to avoid thermal denaturation. Thus, it is essential to formulate an antibody composition of the present invention within a biologically relevant pH range. A solution buffered to maintain a proper pH range during storage is often necessary, especially for liquid formulations stored for longer periods of time between formulation and administration. Typically, both liquid and solid formulations require storage at lower temperatures (usually 2-8 C.) in order to retain stability for longer periods. Formulated antibody compositions, especially liquid formulations, may contain a bacteriostat to prevent or minimize proteolysis during storage, including but not limited to effective concentrations (usually <1% w/v) of benzyl alcohol, phenol, m-cresol, chlorobutanol, methylparaben, and/or propylparaben. A bacteriostat may be contraindicated for some patients. Therefore, a lyophilized formulation may be reconstituted in a solution either containing or not containing such a component. Additional components may be added to either a buffered liquid or solid antibody formulation, including but not limited to sugars as a cryoprotectant (including but not necessarily limited to polyhydroxy hydrocarbons such as sorbitol, mannitol, glycerol and dulcitol and/or disaccharides such as sucrose, lactose, maltose or trehalose) and, in some instances, a relevant salt (including but not limited to NaCl, KCl or LiCl). Such antibody formulations, especially liquid formulations slated for long term storage, will rely on a useful range of total osmolarity to both promote long term stability at temperature of 2-8 C., or higher, while also making the formulation useful for parenteral injection. For example, but not necessarily, an effective range of total osmolarity (the total number of molecules in solution) may be from about 200 mOs/L to about 800 mOs/L. It will be apparent that the amount of a cyroprotectant, such as sucrose or sorbitol, will depend upon the amount of salt in the formulation in order for the total osmolarity of the solution to remain within an appropriate range. Therefore a salt free formulation may, but not necessarily, contain from about 5% to about 25% sucrose.
(50) Alternatively, a salt free sorbitol-based formulation may, but not necessarily, contain sorbitol within a range from about 3% to about 12%. Salt-free formulations may warrant increased ranges of the respective cryoprotectant in order to maintain effective osmolarity levels. These formulation may also contain a divalent cation (including but not necessarily limited to MgCl.sub.2, CaCl2) and MnCl.sub.2); and a non-32 ionic surfactant (including but not necessarily limited to Polysorbate-80 (Tween 80), Polysorbate-60 (Tween 60), Polysorbate-40 (Tween 40) and Polysorbate-20 (Tween 20), polyoxyethylene alkyl ethers, including but not limited to Brij 58, Brij 35, as well as others such as Triton X-100, Triton X 114, NP40, Span 85 and the Pluronic series of non-ionic surfactants (e.g., Pluronic 121)). Any combination of such components, including probable inclusion of a bacteriostat, may be useful to fill the antibody-containing formulations of the present invention. The anti-HIV-1 antibodies or antigen-binding portions thereof of the present invention may also be a chemical derivative, which describes antibodies that contain additional chemical moieties which are not normally a part of the immunogloblulin molecule (e.g., pegylation). Such moieties may improve the solubility, half-life, absorption, etc. of the base molecule. Alternatively the moieties may attenuate undesirable side effects of the base molecule or decrease the toxicity of the base molecule.
(51) For in vivo treatment, the patient is administered or provided a pharmaceutical formulation including at least one anti-HIV antibody or antigen-binding portion thereof of the present invention. When used for in vivo therapy, the anti-HIV antibodies or antigen-binding portions thereof of the invention are administered to the patient in therapeutically effective amounts (i.e., amounts that eliminate or reduce the total viral load, as described in Example 1 infra). The antibodies are administered to a human patient, in accord with known methods, such as intravenous administration, for example, as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes. The antibodies or antigen-binding portions thereof can be administered parenterally, when possible, at the target cell site, or intravenously. In some embodiments, antibody is administered by intravenous or subcutaneous administration. Therapeutic compositions of the invention may be administered to a patient or subject systemically, parenterally, or locally. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
(52) For parenteral administration, the anti-HIV-1 antibodies or antigen-binding portions thereof may be formulated in a unit dosage injectable form (solution, suspension, emulsion) in association with a pharmaceutically acceptable, parenteral vehicle. Examples of such vehicles include, but are not limited, water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin. Non-aqueous vehicles include, but are not limited to, fixed oils and ethyl oleate. Liposomes can be used as carriers. The vehicle may contain minor amounts of additives such as substances that enhance isotonicity and chemical stability, such as, for example, buffers and preservatives.
(53) The anti-HIV-1 antibodies or antigen-binding portions thereof of the present invention may be administered to the host in any manner, strategy and/or combination available in the art in amounts sufficient to offer a therapeutic treatment against HIV-1. These compositions may be provided to the individual by a variety of routes known in the art, especially parenteral routes, including but in no way limited to parenteral routes such as intravenous (IV), intramuscular (IM); or subcutaneous (SC) administration, with IV administration being the norm within the art of therapeutic antibody administration. These compositions may be administered as separate or multiple doses (i.e., administration of the antibody at staggered times by maintaining the sterile condition of the formulation through the treatment regime).
(54) The dose and dosage regimen depends upon a variety of factors readily determined by a physician, such as the nature of the infection, for example, its therapeutic index, the patient, and the patient's history. Generally, a therapeutically effective amount of an antibody is administered to a patient. In some embodiments, the amount of antibody administered is in the range of about 0.001 mg/kg to about 100 mg/kg of patient body weight, and any range in between. Depending on the type and severity of the infection, about 0.1 mg/kg to about 50 mg/kg body weight (for example, about 0.1-15 mg/kg/dose) of antibody is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. The anti-HIV-1 antibodies can be delivered relatively low volume rates, for example but not necessarily from about 0.001 ml/day to 10 ml/day so as to minimize tissue disturbance or trauma near the site where the formulation is released. The formulation may be released at a rate of, depending on the specific biological agent(s), at a low dose, e.g., from about 0.01 g/hr or 0.1 g/hr, 0.25 g/hr, 1 g/hr, generally up to about 200 g/hr, or the formulation is delivered at a low volume rate e.g., a volume rate of from about 0.001 mL/day to about 1 mL/day, for example, 0.01 micrograms per day up to about 20 milligrams per day. Dosage depends on a number of factors such as potency, bioavailability, and toxicity of the active ingredient used (e.g. the anti-HIV-1 antibodies or antigen-binding portions thereof) and the requirements of the subject. The progress of this therapy is readily monitored by conventional methods and assays and based on criteria known to the physician or other persons of skill in the art. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
(55) Specific embodiments for delivery vehicles for anti-HIV-1 antibodies of the present invention include PLGA microspheres, as discussed herein and as further known in the art, as well as polymer-based non-degradable vehicles comprising poly(ethylene-co-vinyl acetate; PEVAc). Additionally, controlled-release and localized delivery of antibody-based therapeutic products is reviewed in Grainger, et al., 2004, Expert Opin. Biol. Ther. 4(7): 1029-1044). Suitable microcapsules capable of encapsulating the antibody may also include hydroxymethylcellulose or gelatin-microcapsules and polymethyl methacrylate microcapsules prepared by coacervation techniques or by interfacial polymerization. See PCT publication WO 99/24061 entitled Method for Producing IGF-1 Sustained-Release Formulations, wherein a protein is encapsulated in PLGA microspheres, this reference which is hereby incorporated herein by reference in its entirety. In addition, microemulsions or colloidal drug delivery systems such as liposomes and albumin microspheres, may also be used. Other preferred sustained-release compositions employ a bioadhesive to retain the antibody at the site of administration. As noted above, the sustained-release formulation may comprise a biodegradable polymer into which the antibody is disposed, which may provide for non-immediate release. Non-injectable devices may be described herein as an implant, pharmaceutical depot implant, depot implant, non-injectable depot or some such similar term. Common depot implants may include, but are not limited to, solid biodegradable and non-biodegradable polymer devices (such as an extended polymer or coaxial rod shaped device), as well as numerous pump systems also known in the art. Injectable devices are split into bolus injections (release and dissipation of the drug subsequent to injection), and repository or depot injections, which provide a storage reservoir at the site of injection, allowing for sustained-release of the biological agent over time. A depot implant may be surgically tethered to the point of delivery so as to provide an adequate reservoir for the prolonged release of the antibody over time. Such a device will be capable of carrying the drug formulation in such quantities as therapeutically or prophylactically required for treatment over the pre-selected period. The depot implant may also provide protection to the formulation from degradation by body processes (such as proteases) for the duration of treatment. As known in the art, the term sustained-release refers to the gradual (continuous or discontinuous) release of such an agent from the block polymer matrix over an extended period of time. Regardless of the specific device, the sustained-release of the composition will result in a local biologically effective concentrations of the antibody. A sustained release of the biological agent(s) will be for a period of a single day, several days, a week or more; but most likely for a month or more, or up to about six months, depending on the formulation. Natural or synthetic polymers known in the art will be useful as a depot implant due to characteristics such as versatile degradation kinetics, safety, and biocompatibility. These copolymers can be manipulated to modify the pharmacokinetics of the active ingredient, shield the agent from enzymatic attack, as well as degrading over time at the site of attachment or injection. The artisan will understand that there are ample teachings in the art to manipulate the properties of these copolymers, including the respective production process, catalysts used, and final molecular weight of the sustained-release depot implant or depot injection. Natural polymers include but are not limited to proteins (e.g., collagen, albumin or gelatin); polysaccharides (cellulose, starch, alginates, chitin, chitosan, cyclodextrin, dextran, hyaluronic acid) and lipids. Biodegradable synthetic polymers may include but are not limited to various polyesters, copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al., 1983, Biopolymers 22:547-556), polylactides ([PLA]; U.S. Pat. No. 3,773,919 and EP 058,481), polylactate polyglycolate (PLGA) such as polylactide-co-glycolide (see, for example, U.S. Pat. Nos. 4,767,628 and 5,654,008), polyglycolide (PG), polyethylene glycol (PEG) conjugates of poly(-hydroxy acids), polyorthoesters, polyaspirins, polyphosphagenes, vinylpyrrolidone, polyvinyl alcohol (PVA), PVA-g-PLGA, PEGT-PBT copolymer (polyactive), methacrylates, poly(N-isopropylacrylamide), PEO-PPO-PEO (pluronics), PEO-PPO-PAA copolymers, PLGA-PEO-PLGA, polyorthoesters (POE), or any combinations thereof, as described above (see, for example, U.S. Pat. No. 6,991,654 and U.S. patent application No. 20050187631, each of which is incorporated herein by reference in its entirety, hydrogels (see, for example, Langer et al., 1981, J. Biomed. Mater. Res. 15:167-277; Langer, 1982, Chem. Tech. 12:98-105, non-degradable ethylene-vinyl acetate (e.g. ethylene vinyl acetate disks and poly(ethylene-co-vinyl acetate)), degradable lactic acid-glycolic acid copolymers such as the Lupron Depot, poly-D-()-3-hydroxybutyric acid (EP 133,988), hyaluronic acid gels (see, for example, U.S. Pat. No. 4,636,524), alginic acid suspensions, polyorthoesters (POE), and the like. Polylactide (PLA) and its copolymers with glycolide (PLGA) have been well known in the art since the commercialization of the Lupron Depot, approved in 1989 as the first parenteral sustained-release formulation utilizing PLA polymers. Additional examples of products which utilize PLA and PLGA as excipients to achieve sustained-release of the active ingredient include AMIDOX (PLA; periodontal disease), NUTROPIN DEPOT (PLGA; with hGH), and the TRELSTAR DEPOT (PLGA; prostate cancer). Other synthetic polymers included but are not limited to poly(c-caprolactone), poly3-hydroxybutyrate, poly(-malic acid) and poly(dioxanone)]; polyanhydrides, polyurethane (see WO 2005/013936), polyamides, cyclodestrans, polyorthoesters, n-vinyl alcohol, polyethylene oxide/polyethylene terephthalate, polyphosphate, polyphosphonate, polyorthoester, polycyanoacrylate, polyethylenegylcol, polydihydropyran, and polyacytal. Non-biodegradable devices include but are not limited to various cellulose derivatives (carboxymethyl cellulose, cellulose acetate, cellulose acetate propionate, ethyl cellulose, hydroxypropyl methyl cellulose) silicon-based implants (polydimethylsiloxane), acrylic polymers, (polymethacrylate, polymethylmethacrylate, polyhydroxy(ethylmethylacrylate), as well as polyethylene-co-(vinyl acetate), poloxamer, polyvinylpyrrolidone, poloxamine, polypropylene, polyamide, polyacetal, polyester, poly ethylene-chlorotrifluoroethylene, polytetrafluoroethylene (PTFE or Teflon), styrene butadiene rubber, polyethylene, polypropylene, polyphenylene oxide-polystyrene, poly-a-chloro-p-xylene, polymethylpentene, polysulfone and other related biostable polymers. Carriers suitable for sustained-release depot formulations include, but are not limited to, microspheres, films, capsules, particles, gels, coatings, matrices, wafers, pills or other pharmaceutical delivery compositions. Examples of such sustained-release formulations are described above. See also U.S. Pat. Nos. 6,953,593; 6,946,146; 6,656,508; 6,541,033; and 6,451,346, the contents of each which are incorporated herein by reference. The dosage form must be capable of carrying the drug formulation in such quantities and concentration as therapeutically required for treatment over the pre-selected period, and must provide sufficient protection to the formulation from degradation by body processes for the duration of treatment. For example, the dosage form can be surrounded by an exterior made of a material that has properties to protect against degradation from metabolic processes and the risk of, e.g., leakage, cracking, breakage, or distortion. This can prevent expelling of the dosage form contents in an uncontrolled manner under stresses it would be subjected to during use, e.g., due to physical forces exerted upon the drug release device as a result of normal joint articulation and other movements by the subject or for example, in convective drug delivery devices, physical forces associated with pressure generated within the reservoir. The drug reservoir or other means for holding or containing the drug must also be of such material as to avoid unintended reactions with the active agent formulation, and is preferably biocompatible (e.g., where the dosage form is implanted, it is substantially non-reactive with respect to a subject's body or body fluids). Generally, the anti-HIV-1 antibodies are administered to an individual for at least 12 hours to at least a week, and most likely via an implant designed to deliver a drug for at least 10, 20, 30, 100 days or at least 4 months, or at least 6 months, 12 months, 24 months or more, as required.
(56) In some embodiments, the anti-HIV-1 antibodies or antigen-binding portions thereof of the present invention may be co-administered with one or more additional treatments for HIV-1, e.g. co-administered with one or more HIV agents (e.g. non-nucleoside reverse transcriptase inhibitors (NNRTIs), nucleoside reverse transcriptase inhibitors (NRTIs), protease inhibitors (PIs), fusion inhibitors, CCR5 antagonists/entry inhibitors, integrase strand transfer inhibitors (INSTIs), and combinations thereof) and/or additional anti-HIV-1 antibodies or antigen-binding portions thereof, including but not limited to additional anti-HIV-1 antibodies or antigen-binding portions thereof of the present invention. As shown in Example 1 infra, a 1:1:1 administration of NC17, BG1, and BG18 was effective to reduce viral load in vivo. While not wishing to be bound by theory, the data indicates that monoclonal bNAbs and very low levels of neutralization sensitive viruses co-exist in EB354 suggesting that antibodies contribute to elite control in this individual. According to another embodiment, the present invention provides a passive vaccine or pharmaceutical compositions containing at least one anti-HIV-1 antibody or antigen-binding portions thereof of the invention and a pharmaceutically acceptable carrier. According to one embodiment, the vaccine or pharmaceutical compositions is a composition containing at least one antibody described herein and a pharmaceutically acceptable excipient. The vaccine can include a plurality of the antibodies having the characteristics described herein in any combination and can further include other anti-HIV-1 antibodies or antigen-binding portions thereof. The passive vaccine may comprise one or more pharmaceutically acceptable preservatives, carriers, and/or excipients, which are known in the art. In other embodiments, the present invention provides an active vaccine or pharmaceutical compositions containing HIV-1 or an antigenic fragment thereof. If HIV-1 is used, it may be attenuated. It may be heat-killed. If antigenic fragments are utilized, it may be preferable, although not necessary, to use glycoprotein gp120, although fragments of glycoprotein gp120 may be acceptable.
(57) The present compositions may be used in an immunogenic composition to immunize an animal. Such immunogenic composition according to the invention may be used for the preparation of a vaccine. Preferably a prophylactic and/or therapeutic vaccine is produced. Thus, within the scope of this invention is an immunogenic or vaccine composition that contains a pharmaceutically acceptable carrier and an effective amount of an antigen as described supra. The carriers used in the composition can be selected on the basis of the mode and route of administration, and standard pharmaceutical practice. The composition can also contain an adjuvant. Examples of an adjuvant include a cholera toxin, Escherichia coli heat-labile enterotoxin, liposome, unmethylated DNA (CpG) or any other innate immune-stimulating complex. Various adjuvants that can be used to further increase the immunological response depend on the host species and include Freund's adjuvant (complete and incomplete), mineral gels such as aluminum hydroxide, surface-active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol.
(58) A vaccine formulation may be administered to a subject per se or in the form of a pharmaceutical or therapeutic composition. Compositions of the invention and an adjuvant may be manufactured by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes. Pharmaceutical compositions may be formulated in conventional manner using one or more physiologically acceptable carriers, diluents, excipients or auxiliaries which facilitate processing of the antigens of the invention into preparations which can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen.
(59) For injection, vaccine preparations may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hanks' solution, Ringer's solution, phosphate buffered saline, or any other physiological saline buffer. The solution may contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the composition may be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
(60) The amount of a composition administered depends, for example, on the particular antigen in the composition, whether an adjuvant is co-administered with the antigen, the type of adjuvant co-administered, the mode and frequency of administration, and the desired effect (e.g., protection or treatment), as can be determined by one skilled in the art. Determination of an effective amount of the vaccine formulation for administration is well within the capabilities of those skilled in the art, especially in light of the detailed disclosure provided herein. An effective dose can be estimated initially from in vitro assays. For example, a dose can be formulated in animal models to achieve an induction of an immune response using techniques that are well known in the art. One having ordinary skill in the art could readily optimize administration to all animal species based on results described herein. Dosage amount and interval may be adjusted individually. For example, when used as a vaccine, the vaccine formulations of the invention may be administered in about 1 to 3 doses for a 1-36 week period. Vaccination may continue indefinitely depending on the circumstances, particularly with passive vaccination. Preferably, 1 or 2 doses are administered, at intervals of about 3 weeks to about 4 months, and booster vaccinations may be given periodically thereafter. Alternative protocols may be appropriate for individual animals. A suitable dose is an amount of the vaccine formulation that, when administered as described above, is capable of raising an immune response in an immunized animal sufficient to protect the animal from an infection for at least 4 to 12 months. In general, the amount of the antigen present in a dose ranges from about 1 g to about 100 mg per kg of host, typically from about 10 g to about 1 mg, and preferably from about 100 g to about 1 pg. Suitable dose range will vary with the route of injection and the size of the subject, but will typically range from about 0.1 mL to about 5 mL. Additional boosters can be given as needed.
D. Kits and Diagnostic Methods
(61) One embodiment of the present invention is directed to kits for detecting HIV-1 present in a sample. These kits may comprise an anti-HIV-1 antibody or antigen-binding portion thereof of the present invention and various reagents, for example, reagents that aid in detection of binding between the anti-HIV-1 antibody and an epitope present on HIV-1, e.g. gp120 and/or gp140, or an antigenic fragment thereof.
(62) The kits may be in vitro assays, such as immunoassays, e.g. enzyme immune assays (EIA), enzyme linked immunosorbent assay (ELISA), ELISPOT (enzyme-linked immunospot), radioimmunoassays (RIAs), immunofluorescence, and other assays known in the art, including but not limited to Western Blot analysis and/or immunoprecipitation methods. The in vitro assays may be competitive, or indirect, such as in a sandwich assay, or may be an antibody capture method. For example in a direct ELISA, a buffered solution of an antigen, e.g. a sample containing HIV-1 or an antigenic fragment thereof or a biological sample containing or suspected of containing HIV-1, is added to a well of a microtiter plate, e.g. a 96-well plate. A solution of non-reacting protein, e.g. bovine serum albumin or casein is then added to the well. The anti-HIV-1 antibody or antigen-binding portions thereof conjugated to a reporter molecule enzyme is added, e.g. conjugated to horse-radish peroxidase, although that is not necessarily the enzyme, as other common enzymes include alkaline phosphatase, or -D-galactosidase, although other enzymes are conceivable and considered embodied by the present invention. A substrate for the enzyme is then added, which leads to a detectable signal. For example, adding TMB to horseradish peroxidase leads to a colored product, in which case the ELISA is a colorimetric assay. ELISAs may be run in a qualitative or quantitative format. Qualitative results provide a simple positive or negative result (yes or no) for a sample. The cutoff between positive and negative is determined by the analyst and may be statistical. Sandwich ELISAs generally follow the following protocol. Capture anti-HIV-1 antibody or antigen-binding portions thereof is bound to (i.e. immobilized) on a substrate, e.g. a mictotiter plate. Antigen-containing sample (i.e. sample containing HIV-1 or an antigenic fragment thereof, is then added to the substrate at which point it is captured by the anti-HIV-1 antibodies. The substrate is then washed to remove unbound antigen. A second anti-HIV-1 antibody or antigen-binding portions thereof is added, which binds to a different epitope on HIV-1, such as different epitopes on gp120, or on different antigens, such as gp140. The second anti-HIV-1 antibody or antigen-binding portions thereof is bound to a reporter molecule, e.g. an enzyme, although the reporter molecule may be any molecule which leads to a detectable signal. The plate may be washed a second time, and in those instances where the reporter molecule is an enzyme, a substrate may be added, e.g. TMB, that results in a detectable signal (also a colorimetric assay). A third type of common ELISA is competitive ELISA. In these embodiments, unlabeled anti-HIV-1 antibody or antigen-binding portions thereof is incubated in the presence of an antigen-containing sample which are then added to an antigen-coated well. The plate is washed so as to remove unbound antibodies. A secondary antibody that is specific to the primary antibody, e.g. a secondary antibody specific to anti-HIV-1 antibodies. The secondary antibody is bound to a reporter molecule, as described herein, such as an enzyme (or any other molecule that may lead to a detectable signal). Some competitive ELISA utilize labeled antigens rather than labeled antibodies; the less antigen in the sample, the more labeled antigen is retained and the stronger a detectable signal results.
(63) Other forms of common in vitro assays include radioimmunoassays (RIAs). Typically a known quantity of an antigen is linked to a radioactive tracer, e.g. I-125 although others are suitable for use, such as 99Tc, which is then mixed with a known amount of antibody specific for the antigen, e.g. anti-HIV-1 antibodies or antigen-binding portions thereof. Then, a sample containing unknown quantity of an antigen is added, (e.g. a biological sample that contains or is suspected of containing HIV-1 or an antigenic fragment thereof) is added. This is a direct competitive for specific binding; as the concentration of unlabeled antigen is increased, the binding between the anti-HIV-1 antibodies and the labeled standard is decreased, which is directly measurable by measuring radioactivity. Other assays are known and a person of ordinary skill in the art would readily recognize their applicability.
(64) In some embodiments, the invention is directed to a method of detecting HIV-1 or an antigenic fragment thereof in a sample. Such methods may utilize any of the assays described herein, or others that are known in the art. Several of the assays described herein are capable of quantifying the amount of antigen present in a sample, and so accordingly, in some embodiments, the present invention is directed to methods of quantifying the amount of HIV-1 or antigenic fragments thereof present in a sample, e.g. a biological sample.
(65) The assays containing anti-HIV-1 antibodies or antigen-binding portions thereof of the present invention may or may not be utilized for diagnostic purposes. Accordingly, in some embodiments, the invention is directed to methods of diagnostic use of the anti-HIV-1 antibodies or antigen-binding portions thereof of the present invention. Because of the specificity of the anti-HIV-1 antibodies or antigen-binding portions thereof of the present invention, immunoassays containing anti-HIV-1 antibodies or antigen-binding portions thereof of the present invention may be sufficient to diagnose an individual as having an active or latent infection of HIV-1. The antibodies or antigen-binding portions thereof need not be restricted to any particular epitopes, so long as the antibodies or antigen-binding portions thereof used are specific to HIV-1. For example, in a sandwich assay, the first anti-HIV-1 antibody or antigen-binding portions thereof may bind to a first epitope, such as on gp120, and the second anti-HIV-1 antibody or antigen-binding portions thereof (which is bound to a reporter molecule) may bind to a second epitope, which may or may not be present on the same antigen. Accordingly, kits and methods used to detect or quantify the amount of HIV-1 or an antigenic fragment thereof may contain BG18, NC37, and BG1, including antigen-binding portions thereof, and would be considered within the scope of this invention. Or, any of BG18, NC37, and BG1, including antigen-binding portions thereof, and any other anti-HIV-1 antibody, so long as they are suitable for incorporation into such kits/methods. One will appreciate that the anti-HIV-1 antibodies or antigen-binding portions thereof used for purposes of detecting and/or quantifying HIV-1 present in a sample or even for diagnostic purposes do not necessarily need to be capable of broadly neutralizing HIV-1 to possess utility for such purposes.
E. Equivalents
(66) Where a value of ranges is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges which may independently be included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either both of those included limits are also included in the invention.
(67) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference in their entireties.
(68) As used herein and in the appended claims, the singular forms a, and and the include plural references unless the context clearly dictates otherwise.
(69) The term about refers to a range of values which would not be considered by a person of ordinary skill in the art as substantially different from the baseline values. For example, the term about may refer to a value that is within 20%, 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value, as well as values intervening such stated values.
(70) Publications disclosed herein are provided solely for their disclosure prior to the filing date of the present invention. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
(71) Each of the applications and patents cited in this text, as well as each document or reference, patent or non-patent literature, cited in each of the applications and patents (including during the prosecution of each issued patent; application cited documents), and each of the PCT and foreign applications or patents corresponding to and/or claiming priority from any of these applications and patents, and each of the documents cited or referenced in each of the application cited documents, are hereby expressly incorporated herein by reference in their entirety. More generally, documents or references are cited in this text, either in a Reference List before the claims; or in the text itself, and, each of these documents or references (herein-cited references), as well as each document or reference cited in each of the herein-cited references (including any manufacturer's specifications, instructions, etc.), is hereby expressly incorporated herein by reference.
(72) The following non-limiting examples serve to further illustrate the present invention.
EXAMPLES
(73) 1. Co-Existence of Potent HIV-1 Broadly Neutralizing Antibodies and Antibody-Sensitive Viruses in a Viremic Controller
A. Methods
(74) HIV-1-Infected Subject EB354
(75) Purified IgG from donor EB354 ranked in the top 1% for neutralization breadth and potency in a cohort of 394 HIV-1 infected long-term non-progressors. Donor EB354 was diagnosed with HIV-1 Clade B in 1986. He received treatment with didanosine and stavudine between 1995 and 1998, but has had no antiretroviral therapy since that time. He has been clinically followed frequently since 2002 (Table 3: HLA A*01:01, 24:02, B*27:05, 57:01, C*01:02, 06:02). Most individuals rapidly develop strain specific antibodies shortly after infection. This response is associated with selection for resistant viral variants that in some cases elicit bNAbs. However, the individuals studied in detail differ from EB354 in that the development of bNAbs is associated with rapid selection of autologous plasma viruses, which are resistant to co-existing bNAbs. EB354 is significant because sensitive and resistant viral strains co-exist with bNAbs and the resistant strains fail to produce high levels of viremia either because they are in some way partially effective or kept in check by CD8+ T cells. Thus the bNAb sensitive plasma viruses were unable to escape immune pressure in this individual, resulting in bNAb: virus equilibrium, where the virus persists, but is incapable of producing high levels of viremia. EB354 is unusual in being both an elite controller and elite neutralizer. HIV-1 elite controllers are infected individuals that maintain low viral loads for many years. These individuals are less likely to transmit the virus and they maintain long-term AIDS-free survival. HLA alleles B57*01 and/or B27*05 are found in 85% of HIV-1 elite controllers. These alleles are associated with enhanced CD8 T cell cytotoxic activity. Compared to viremic progressors (i.e., patients with high viral loads), elite controllers are less likely to develop bNAbs. Irrespective of robust CD8+ T cell responses that may have partially controlled infection, there was sufficient HIV-1 replication in EB354 to support bNAb development and affinity maturation. As discussed herein, the bNAbs that account for serologic neutralizing activity in donor EB354 recognize several non-overlapping epitopes.
(76) TABLE-US-00003 TABLE 3 Clinical information regarding donor EB354 diagnosis date 1986 HLA A101, 2402 B2705, 5701 Cw102, 602 visit date Viral Load CD4abs CD8abs Apr. 24, 2002 310 957 1406 Aug. 7, 2002 653 554 Dec. 3, 2002 2520 983 1787 Mar. 11, 2004 1035 1323 1634 Jun. 18, 2004 171 1231 1753 Aug. 20, 2004 467 Oct. 7, 2004 182 789 Feb. 28, 2005 1048 1227 Aug. 25, 2005 <400 1080 Nov. 17, 2005 1665 1551 Aug. 3, 2006 <400 Oct. 24, 2006 <400 744 1132 Nov. 15, 2006 206 814 Apr. 6, 2007 <400 564 Nov. 28, 2007 <400 781 Jul. 17, 2008 149 815 Mar. 17, 2009 107 734 Feb. 19, 2010 170 900 1933 Aug. 10, 2010 65 1096 1706 Jul. 13, 2011 380 795 1512 Mar. 28, 2013 414 1127 1809 Sep. 18, 2013 547 674 1152 Jul. 21, 2014 454 697 1321 Jul. 17, 2015 461 605 1224
B Cell Sorting and Antibody Isolation
(77) Single-cell sorting of bait.sup.+CD19.sup.+IgG.sup.+ B cells from donor EB354 PBMCs was conducted as described in J. F. Scheid et al., A method for identification of HIV gp140 binding memory B cells in human blood. Journal of immunological methods 343, 65-67 (2009). Memory B cells were pre-enriched with anti-CD19 magnetic beads (MACS) and stained using four different baits: the gp120 2CC core protein as bait, gp140YU2, a 1:1 mixture of gp 140.sub.92UG37.8 (Clade A)+gp140.sub.CZA79012 (Clades C) and BG505 SOSIP.664. Rescue primers were used to amplify both heavy chains and Ig genes and regular primers were used for IgK chain. All PCR products were sequenced and analyzed for Ig gene usage, CDR3, and the number of V.sub.H/V.sub.L somatic hypermutations (IgBLAST and IMGT). Purified, digested PCR products were cloned into human Ig1-, Ig or Ig-expression vectors as previously described in T. Tiller et al., Efficient generation of monoclonal antibodies from single human B cells by single cell RT-PCR and expression vector cloning. Journal of immunological methods 329, 112-124 (2008) and produced by transient transfection of IgH, IgK and IgL expression plasmids into exponentially growing HEK 293-6E cells as described in F. Klein et al., Enhanced HIV-1 immunotherapy by commonly arising antibodies that target virus escape variants. The Journal of experimental medicine 211, 2361-2372 (2014).
(78) Neutralization Studies
(79) HIV-1 neutralization was evaluated using the luciferase-based TZM.bl cell assay. Briefly, envelope pseudoviruses were incubated with fivefold serial dilutions of single antibodies and applied to TZM.bl cells that carry a luciferase reporter gene. After 48 hours, cells were lysed and luminescence was measured. IC.sub.50 and IC.sub.80 reflect single antibody concentrations that caused a reduction in relative luminescence units (RLU) by 50% and 80%, respectively. Coverage curves were built using the Antibody Database computational tool.
(80) Crystallization, X-Ray Data Collection and Structure Determinations
(81) Crystals of BG18 Fab in which a potential N-linked glycosylation site at heavy chain position 26 was removed by mutating Asn26HC to Gln showed superior size and morphology compared with crystals of wild-type BG18 Fab, thus the structure determination was done using BG18.sub.N26Q Fab. Crystals of BG18.sub.N26Q Fab (space group P2.sub.1; a=46.12 , b=71.04 , c=69.54 ; =98.48; 1 molecule per asymmetric unit); were obtained by combining 0.2 L of an 18 mg/mL protein solution with 0.2 mL of 0.1 M sodium acetate pH 4.5, 26.8% (v/v) polyethylene glycol (PEG) 400 and 13.4% (w/v) PEG 8,000 at 20 C., cryoprotected in mother liquor supplemented with 20% (v/v) ethylene glycol, and flash cooled in liquid nitrogen. Crystals of NC102 Fab (space group P2.sub.12.sub.12.sub.1; a=60.2 , b=82.5 , c=117.2 ; 1 molecule per asymmetric unit) were produced by vapor diffusion in sitting drops with a reservoir of 0.1 M sodium acetate trihydrate pH 4.6 and 2.0 M ammonium sulfate using 250 nL drops with a 1.5:1 protein: reservoir ratio. Crystals were cryoprotected in mother liquor supplemented with 25% (v/v) ethylene glycol and flash cooled in liquid nitrogen. Crystals of a NC37-93TH057 complex (space group P2.sub.12.sub.12.sub.1; a=63.6 , b=67.4 , c=210.4 ; 1 complex per asymmetric unit) were produced by vapor diffusion in 250 nL sitting drops by incubating protein and reservoir (comprising 0.1 M HEPES pH 7.5 and 20% (w/v) PEG 10,000) at a 1.5:1 protein: reservoir ratio. Crystals were cryoprotected in mother liquor supplemented with 20% (w/v) PEG 400 and flash cooled in liquid nitrogen.
(82) X-ray diffraction data were collected at the Stanford Synchrotron Radiation Lightsource beamline 12-2 outfitted with a Pilatus 6M pixel detector (Dectris). XDS was used to index, integrate and scale the data. Crystals of BG18N26Q Fab diffracted to 1.5 , and the structure was solved by molecular replacement using 10-1074 Fab (PDB code 4FQ2) V.sub.HV.sub.L with CDR loops removed and C.sub.H1C.sub.L as search models. The structure was refined using an iterative approach of refinement with Phenix and manual model building in Coot. The final model of BG18N26Q Fab (R.sub.work=18.0%, R.sub.free=18.9%) had 98.3%, 1.7% and 0% of residues in the favored, allowed, and disallowed regions, respectively, of the Ramachandran plot. NC102 Fab diffracted to 1.6 , and the structure was solved by molecular replacement using a model of NIH45-46 (PDB code 3U7W) with V.sub.HV.sub.L with CDR loops removed and C.sub.H1C.sub.L as search models. The final model of NC102 Fab (R.sub.work=18.0%, R.sub.free=20.0%) had 98%, 2% and 0% of residues in the favored, allowed, and disallowed regions, respectively, of the Ramachandran plot. The NC37-93TH057 gp120 complex structure was solved by molecular replacement using search models of NC102 V.sub.HV.sub.L, C.sub.H1C.sub.L, and a truncated gp120 core (from PDB 3U7Y) as search models. The final model of the NC37-93TH057 complex (R.sub.work=21.0%, R.sub.free=26.0%) had 96%, 4% and 0% of residues in the favored, allowed, and disallowed regions, respectively, of the Ramachandran plot. Data collection and refinement statistics are presented in Table 4.
(83) TABLE-US-00004 TABLE 4 Data collection and refinement statistics. 354NC37 + 354BG18 Fab 93TH057 354NC102 Fab Resolution range 35.44-1.3 (1.346-1.3) 38.6-2.7 (2.8-2.7) 38.91-1.60 (1.66-1.60) () Space group P2.sub.1 P2.sub.12.sub.12.sub.1 P2.sub.12.sub.12.sub.1 Unit cell dimensions a, b, c () 46.12, 71.04, 69.54 63.60, 67.41, 210.42 60.22, 82.50, 117.21 a, b, g () 90, 98.48, 90 90, 90, 90 90, 90, 90 Total reflections 634239 (60770) 172153 (17052) 515918 (48175) Unique reflections 106792 (10428) 25596 (2517) 77546 (7649) Multiplicity 5.9 (5.7) 6.7 (6.8) 6.7 (6.3) Completeness (%) 0.98 (0.98) 1.00 (1.00) 1.00 (1.00) Mean I/sigma (I) 14.48 (0.86) 14.80 (2.73) 11.12 (1.68) Wilson B-factor 14.92 41.63 15.84 (.sup.2) R-merge 0.06152 (1.772) 0.1272 (0.7028) 0.108 (1.031) CC1/2 0.999 (0.318) 0.996 (0.832) 0.997 (0.996) CC* 1 (0.694) 0.999 (0.953) R.sub.work 0.180 0.21 0.18 R.sub.free 0.189 0.26 0.2 Number of atoms 3616 6161 4159 macromolecules 3167 5924 3402 ligands 235 25 solvent 449 2 732 Protein residues 432 781 448 RMS (bonds) () 0.009 0.005 0.007 RMS (angles) () 1 0.96 1.145 Clashscore 6.17 13.99 3.41 Average B-factor 22.89 36.55 20.37 (.sup.2) macromolecules 21.3 35.77 17.77 ligands 56.03 34.45 solvent 34.17 34.8 31.96 Statistics for the highest-resolution shell are shown in parentheses.
(84) The structure of a BG505 SOSIP.664-BG18-179NC75 complex was solved by cryoelectron tomography/sub-tomogram averaging to 40 resolution and used as a reference structure to solve a single particle EM structure from negatively-stained samples. Purified BG505 SOSIP.664-BG18-179NC75 complexes were diluted to 10 g/mL in TBS immediately before adding 3 L to a glow-discharged ultrathin C film on holey carbon support film, 400 mesh, Cu grids (Ted Pella, Inc.). Samples on the grids were cross-linked using glutaraldehyde vapor and then stained with 3% uranyl acetate. Data were collected using a FEI Tecnai T12 transmission electron microscope operating at 120 keV equipped with a Gatan Ultrascan 2k2k CCD. Images were acquired using a 0.5 second exposure time at a nominal magnification of 42,000 at 1 m defocus, resulting in 2.5 per pixel. A total of 25,639 particles were picked using swarm picking in EMAN2.1, and the CTF correction was done using EMAN2.1. Initial reference-free 2D class averaging was performed using RELION and all particles were sorted into 250 classes. 9,827 particles corresponding to good class averages were selected, and the particles were further sorted using 3D classification in RELION, after which 7,925 particles were selected for refinement. To obtain a reference structure for 3D classification and refinement, data was collected from an independent BG505 SOSIP.664-BG18-179NC75 complex sample by cryoelectron tomography and a 40 sub-tomogram averaged structure was obtained using methods described in Scharf, L., et al., Broadly Neutralizing Antibody 8ANC195 Recognizes Closed and Open States of HIV-1 Env. Cell, 2015. 162 (6): p. 1379-90. The sub-tomogram averaged structure was low-pass filtered to 80 for use as the reference structure for single particle reconstruction. The resolution of the final single particle reconstruction was 25 calculated using RELION and a gold-standard FSC with a 0.143 cutoff, recommended for resolution estimations for single particle EM reconstructions.
(85) Fitting of EM Density Maps
(86) EM structures were visualized using USCF Chimera. Coordinates from crystal structures were fit into the sub-tomogram averaged or negative stain single particle EM structures using the fit in map utility within UCSF Chimera with the following options: real-time correlation/average update, use map simulated from atoms, resolution 25 . A BG505 SOSIP.664 structure (PDB 4TVP) was first fitted into the density, and then coordinates for BG18 Fab and CH103 Fab (PDB 4JAM; as a model for 179NC75 Fab) into corresponding densities individually. The CH1-CL domain regions of the Fabs exhibited poor densities.
(87) Protein Production and Purification for Structural Determination Studies
(88) 6-His-tagged BG18, BG18N26Q, NC102, and NC37 Fabs were expressed by transient transfection in HEK293-6E cells and purified from transfected cell supernatants using Ni2+-NTA affinity chromatography (GE Healthcare) and Superdex 200 16/60 size exclusion chromatography (SEC) (GE Healthcare). Truncated, His-tagged 93TH057 gp120 core protein was produced in baculovirus-infected insect cells and purified as described using Ni.sup.2+ affinity chromatography (GE Healthcare) (Diskin et al. Science 2011; Diskin et al. NSMB 2010). Prior to crystallization trials, purified NC37 and 93TH057 proteins were coincubated (2:1 molar ratio of Fab to gp120 core) and treated with 5 kU of Endoglycosidase H per mg of gp120 protein for 3 hours at 25 C. Endoglycosidase H-treated complex was purified by size exclusion chromatography using a Superdex 200 10/300 GL column (GE Healthcare).
(89) Soluble BG505 SOSIP.664 trimers for EM studies were constructed as described in Sanders, R. W., et al., A next-generation cleaved, soluble HIV-1 Env trimer, BG505 SOSIP.664 gp140, expresses multiple epitopes for broadly neutralizing but not non-neutralizing antibodies. PLoS Pathog, 2013. 9 (9): p. e1003618. HEK293-6E cells treated with 5 M kifunensine (Sigma) were co-transfected with plasmids encoding BG505 SOSIP.664 and soluble furin at a ratio of 4:1. BG505 SOSIP.664 protein was harvested from cell supernatants using a 2G12 immunoaffinity column made by covalently coupling 2G12 IgG monomer to an NHS-activated Sepharose column (GE Healthcare). Protein was eluted with 3M MgCl.sub.2 followed by immediate buffer exchange into Tris-buffered saline (TBS) pH 7.4 (50 mM NaCl). Trimers were further purified using Mono Q 5/50 GL (GE Healthcare) followed by Superose 6 10/300 SEC (GE Healthcare).
(90) Autologous Viruses
(91) Single genome sequencing (SGS) of HIV-1 env genes HIV-1-RNA was extracted from patient plasma using the Qiagen MinElute Virus Spin Kit according to manufacturer's instructions. Extracted RNA was subjected to Env specific cDNA Synthesis using SuperScript III Reverse Transcriptase and HIV-1 specific primer envB3out:
(92) TABLE-US-00005 envB5out: (SEQIDNO:97) 5-TAGAGCCCTGGAAGCATCCAGGAAG-3 envB3out: (SEQIDNO:98) 5-TTGCTACTTGTGATTGCTCCATGT-3 envB5in: (SEQIDNO:99) 5-TTAGGCATCTCCTATGGCAGGAAGAAG-3 envB3in: (SEQIDNO:100) 5-GTCTCGAGATACTGCTCCCACCC-3
(93) First round PCR was performed in a 20 L volume containing 1 High Fidelity buffer, 2 mM MgSO4, 0.2 mM dNTPs and 0.5 units of High Fidelity Platinum Taq using 0.2 M each of primers envB5out and envB3out. Second round PCR was performed using 1 L of PCR 1 and 0.2 M of primers of envB5 in and envB3 in. PCR conditions were the same as PCR-1 except for 45 cycles and an increased annealing temperature of 58 C. PCR-2 products were checked using 1% 96-well E-Gels (Invitrogen). Bands from PCRs with amplification efficiencies lower than 30% were subjected to library preparation and sequenced using the Illumina Nextera DNA Sample Preparation Kit (Illumina). CMV-Env expression cassettes were generated according to protocol set forth in J. L. Kirchherr et al., High throughput functional analysis of HIV-1 env genes without cloning. J Virol Methods 143, 104-111 (2007). 500 ng of CMV-env were co-transfected with pSG3env in 6-well plates into 293T cells and supernatant was harvested after 48 hours. All plasmids were sequence validated before expression. Supernatants were subjected to neutralization testing by TZM-bl assays.
(94) TZM-bl Assays of Env Glycol-Mutant Viruses
(95) Pseudoviruses were generated by transfection of 293T cells (ATCC) with an HIV-1 Env expressing plasmid and the Env-deficient genomic backbone plasmid called pSG3Env as described in Li, M., et al., Human immunodeficiency virus type 1 env clones from acute and early subtype B infections for standardized assessments of vaccine-elicited neutralizing antibodies. J Virol, 2005. 79(16): p. 10108-25. Pseudoviruses were harvested 72 hours post-transfection for use in neutralization assays. Neutralizing activity was assessed using a single round of replication pseudovirus assay and TZM-Bl target cells, as described in Li et al. above. Briefly, TZM-bl cells were seeded in a 96-well flat bottom plate. To this plate was added pseudovirus, which was pre-incubated with serial dilutions of antibody for 1 hour at 37 C. Luciferase reporter gene expression was quantified 72 hours after infection upon lysis and addition of Bright-Glo Luciferase substrate (Promega). To determine IC.sub.50 values, dose-response curves were fit by nonlinear regression.
(96) Synthesis of the HIV-1 V3 Glycopeptides
(97) The synthesis of the V3 glycopeptides derived from several HIV-1 strains was achieved by using a chemoenzymatic method that consisting of automated solid-phase peptide synthesis of the GlcNAc-peptide precursor and subsequent enzymatic transglycosylation of the GlcNAc-peptide to provide the target glycopeptides, following the procedures set forth in Amin, M. N., et al., Synthetic glycopeptides reveal the glycan specificity of HIV-neutralizing antibodies. Nat Chem Biol, 2013. 9(8): p. 521-6. The interactions between the biotinylated synthetic glycopeptides and the BG18 and BG8 IgG antibodies were evaluated by SPR using a Biacore T200 system (GE Healthcare) at 25 C. Biotinylated glycopeptides were immobilized on neutravidin-coated CM5 sensor chips in HBS-P buffer (10 mM HEPES, 150 mM NaCl, P20 surfactant 0.05% v/v, pH 7.4) until 200 response unit (RU) was achieved. BG18 (or BG8) was injected at two-fold series dilutions of concentration starting at 4 M in BS-P buffer with a flow rate of 40 L/min. for 180 s. BS-P buffer with a flow rate of 40 L/min was then injected for 1210s to allow for dissociation. Regeneration was performed by injection of 3M MgCl.sub.2 with a flow rate of 50 L/min. for 3 minutes followed by injection of HBS-P buffer with a flow rate of 50 L/min. for 5 minutes.
(98) In Vivo Mouse Model
(99) Humanized NOD Rag1.sup./Il2rg.sup.null (NOD.Cg-Rag1.sup.tm1Mom Il2rg.sup.tm1Wj1/SzJ) mice (The Jackson Laboratory) were treated with 1 mg of each antibody sub-cutaneously (s.c.) twice a week for a period of 3 weeks, getting a total of six antibody injections. Control hu-mice were reconstituted with human cells from the same donor and infected with HIV-1.sub.YU2 but not treated with antibodies. Plasma viral loads were measured weekly. The gp120 sequences from mice with rebounding virus were obtained as described in F. Klein et al., HIV therapy by a combination of broadly neutralizing antibodies in humanized mice. Nature 492, 118-122 (2012).
(100) ELISAs
(101) High-binding 96-well ELISA plates (Costar) were coated overnight with 5 g/mL of purified 2CC core, gp120.YU2 (wild type or mutants) or gp140.YU2 foldon trimer in PBS. After washing 6 times with PBS+0.05% Tween 20, the plates were blocked for 2 h with 2% BSA, 1 M EDTA and 0.05% Tween-PBS (blocking buffer), and then incubated for 1 hour with IgGs that were added as seven consecutive 1:4 dilutions in PBS from an initial concentration of 4 g/mL. After additional washing, the plates were developed by incubation with goat HRP-conjugated anti-human IgG antibodies (Jackson ImmunoResearch) (at 0.8 ug/mL in blocking buffer) for 1 hour followed by horseradish peroxidase (HRP) chromogenic substrate (ABTS solution; Invitrogen). For competition ELISAs, the plates were coated with 0.5 g/mL BG505.SOSIP.664, washed, blocked for 2 hours with blocking buffer and then incubated for 1 hour with IgGs added as seven consecutive 1:4 dilutions in PBS from an initial concentration of 32 g/mL, and in the presence of biotinylated antibody at a constant concentration of 4 g/mL. The plates were then developed using HRP-conjugated streptavidin (Jackson ImmunoReseach) (at 1 g/mL in blocking buffer).
(102) For ELISAs using BG505 SOSIP.664 trimers with a D7324 epitope tag (BG505 SOSIP.664-D7324) the plates were coated overnight with 5 g/mL of D7324 antibody as described in Sanders, R. W., et al., A next-generation cleaved, soluble HIV-1 Env trimer, BG505 SOSIP.664 gp140, expresses multiple epitopes for broadly neutralizing but not non-neutralizing antibodies. PLOS Pathog, 2013. 9 (9): p. e1003618, and then washed and incubated with 500 ng/ml of the trimer. After a further wash, IgGs were added for 1 h as seven consecutive 1:4 dilutions in PBS from initial concentrations of 4 g/mL. The endpoint was generated by incubation with goat HRP-conjugated anti-human IgG antibodies, as described above. All experiments were performed at least 3 times.
(103) Generation of CMV-Env Viruses
(104) CMV-env expression cassettes were generated according to an established protocol (52). Briefly, the CMV promoter was amplified from pcDNA 3.1D/V5-His-TOPO Expression vector using the following primers:
(105) TABLE-US-00006 CMVenv: (SEQIDNO:101) 5-AGTAATCAATTACGGGGTCATTAGTTCAT-3 and CMVenv1A (SEQIDNO:102) 5-CATAGGAGATGCCTAAGCCGGTGGAGCTCTGCTTATATAGACC TC-3.
(106) The PCR product was purified using the Macherey-Nagel PCR and Gel Purification Kit. 1 ul of first round PCR product was amplified using the following primers: env1ATOPO 5-CACCGGCTTAGGCATCTCCTATGGCAGGAAGAA-3 (SEQ ID NO: 103) and Rev19 5-ACTTTTTGACCACTTGCCACCCAT-3 (SEQ ID NO: 104) in a 20 L volume containing 1 High Fidelity Buffer, 2 mM MgSO4, 0.2 mM dNTPs, 0.5 units of High Fidelity Platinum Taq and 0.2 M of each primer. Cycling conditions were 94 C., 2 min.; (94 C., 15 seconds; 55 C. 30 seconds; 68 C., 4 minutes)35; 68 C., 10 minutes. The presence of env was validated by analysis on a 0.7% Agarose gel and the product was purified using the Macherey-Nagel Gel and PCR Purification Kit. 10 ng of envelope and 0.5 ng of CMV were then subjected to overlapping PCR with primers CMVenv and Rev19 in triplicates. Total reaction volume 6 was 50 L containing 1 High Fidelity Buffer, 0.2 M MgSO4, 0.2 mM dNTPs, 1 unit of High Fidelity Platinum Taq and 0.4 M of each primer. PCR was carried out at 94 C., 2 min.; (94 C., 30 seconds; 60 C. 30 seconds; 68 C., 4 minutes)25; 68 C., 10 min. 500 ng of CMV-env were co-transfected with pSG3env in 6-well plates into 293T cells and supernatant was harvested after 48 hours. Supernatants were subjected to neutralization testing by TZM-bl as described supra.
Culture Virus (VOA)
(107) Virus from donor EB354 was obtained by co-culture of patient peripheral blood mononuclear cells (PBMCs) with healthy donor PBMCs as described in van't Wout et al., Isolation and propagation of HIV-1 on peripheral blood mononuclear cells. Nat Protoc, 2008. 3(3): p. 363-70. Healthy donor PBMCs were obtained from patients by leukapheresis under study protocol MNU-0628 at Rockefeller University. Healthy donor PBMCs were pre-stimulated at a density of 510.sup.6 cells per mL in IMDM containing 10% FBS, 1% Penicillin-Streptomycin and PHA at 1 g/mL for 2-3 days at 37 C. and 5% CO.sub.2. 610.sup.6 of the stimulated donor PBMCs were then transferred to IMDM containing 10% FBS, 1% Penicillin-Streptomycin, 10 IU/mL IL-2 and 5 g/mL polybrene and co-cultured with 5-1010.sup.6 EB354 PBMCs at 37 C. and 5% CO.sub.2. Media was replaced weekly and the presence of p24 in culture supernatant was quantified by Lenti-X p24 Rapid Titer Kit (Clontech). Cultures exceeding 1 ng of p24 per mL of supernatant were frozen and stored at 80 C. Determination of tissue culture infectious dose 50 (TCID.sub.50) and subsequent testing for sensitivity of autologous viruses to different broadly neutralizing antibodies and autologous serum IgG was carried out using a TZM-bl neutralization assay according to protocols described supra. All neutralization assays were run in duplicates.
(108) HIV-1.sub.YU2 Envelope Mutants
(109) Single, double and triple mutations were introduced into wild-type HIV-1YU2 envelope using the QuikChange (multi-) site-directed mutagenesis kit, according to the manufacturer's specifications (Agilent Technologies).
(110) Analysis of Viral Evolution
(111) Alignments of env nucleotide sequences were generated using ClustalW (version 2.11) or via manual alignment using Geneious (version 8.1.6) sequence analysis software. Regions that could not be unambiguously aligned were removed for phylogenetic analysis and diversity calculations. Evolutionary model classes for maximum likelihood phylogenetic analyses were selected using jModelTest. Maximum likelihood phylogenetic trees were generated using PhyML (version 3) with joint estimation of model parameter values and phylogenies. Pairwise genetic diversity was compared among samples using a two-sample U statistic test in the DIVEIN webtool.
(112) Bioinformatic Processing of MiSeq Env-Sequences
(113) Sequence adapters were removed using Cutadapt v1.8.3. Read assembly for each virus was performed in three steps. First, de novo assembly was performed using Spades v3.6.1 to yield long contig files. Contigs longer than 255 bp were subsequently aligned to an HIV envelope reference sequence and a consensus sequence was generated using Geneious 8. Finally, reads were re-aligned to the consensus sequence to close gaps and a final consensus was generated. Sequences with double peaks (cutoff consensus identity for any residue <75%) were omitted from downstream analysis.
(114) Statistical Analyses
(115) Statistical differences were analyzed by the Mann-Whitney test. GraphPad Prism software was used for analysis, and data were considered significant at +p0.05, ** p0.01, and *** p0.001.
B. Results
(116) Multiple bNAbs
(117) Purified IgG from donor EB354 ranked in the top 1% for neutralization breadth and potency in a cohort of 394 HIV-1 infected long-term non-progressors. This donor was diagnosed with HIV-1 Clade B in 1986. EB354 received treatment with didanosine and stavudine between 1995 and 1998, but has had no antiretroviral therapy since that time. In 2002 EB354's viral load was <400 copies/mL and CD4 and CD8 counts were 954 and 1046 cells/mm.sup.3, respectively. EB354 had three documented peaks in viremia between 2002 and 2006 (
(118) To isolate the antibodies that account for this subject's serologic activity, single cells were sorted using four different HIV-1 baits; 2CC core, gp140.sub.YU2, a 1:1 mixture of gp140.sub.92UG37.8 (Clade A)+gp140.sub.CZA79012 (Clades C) and BG505 SOSIP.664 (
(119) To map the binding sites of the antibodies in the 3 neutralizing clones, TZM-bl assays were performed using HIV-1YU2 variants carrying epitope specific point mutations in Env. Whereas the polyclonal IgG showed no measurable change in sensitivity to the mutants, antibody BG18 was sensitive to YU2.sub.N332K (glycan-V3), antibody BG1 to YU2.sub.N160K (V1V2), and antibody NC37 to YU2.sub.N280Y (CD4bs) (
(120) BG18 neutralized 64% of viruses in a 118-virus panel (
(121) TABLE-US-00007 TABLE 5 IC50 and IC80 values in TZM-bl assay for BG18. BG18 Virus ID Clade IC50 IC80 6535.3 B 0.001 0.005 QH0692.42 B 0.013 0.042 SC422661.8 B 0.005 0.021 PVO.4 B 0.003 0.013 TRO.11 B 0.001 0.002 AC10.0.29 B 0.001 0.003 RHPA4259.7 B 1.437 >30 THRO4156.18 B >30 >30 REJO4541.67 B >30 >30 TRJO4551.58 B 3.341 26.938 WITO4160.33 B 0.018 0.250 CAAN5342.A2 B 0.008 0.040 WEAU_d15_410_787 B (T/F) 0.003 0.012 1006_11_C3_1601 B (T/F) 0.001 0.004 1054_07_TC4_1499 B (T/F) 0.005 0.022 1056_10_TA11_1826 B (T/F) 0.007 0.045 1012_11_TC21_3257 B (T/F) 0.003 0.012 6240_08_TA5_4622 B (T/F) 0.003 0.010 6244_13_B5_4576 B (T/F) 0.011 0.049 62357_14_D3_4589 B (T/F) 3.008 >30 SC05_8C11_2344 B (T/F) 0.003 0.016 Du156.12 C 0.003 0.010 Du172.17 C >30 >30 Du422.1 C 0.009 0.057 ZM197M.PB7 C >30 >30 ZM214M.PL15 C >30 >30 ZM233M.PB6 C 2.866 29.805 ZM249M.PL1 C >30 >30 ZM53M.PB12 C >30 >30 ZM109F.PB4 C >30 >30 ZM135M.PL10a C 0.029 0.161 CAP45.2.00.G3 C >30 >30 CAP210.2.00.E8 C 3.469 10.748 HIV-001428-2.42 C 0.004 0.021 HIV-0013095-2.11 C 10.516 29.966 HIV-16055-2.3 C >30 >30 HIV-16845-2.22 C 0.019 0.090 Ce1086_B2 C (T/F) >30 >30 Ce0393_C3 C (T/F) >30 >30 Ce1176_A3 C (T/F) 0.004 0.012 Ce2010_F5 C (T/F) >30 >30 Ce0682_E4 C (T/F) >30 >30 Ce1172_H1 C (T/F) 0.002 0.007 Ce2060_G9 C (T/F) >30 >30 Ce703010054_2A2 C (T/F) >30 >30 BF1266.431a C (T/F) >30 >30 246F C1G C (T/F) 0.034 0.257 249M B10 C (T/F) >30 >30 ZM247v1(Rev-) C (T/F) 1.454 8.725 7030102001E5(Rev-) C (T/F) 0.002 0.008 1394C9G1(Rev-) C (T/F) 0.029 0.350 Ce704809221_1B3 C (T/F) 4.394 >30 CNE19 BC >30 >30 CNE20 BC 0.002 0.006 CNE21 BC 0.002 0.007 CNE17 BC 0.020 0.109 CNE30 BC 0.019 0.059 CNE52 BC 0.012 0.045 CNE53 BC 0.003 0.011 CNE58 BC 0.024 0.073 MS208.A1 A >30 >30 Q23.17 A 0.006 0.020 Q461.e2 A >30 >30 Q769.d22 A >30 >30 Q259.d2.17 A >30 >30 Q842.d12 A 13.986 >30 3415.v1.c1 A 0.023 0.087 3365.v2.c2 A 0.013 0.037 191955_A11 A (T/F) >30 >30 191084 B7-19 A (T/F) 0.011 0.043 9004SS_A3_4 A (T/F) 0.005 0.056 T257-31 CRF02_AG >30 >30 928-28 CRF02_AG 0.761 3.934 263-8 CRF02_AG 1.380 7.548 T250-4 CRF02_AG 0.001 0.006 T251-18 CRF02_AG 0.086 0.328 T278-50 CRF02_AG 2.947 12.875 T255-34 CRF02_AG >30 >30 211-9 CRF02_AG 1.299 5.529 235-47 CRF02_AG 0.005 0.017 620345.c01 CRF01_AE >30 >30 CNE8 CRF01_AE >30 >30 C1080.c03 CRF01_AE 5.369 >30 R2184.c04 CRF01_AE >30 >30 R1166.c01 CRF01_AE >30 >30 R3265.c06 CRF01_AE >30 >30 C2101.c01 CRF01_AE >30 >30 C3347.c11 CRF01_AE >30 >30 C4118.c09 CRF01_AE >30 >30 CNE5 CRF01_AE >30 >30 BJOX009000.02.4 CRF01_AE 24.376 >30 BJOX015000.11.5 CRF01_AE (T/F) >30 >30 BJOX010000.06.2 CRF01_AE (T/F) >30 >30 BJOX025000.01.1 CRF01_AE (T/F) >30 >30 BJOX028000.10.3 CRF01_AE (T/F) 0.474 14.851 X1193_c1 G 0.005 0.022 P0402_c2_11 G 0.005 0.029 X1254_c3 G 0.004 0.012 X2088_c9 G 0.004 0.009 X2131_C1_B5 G 0.002 0.008 P1981_C5_3 G 0.006 0.019 X1632_S2_B10 G >30 >30 3016.v5.c45 D >30 >30 A07412M1.vrc12 D 0.081 1.715 231965.c01 D >30 >30 231966.c02 D >30 >30 191821_E6_1 D (T/F) 14.076 >30 3817.v2.c59 CD 0.219 1.059 6480.v4.c25 CD 0.016 0.116 6952.v1.c20 CD 0.005 0.011 6811.v7.c18 CD 0.001 0.006 89-F1_2_25 CD >30 >30 3301.v1.c24 AC 0.025 0.082 6041.v3.c23 AC >30 >30 6540.v4.c1 AC 28.197 >30 6545.v4.c1 AC >30 >30 0815.v3.c3 ACD 0.160 5.964 3103.v3.c10 ACD 0.002 0.005 BG505/T332N A <0.0001 0.002 YU2_WT B 0.033 0.198 YU2_N276D B 0.012 0.036 YU2_N332K B >30 >30 YU2_N160K B 0.028 0.150 YU2_N280Y B 0.005 0.016
(122) TABLE-US-00008 TABLE 6 IC50 and IC80 values in TZM-bl assay for NC37. NC37 Virus ID Clade IC50 IC80 6535.3 B >30 >30 QH0692.42 B 0.582 2.054 SC422661.8 B 0.071 0.321 PVO.4 B 0.412 2.825 TRO.11 B 0.337 1.761 AC10.0.29 B >30 >30 RHPA4259.7 B 0.345 2.289 THRO4156.18 B >30 >30 REJO4541.67 B 0.104 0.304 TRJO4551.58 B 0.143 1.615 WITO4160.33 B 0.733 17.779 CAAN5342.A2 B 0.911 3.694 WEAU_d15_410_787 B (T/F) 0.037 0.133 1006_11_C3_1601 B (T/F) 0.054 0.207 1054_07_TC4_1499 B (T/F) >30 >30 1056_10_TA11_1826 B (T/F) 1.048 5.510 1012_11_TC21_3257 B (T/F) 0.099 0.638 6240_08_TA5_4622 B (T/F) 1.236 6.388 6244_13_B5_4576 B (T/F) 5.574 >30 62357_14_D3_4589 B (T/F) 1.860 29.422 SC05_8C11_2344 B (T/F) 0.202 0.714 Du156.12 C >30 >30 Du172.17 C >30 >30 Du422.1 C >30 >30 ZM197M.PB7 C 3.098 17.368 ZM214M.PL15 C >30 >30 ZM233M.PB6 C >30 >30 ZM249M.PL1 C >30 >30 ZM53M.PB12 C >30 >30 ZM109F.PB4 C >30 >30 ZM135M.PL10a C >30 >30 CAP45.2.00.G3 C >30 >30 CAP210.2.00.E8 C >30 >30 HIV-001428-2.42 C 0.124 2.275 HIV-0013095-2.11 C >30 >30 HIV-16055-2.3 C >30 >30 HIV-16845-2.22 C >30 >30 Ce1086_B2 C (T/F) 2.322 20.996 Ce0393_C3 C (T/F) >30 >30 Ce1176_A3 C (T/F) >30 >30 Ce2010_F5 C (T/F) >30 >30 Ce0682_E4 C (T/F) >30 >30 Ce1172_H1 C (T/F) >30 >30 Ce2060_G9 C (T/F) >30 >30 Ce703010054_2A2 C (T/F) >30 >30 BF1266.431a C (T/F) >30 >30 246F C1G C (T/F) >30 >30 249M B10 C (T/F) >30 >30 ZM247v1(Rev-) C (T/F) >30 >30 7030102001E5(Rev-) C (T/F) >30 >30 1394C9G1(Rev-) C (T/F) >30 >30 Ce704809221_1B3 C (T/F) >30 >30 CNE19 BC >30 >30 CNE20 BC >30 >30 CNE21 BC >30 >30 CNE17 BC >30 >30 CNE30 BC 0.915 11.813 CNE52 BC >30 >30 CNE53 BC >30 >30 CNE58 BC >30 >30 MS208.A1 A >30 >30 Q23.17 A >30 >30 Q461.e2 A >30 >30 Q769.d22 A 0.242 1.574 Q259.d2.17 A >30 >30 Q842.d12 A 0.255 1.821 3415.v1.c1 A 0.183 0.654 3365.v2.c2 A >30 >30 191955_A11 A (T/F) >30 >30 191084 B7-19 A (T/F) 0.064 0.208 9004SS_A3_4 A (T/F) >30 >30 T257-31 CRF02_AG >30 >30 928-28 CRF02_AG >30 >30 263-8 CRF02_AG 0.269 1.523 T250-4 CRF02_AG >30 >30 T251-18 CRF02_AG 1.835 7.857 T278-50 CRF02_AG >30 >30 T255-34 CRF02_AG >30 >30 211-9 CRF02_AG >30 >30 235-47 CRF02_AG 14.369 >30 620345.c01 CRF01_AE >30 >30 CNE8 CRF01_AE >30 >30 C1080.c03 CRF01_AE >30 >30 R2184.c04 CRF01_AE 0.025 0.082 R1166.c01 CRF01_AE >30 >30 R3265.c06 CRF01_AE >30 >30 C2101.c01 CRF01_AE >30 >30 C3347.c11 CRF01_AE >30 >30 C4118.c09 CRF01_AE >30 >30 CNE5 CRF01_AE >30 >30 BJOX009000.02.4 CRF01_AE >30 >30 BJOX015000.11.5 CRF01_AE (T/F) >30 >30 BJOX010000.06.2 CRF01_AE (T/F) >30 >30 BJOX025000.01.1 CRF01_AE (T/F) >30 >30 BJOX028000.10.3 CRF01_AE (T/F) >30 >30 X1193_c1 G >30 >30 P0402_c2_11 G >30 >30 X1254_c3 G >30 >30 X2088_c9 G >30 >30 X2131_C1_B5 G >30 >30 P1981_C5_3 G >30 >30 X1632_S2_B10 G >30 >30 3016.v5.c45 D 23.592 >30 A07412M1.vrc12 D >30 >30 231965.c01 D >30 >30 231966.c02 D >30 >30 191821_E6_1 D (T/F) 9.963 >30 3817.v2.c59 CD >30 >30 6480.v4.c25 CD 3.060 >30 6952.v1.c20 CD 0.104 0.477 6811.v7.c18 CD >30 >30 89-F1_2_25 CD 17.963 >30 3301.v1.c24 AC >30 >30 6041.v3.c23 AC 0.018 0.054 6540.v4.c1 AC >30 >30 6545.v4.c1 AC >30 >30 0815.v3.c3 ACD 0.022 0.082 3103.v3.c10 ACD >30 >30 BG505/T332N A YU2_WT B 0.12 YU2_N276D B NT YU2_N332K B 0.05 YU2_N160K B 0.05 YU2_N280Y B >30
(123) TABLE-US-00009 TABLE 7 IC50 and IC80 values in TZM-bl assay for BG1. BG1 Virus ID Clade IC50 IC80 6535.3 B 0.322 1.130 QH0692.42 B >30 >30 SC422661.8 B >30 >30 PVO.4 B >30 >30 TRO.11 B >30 >30 AC10.0.29 B 0.012 0.043 RHPA4259.7 B >30 >30 THRO4156.18 B >30 >30 REJO4541.67 B 0.342 1.662 TRJO4551.58 B >30 >30 WITO4160.33 B 0.002 0.014 CAAN5342.A2 B >30 >30 WEAU_d15_410_787 B (T/F) >30 >30 1006_11_C3_1601 B (T/F) >30 >30 1054_07_TC4_1499 B (T/F) >30 >30 1056_10_TA11_1826 B (T/F) 5.428 29.924 1012_11_TC21_3257 B (T/F) >30 >30 6240_08_TA5_4622 B (T/F) >30 >30 6244_13_B5_4576 B (T/F) >30 >30 62357_14_D3_4589 B (T/F) 0.638 2.889 SC05_8C11_2344 B (T/F) >30 >30 Du156.12 C 1.525 6.031 Du172.17 C >30 >30 Du422.1 C 1.804 13.708 ZM197M.PB7 C >30 >30 ZM214M.PL15 C >30 >30 ZM233M.PB6 C >30 >30 ZM249M.PL1 C 1.223 6.795 ZM53M.PB12 C >30 >30 ZM109F.PB4 C >30 >30 ZM135M.PL10a C >30 >30 CAP45.2.00.G3 C 0.149 0.383 CAP210.2.00.E8 C >30 >30 HIV-001428-2.42 C 1.094 3.124 HIV-0013095-2.11 C >30 >30 HIV-16055-2.3 C 4.296 16.939 HIV-16845-2.22 C >30 >30 Ce1086_B2 C (T/F) >30 >30 Ce0393_C3 C (T/F) >30 >30 Ce1176_A3 C (T/F) 0.031 0.165 Ce2010_F5 C (T/F) >30 >30 Ce0682_E4 C (T/F) >30 >30 Ce1172_H1 C (T/F) >30 >30 Ce2060_G9 C (T/F) >30 >30 Ce703010054_2A2 C (T/F) >30 >30 BF1266.431a C (T/F) >30 >30 246F C1G C (T/F) >30 >30 249M B10 C (T/F) 1.473 5.445 ZM247v1(Rev-) C (T/F) >30 >30 7030102001E5(Rev-) C (T/F) >30 >30 1394C9G1(Rev-) C (T/F) 1.279 7.249 Ce704809221_1B3 C (T/F) 3.251 18.455 CNE19 BC 1.267 10.883 CNE20 BC 4.264 >30 CNE21 BC >30 >30 CNE17 BC >30 >30 CNE30 BC >30 >30 CNE52 BC 0.975 5.008 CNE53 BC 1.318 7.470 CNE58 BC >30 >30 MS208.A1 A 1.478 6.543 Q23.17 A 0.008 0.016 Q461.e2 A >30 >30 Q769.d22 A >30 >30 Q259.d2.17 A >30 >30 Q842.d12 A 1.395 4.297 3415.v1.c1 A 14.412 >30 3365.v2.c2 A 1.161 4.272 191955_A11 A (T/F) 0.008 0.018 191084 B7-19 A (T/F) >30 >30 9004SS_A3_4 A (T/F) >30 >30 T257-31 CRF02_AG >30 >30 928-28 CRF02_AG >30 >30 263-8 CRF02_AG >30 >30 T250-4 CRF02_AG 3.921 >30 T251-18 CRF02_AG 3.591 17.977 T278-50 CRF02_AG 19.313 >30 T255-34 CRF02_AG 11.589 >30 211-9 CRF02_AG 2.852 12.939 235-47 CRF02_AG 1.275 4.384 620345.c01 CRF01_AE 0.626 4.229 CNE8 CRF01_AE >30 >30 C1080.c03 CRF01_AE 0.002 0.005 R2184.c04 CRF01_AE >30 >30 R1166.c01 CRF01_AE >30 >30 R3265.c06 CRF01_AE 0.611 3.438 C2101.c01 CRF01_AE >30 >30 C3347.c11 CRF01_AE >30 >30 C4118.c09 CRF01_AE 22.788 >30 CNE5 CRF01_AE 0.351 1.277 BJOX009000.02.4 CRF01_AE >30 >30 BJOX015000.11.5 CRF01_AE (T/F) >30 >30 BJOX010000.06.2 CRF01_AE (T/F) >30 >30 BJOX025000.01.1 CRF01_AE (T/F) >30 >30 BJOX028000.10.3 CRF01_AE (T/F) >30 >30 X1193_c1 G 0.138 0.463 P0402_c2_11 G >30 >30 X1254_c3 G 0.048 0.086 X2088_c9 G >30 >30 X2131_C1_B5 G 0.116 0.313 P1981_C5_3 G >30 >30 X1632_S2_B10 G 0.079 0.250 3016.v5.c45 D >30 >30 A07412M1.vrc12 D >30 >30 231965.c01 D >30 >30 231966.c02 D >30 >30 191821_E6_1 D (T/F) >30 >30 3817.v2.c59 CD 11.147 >30 6480.v4.c25 CD >30 >30 6952.v1.c20 CD >30 >30 6811.v7.c18 CD >30 >30 89-F1_2_25 CD >30 >30 3301.v1.c24 AC >30 >30 6041.v3.c23 AC 6.745 16.641 6540.v4.c1 AC >30 >30 6545.v4.c1 AC >30 >30 0815.v3.c3 ACD >30 >30 3103.v3.c10 ACD >30 >30 BG505/T332N A 0.034 0.125 YU2_WT B 15.816 >30 YU2_N276D B 18.765 >30 YU2_N332K B 19.434 >30 YU2_N160K B >30 >30 YU2_N280Y B 8.998 23.023
(124) TABLE-US-00010 TABLE 8 IC50 and IC80 values in TZM-bl assay for BG8 BG8 Virus ID Clade IC50 IC80 6535.3 B 0.007 0.022 QH0692.42 B 0.106 0.383 SC422661.8 B 0.058 0.368 PVO.4 B 0.072 0.252 TRO.11 B 0.011 0.039 AC10.0.29 B 0.015 0.043 RHPA4259.7 B 0.023 0.083 THRO4156.18 B >10 >10 REJO4541.67 B >10 >10 TRJO4551.58 B 0.057 0.218 WITO4160.33 B 0.111 0.828 CAAN5342.A2 B 0.005 0.019 WEAU_d15_410_787 B (T/F) 0.031 0.112 1006_11_C3_1601 B (T/F) 0.002 0.006 1054_07_TC4_1499 B (T/F) 0.048 0.222 1056_10_TA11_1826 B (T/F) 0.038 0.168 1012_11_TC21_3257 B (T/F) 0.011 0.047 6240_08_TA5_4622 B (T/F) 0.038 0.131 6244_13_B5_4576 B (T/F) 0.091 0.380 62357_14_D3_4589 B (T/F) >10 >10 SC05_8C11_2344 B (T/F) 0.017 0.048 Du156.12 C 0.010 0.036 Du172.17 C 0.049 0.194 Du422.1 C 0.047 0.113 ZM197M.PB7 C >10 >10 ZM214M.PL15 C 0.415 2.970 ZM233M.PB6 C 0.058 0.371 ZM249M.PL1 C >10 >10 ZM53M.PB12 C >10 >10 ZM109F.PB4 C >10 >10 ZM135M.PL10a C 0.061 0.263 CAP45.2.00.G3 C >10 >10 CAP210.2.00.E8 C >10 >10 HIV-001428-2.42 C 0.035 0.126 HIV-0013095-2.11 C >10 >10 HIV-16055-2.3 C >10 >10 HIV-16845-2.22 C 0.727 3.930 Ce1086_B2 C (T/F) >10 >10 Ce0393_C3 C (T/F) >10 >10 Ce1176_A3 C (T/F) 0.022 0.070 Ce2010_F5 C (T/F) >10 >10 Ce0682_E4 C (T/F) >10 >10 Ce1172_H1 C (T/F) 0.019 0.083 Ce2060_G9 C (T/F) >10 >10 Ce703010054_2A2 C (T/F) >10 >10 BF1266.431a C (T/F) >10 >10 246F C1G C (T/F) 0.035 0.119 249M B10 C (T/F) >10 >10 ZM247v1(Rev) C (T/F) 0.042 0.146 7030102001E5(Rev) C (T/F) 0.009 0.019 1394C9G1(Rev) C (T/F) 0.031 0.093 Ce704809221_1B3 C (T/F) 0.084 0.395 CNE19 BC 0.075 >10 CNE20 BC 0.002 0.005 CNE21 BC 0.047 0.124 CNE17 BC 1.180 4.853 CNE30 BC 0.261 0.678 CNE52 BC 1.991 9.763 CNE53 BC 0.013 0.058 CNE58 BC 0.165 0.476 MS208.A1 A >10 >10 Q23.17 A 0.005 0.015 Q461.e2 A >10 >10 Q769.d22 A >10 >10 Q259.d2.17 A >10 >10 Q842.d12 A >10 >10 3415.v1.c1 A >10 >10 3365.v2.c2 A 0.057 0.200 191955_A11 A (T/F) >10 >10 191084 B7-19 A (T/F) 0.026 0.108 9004SS_A3_4 A (T/F) 0.012 0.032 T257-31 CRF02_AG >10 >10 928-28 CRF02_AG 0.616 2.396 263-8 CRF02_AG 0.416 5.714 T250-4 CRF02_AG 0.002 0.005 T251-18 CRF02_AG 0.399 2.292 T278-50 CRF02_AG 1.713 >10 T255-34 CRF02_AG >10 >10 211-9 CRF02_AG 0.065 0.403 235-47 CRF02_AG 0.058 0.224 620345.c01 CRF01_AE >10 >10 CNE8 CRF01_AE >10 >10 C1080.c03 CRF01_AE >10 >10 R2184.c04 CRF01_AE >10 >10 R1166.c01 CRF01_AE >10 >10 R3265.c06 CRF01_AE >10 >10 C2101.c01 CRF01_AE >10 >10 C3347.c11 CRF01_AE >10 >10 C4118.c09 CRF01_AE >10 >10 CNE5 CRF01_AE >10 >10 BJOX009000.02.4 CRF01_AE >10 >10 BJOX015000.11.5 CRF01_AE (T/F) >10 >10 BJOX010000.06.2 CRF01_AE (T/F) >10 >10 BJOX025000.01.1 CRF01_AE (T/F) >10 >10 BJOX028000.10.3 CRF01_AE (T/F) >10 >10 X1193_c1 G 0.070 0.207 P0402_c2_11 G 0.008 0.024 X1254_c3 G 0.063 0.239 X2088_c9 G 0.003 0.010 X2131_C1_B5 G 0.014 0.056 P1981_C5_3 G 0.004 0.013 X1632_S2_B10 G >10 >10 3016.v5.c45 D >10 >10 A07412M1.vrc12 D 0.011 0.037 231965.c01 D >10 >10 231966.c02 D >10 >10 191821_E6_1 D (T/F) >10 >10 3817.v2.c59 CD 0.706 4.492 6480.v4.c25 CD 0.006 0.023 6952.v1.c20 CD 0.023 0.086 6811.v7.c18 CD 0.003 0.009 89-F1_2_25 CD >10 >10 3301.v1.c24 AC 0.018 0.049 6041.v3.c23 AC >10 >10 6540.v4.c1 AC >10 >10 6545.v4.c1 AC >10 >10 0815.v3.c3 ACD 0.043 0.197 3103.v3.c10 ACD 0.024 0.061
(125) TABLE-US-00011 TABLE 9 IC50 and IC80 values in TZM-bl assay for 10-1074 10-1074 Virus ID Clade IC50 IC80 6535.3 B 0.007 0.022 QH0692.42 B 0.106 0.383 SC422661.8 B 0.058 0.368 PVO.4 B 0.072 0.252 TRO.11 B 0.011 0.039 AC10.0.29 B 0.015 0.043 RHPA4259.7 B 0.023 0.083 THRO4156.18 B >10 >10 REJO4541.67 B >10 >10 TRJO4551.58 B 0.057 0.218 WITO4160.33 B 0.111 0.828 CAAN5342.A2 B 0.005 0.019 WEAU_d15_410_787 B (T/F) 0.031 0.112 1006_11_C3_1601 B (T/F) 0.002 0.006 1054_07_TC4_1499 B (T/F) 0.048 0.222 1056_10_TA11_1826 B (T/F) 0.038 0.168 1012_11_TC21_3257 B (T/F) 0.011 0.047 6240_08_TA5_4622 B (T/F) 0.038 0.131 6244_13_B5_4576 B (T/F) 0.091 0.380 62357_14_D3_4589 B (T/F) >10 >10 SC05_8C11_2344 B (T/F) 0.017 0.048 Du156.12 C 0.010 0.036 Du172.17 C 0.049 0.194 Du422.1 C 0.047 0.113 ZM197M.PB7 C >10 >10 ZM214M.PL15 C 0.415 2.970 ZM233M.PB6 C 0.058 0.371 ZM249M.PL1 C >10 >10 ZM53M.PB12 C >10 >10 ZM109F.PB4 C >10 >10 ZM135M.PL10a C 0.061 0.263 CAP45.2.00.G3 C >10 >10 CAP210.2.00.E8 C >10 >10 HIV-001428-2.42 C 0.035 0.126 HIV-0013095-2.11 C >10 >10 HIV-16055-2.3 C >10 >10 HIV-16845-2.22 C 0.727 3.930 Ce1086_B2 C (T/F) >10 >10 Ce0393_C3 C (T/F) >10 >10 Ce1176_A3 C (T/F) 0.022 0.070 Ce2010_F5 C (T/F) >10 >10 Ce0682_E4 C (T/F) >10 >10 Ce1172_H1 C (T/F) 0.019 0.083 Ce2060_G9 C (T/F) >10 >10 Ce703010054_2A2 C (T/F) >10 >10 BF1266.431a C (T/F) >10 >10 246F C1G C (T/F) 0.035 0.119 249M B10 C (T/F) >10 >10 ZM247v1(Rev) C (T/F) 0.042 0.146 7030102001E5(Rev) C (T/F) 0.009 0.019 1394C9G1(Rev) C (T/F) 0.031 0.093 Ce704809221_1B3 C (T/F) 0.084 0.395 CNE19 BC 0.075 >10 CNE20 BC 0.002 0.005 CNE21 BC 0.047 0.124 CNE17 BC 1.180 4.853 CNE30 BC 0.261 0.678 CNE52 BC 1.991 9.763 CNE53 BC 0.013 0.058 CNE58 BC 0.165 0.476 MS208.A1 A >10 >10 Q23.17 A 0.005 0.015 Q461.e2 A >10 >10 Q769.d22 A >10 >10 Q259.d2.17 A >10 >10 Q842.d12 A >10 >10 3415.v1.c1 A >10 >10 3365.v2.c2 A 0.057 0.200 191955_A11 A (T/F) >10 >10 191084 B7-19 A (T/F) 0.026 0.108 9004SS_A3_4 A (T/F) 0.012 0.032 T257-31 CRF02_AG >10 >10 928-28 CRF02_AG 0.616 2.396 263-8 CRF02_AG 0.416 5.714 T250-4 CRF02_AG 0.002 0.005 T251-18 CRF02_AG 0.399 2.292 T278-50 CRF02_AG 1.713 >10 T255-34 CRF02_AG >10 >10 211-9 CRF02_AG 0.065 0.403 235-47 CRF02_AG 0.058 0.224 620345.c01 CRF01_AE >10 >10 CNE8 CRF01_AE >10 >10 C1080.c03 CRF01_AE >10 >10 R2184.c04 CRF01_AE >10 >10 R1166.c01 CRF01_AE >10 >10 R3265.c06 CRF01_AE >10 >10 C2101.c01 CRF01_AE >10 >10 C3347.c11 CRF01_AE >10 >10 C4118.c09 CRF01_AE >10 >10 CNE5 CRF01_AE >10 >10 BJOX009000.02.4 CRF01_AE >10 >10 BJOX015000.11.5 CRF01_AE (T/F) >10 >10 BJOX010000.06.2 CRF01_AE (T/F) >10 >10 BJOX025000.01.1 CRF01_AE (T/F) >10 >10 BJOX028000.10.3 CRF01_AE (T/F) >10 >10 X1193_c1 G 0.070 0.207 P0402_c2_11 G 0.008 0.024 X1254_c3 G 0.063 0.239 X2088_c9 G 0.003 0.010 X2131_C1_B5 G 0.014 0.056 P1981_C5_3 G 0.004 0.013 X1632_S2_B10 G >10 >10 3016.v5.c45 D >10 >10 A07412M1.vrc12 D 0.011 0.037 231965.c01 D >10 >10 231966.c02 D >10 >10 191821_E6_1 D (T/F) >10 >10 3817.v2.c59 CD 0.706 4.492 6480.v4.c25 CD 0.006 0.023 6952.v1.c20 CD 0.023 0.086 6811.v7.c18 CD 0.003 0.009 89-F1_2_25 CD >10 >10 3301.v1.c24 AC 0.018 0.049 6041.v3.c23 AC >10 >10 6540.v4.c1 AC >10 >10 6545.v4.c1 AC >10 >10 0815.v3.c3 ACD 0.043 0.197 3103.v3.c10 ACD 0.024 0.061
(126) TABLE-US-00012 TABLE 10 IC50 and IC80 values in TZM-bl assay for PGT121 PGT121 Virus ID Clade IC50 IC80 6535.3 B 0.003 0.010 QH0692.42 B 0.498 8.507 SC422661.8 B 0.079 0.373 PVO.4 B 0.094 0.450 TRO.11 B 0.011 0.037 AC10.0.29 B 0.019 0.060 RHPA4259.7 B 0.013 0.046 THRO4156.18 B >10 >10 REJO4541.67 B >10 >10 TRJO4551.58 B 0.802 >10 WITO4160.33 B 0.301 3.200 CAAN5342.A2 B 0.008 0.026 WEAU_d15_410_787 B (T/F) 0.017 0.062 1006_11_C3_1601 B (T/F) 0.002 0.008 1054_07_TC4_1499 B (T/F) 0.041 0.299 1056_10_TA11_1826 B (T/F) 0.034 0.148 1012_11_TC21_3257 B (T/F) 0.008 0.034 6240_08_TA5_4622 B (T/F) 0.068 0.231 6244_13_B5_4576 B (T/F) 0.172 1.471 62357_14_D3_4589 B (T/F) 6.215 >10 SC05_8C11_2344 B (T/F) 0.030 0.108 Du156.12 C 0.006 0.019 Du172.17 C 0.062 0.531 Du422.1 C 0.017 0.088 ZM197M.PB7 C >10 >10 ZM214M.PL15 C 0.288 2.456 ZM233M.PB6 C 2.809 >10 ZM249M.PL1 C >10 >10 ZM53M.PB12 C 0.001 0.005 ZM109F.PB4 C 8.924 >10 ZM135M.PL10a C 0.730 5.727 CAP45.2.00.G3 C 1.300 >10 CAP210.2.00.E8 C >10 >10 HIV-001428-2.42 C 0.020 0.126 HIV-0013095-2.11 C >10 >10 HIV-16055-2.3 C 0.772 7.986 HIV-16845-2.22 C 8.512 >10 Ce1086_B2 C (T/F) 0.003 0.016 Ce0393_C3 C (T/F) >10 >10 Ce1176_A3 C (T/F) 0.022 0.063 Ce2010_F5 C (T/F) >10 >10 Ce0682_E4 C (T/F) >10 >10 Ce1172_H1 C (T/F) 0.007 0.030 Ce2060_G9 C (T/F) >10 >10 Ce703010054_2A2 C (T/F) >10 >10 BF1266.431a C (T/F) >10 >10 246F C1G C (T/F) 0.082 0.363 249M B10 C (T/F) >10 >10 ZM247v1(Rev) C (T/F) 0.036 0.123 7030102001E5(Rev) C (T/F) 0.016 0.042 1394C9Gl(Rev) C (T/F) 0.823 6.227 Ce704809221_1B3 C (T/F) 0.043 0.285 CNE19 BC 0.012 0.083 CNE20 BC 0.003 0.006 CNE21 BC 0.009 0.031 CNE17 BC 3.962 >10 CNE30 BC 0.088 0.288 CNE52 BC 4.914 >10 CNE53 BC 0.014 0.062 CNE58 BC >10 >10 MS208.A1 A >10 >10 Q23.17 A 0.005 0.017 Q461.e2 A >10 >10 Q769.d22 A >10 >10 Q259.d2.17 A 3.071 >10 Q842.d12 A 0.010 0.037 3415.v1.c1 A >10 >10 3365.v2.c2 A 0.243 2.133 191955_A11 A (T/F) >10 >10 191084 B7-19 A (T/F) 0.038 0.118 9004SS_A3_4 A (T/F) 0.006 0.016 T257-31 CRF02_AG >10 >10 928-28 CRF02_AG >10 >10 263-8 CRF02_AG 0.647 4.680 T250-4 CRF02_AG 0.003 0.009 T251-18 CRF02_AG 5.183 >10 T278-50 CRF02_AG >10 >10 T255-34 CRF02_AG 2.631 >10 211-9 CRF02_AG 0.866 6.631 235-47 CRF02_AG 0.259 1.601 620345.c01 CRF01_AE >10 >10 CNE8 CRF01_AE >10 >10 C1080.c03 CRF01_AE >10 >10 R2184.c04 CRF01_AE >10 >10 R1166.c01 CRF01_AE >10 >10 R3265.c06 CRF01_AE >10 >10 C2101.c01 CRF01_AE >10 >10 C3347.c11 CRF01_AE >10 >10 C4118.c09 CRF01_AE >10 >10 CNE5 CRF01_AE >10 >10 BJOX009000.02.4 CRF01_AE 9.001 >10 BJOX015000.11.5 CRF01_AE (T/F) >10 >10 BJOX010000.06.2 CRF01_AE (T/F) >10 >10 BJOX025000.01.1 CRF01_AE (T/F) >10 >10 BJOX028000.10.3 CRF01_AE (T/F) >10 >10 X1193_c1 G 0.022 0.088 P0402_c2_11 G 0.007 0.022 X1254_c3 G 0.029 0.085 X2088_c9 G 0.007 0.022 X2131_C1_B5 G 0.011 0.037 P1981_C5_3 G 0.002 0.009 X1632_S2_B10 G >10 >10 3016.v5.c45 D >10 >10 A07412M1.vrc12 D 0.034 0.255 231965-c01 D >10 >10 231966.c02 D >10 >10 191821_E6_1 D (T/F) >10 >10 3817.v2.c59 CD >10 >10 6480.v4.c25 CD 0.008 0.029 6952.v1.c20 CD 0.049 0.348 6811.v7.c18 CD 0.002 0.007 89-F1_2_25 CD >10 >10 3301.v1.c24 AC 0.013 0.041 6041.v3.c23 AC >10 >10 6540.v4.c1 AC >10 >10 6545.v4.c1 AC >10 >10 0815.v3.c3 ACD 0.017 0.085 3103.v3.c10 ACD 0.024 0.073
(127) TABLE-US-00013 TABLE 11 IC50 and IC80 values in TZM-bl assay of the 1:1:1 combination of NC37, BG1, and BG18 against a 118-virus panel. Titer in TZM.bl cells (ug/ml) NC37 + BG1 + BG18 Virus ID Clade IC50 IC80 6535.3 B 0.006 0.030 QH0692.42 B 0.033 0.130 SC422661.8 B 0.024 0.089 PVO.4 B 0.012 0.050 TRO.11 B 0.004 0.015 AC10.0.29 B 0.006 0.016 RHPA4259.7 B 0.210 1.669 THRO4156.18 B >50 >50 REJO4541.67 B 0.199 0.696 TRJO4551.58 B 0.938 7.063 WITO4160.33 B 0.021 0.075 CAAN5342.A2 B 0.036 0.162 YU2.DG B 0.052 0.147 WEAU_d15_410_787 B (T/F) 0.022 0.074 1006_11_C3_1601 B (T/F) 0.005 0.013 1054_07_TC4_1499 B (T/F) 0.022 0.122 1056_10_TA11_1826 B (T/F) 0.031 0.266 1012_11_TC21_3257 B (T/F) 0.012 0.055 6240_08_TA5_4622 B (T/F) 0.009 0.028 6244_13_B5_4576 B (T/F) 0.045 0.216 62357_14_D3_4589 B (T/F) 0.840 5.585 SC05_8C11_2344 B (T/F) 0.045 0.083 Du156.12 C 0.018 0.050 Du172.17 C >50 >50 Du422.1 C 0.076 0.347 ZM197M.PB7 C 4.123 >50 ZM214M.PL15 C >50 >50 ZM233M.PB6 C 7.814 >50 ZM249M.PL1 C 2.916 17.336 ZM53M.PB12 C >50 >50 ZM109F.PB4 C >50 >50 ZM135M.PL10a C 6.018 31.451 CAP45.2.00.G3 C 0.251 1.097 CAP210.2.00.E8 C 19.144 >50 HIV-001428-2.42 C 0.029 0.075 HIV-0013095-2.11 C 31.333 >50 HIV-16055-2.3 C 12.372 43.320 HIV-16845-2.22 C 0.092 0.316 Ce1086_B2 C (T/F) 2.088 13.998 Ce0393_C3 C (T/F) >50 >50 Ce1176_A3 C (T/F) 0.013 0.030 Ce2010_F5 C (T/F) >50 >50 Ce0682_E4 C (T/F) >50 >50 Ce1172_H1 C (T/F) 0.017 0.047 Ce2060_G9 C (T/F) >50 >50 Ce703010054_2A2 C (T/F) >50 >50 BF1266.431a C (T/F) 45.589 >50 246F C1G C (T/F) 0.172 1.220 249M B10 C (T/F) 4.422 17.159 ZM247v1(Rev) C (T/F) 6.417 >50 7030102001E5(Rev) C (T/F) 0.011 0.035 1394C9G1(Rev) C (T/F) 0.078 1.405 Ce704809221_1B3 C (T/F) 10.937 >50 CNE19 BC 1.576 17.656 CNE20 BC 0.008 0.024 CNE21 BC 0.009 0.022 CNE17 BC 0.195 0.709 CNE30 BC 0.067 0.183 CNE52 BC 0.077 0.199 CNE53 BC 0.015 0.036 CNE58 BC 0.055 0.206 MS208.A1 A 2.393 17.933 Q23.17 A 0.009 0.024 Q461.e2 A >50 >50 Q769.d22 A 0.364 2.151 Q259.d2.17 A >50 >50 Q842.d12 A 0.405 1.371 0260.v5.c36 A 0.018 0.055 3415.v1.c1 A 0.039 0.187 3365.v2.c2 A 0.020 0.049 191955_A11 A (T/F) 0.830 4.335 191084 B7-19 A (T/F) 0.029 0.071 9004SS_A3_4 A (T/F) 0.027 0.090 T257-31 CRF02_AG >50 >50 928-28 CRF02_AG 1.919 7.522 263-8 CRF02_AG 0.544 3.759 T250-4 CRF02_AG 0.005 0.029 T251-18 CRF02_AG 0.133 0.639 T278-50 CRF02_AG 9.069 44.006 T255-34 CRF02_AG 37.020 >50 211-9 CRF02_AG 1.976 18.953 235-47 CRF02_AG 0.013 0.046 620345.c01 CRF01_AE 1.325 8.233 CNE8 CRF01_AE >50 >50 C1080.c03 CRF01_AE 0.012 0.042 R2184.c04 CRF01_AE 0.084 0.376 R1166.c01 CRF01_AE >50 >50 C2101.c01 CRF01_AE >50 >50 C3347.c11 CRF01_AE >50 >50 C4118.c09 CRF01_AE >50 >50 CNE5 CRF01_AE 1.465 6.578 BJOX009000.02.4 CRF01_AE >50 >50 BJOX015000.11.5 CRF01_AE (T/F) >50 >50 BJOX010000.06.2 CRF01_AE (T/F) >50 >50 BJOX025000.01.1 CRF01_AE (T/F) >50 >50 BJOX028000.10.3 CRF01_AE (T/F) >50 >50 X1193_c1 G 0.036 0.130 P0402_c2_11 G 0.023 0.088 X1254_c3 G 0.016 0.038 X2088_c9 G 0.007 0.021 X2131_C1_B5 G 0.016 0.036 P1981_C5_3 G 0.022 0.063 X1632_S2_B10 G 0.275 0.986 3016.v5.c45 D 8.359 >50 A07412M1.vrc12 D 0.189 2.455 231965.c01 D >50 >50 231966.c02 D >50 >50 191821_E6_1 D (T/F) >50 >50 3817.v2.c59 CD 0.582 2.883 6480.v4.c25 CD 0.108 0.476 6952.v1.c20 CD 0.011 0.027 6811.v7.c18 CD 0.009 0.035 89-F1_2_25 CD 5.379 >50 3301.v1.c24 AC 0.074 0.260 6041.v3.c23 AC 0.085 0.233 6540.v4.c1 AC >50 >50 6545.v4.c1 AC >50 >50 0815.v3.c3 ACD 0.071 0.321 3103.v3.c10 ACD 0.009 0.017
BG18
(128) At the amino acid level BG18 is 63% and 62% identical to the heavy chains of 10-1074 and PGT121, respectively, both of which arise from a V.sub.H4-59 germline precursor. BG18 arises from the closely related (90.8% identity) germline gene V.sub.H4-4 (
(129) BG18 uses the V.sub.L gene segment V.sub.L2-25, and is related by only 46% and 50% identity at the amino acid sequence level to the V.sub.L3-21 gene segment used by PGT121 and 10-1074, respectively (
(130) The 1.3 resolution crystal structure of BG18 Fab revealed that the CDR loops form a compact combining site, with the exception of CDRH3, which protrudes 11 beyond the other CDRs, presenting a tip consisting predominantly of hydrophobic residues (
(131) To investigate how BG18 recognizes Env, a 25 resolution negative stain single particle electron microscopy (EM) structure of BG505 SOSIP.664 trimer in complex with Fabs from BG18 and the CD4bs bNAb 179NC75 was resolved. Fitting the coordinates from the BG18 Fab crystal structure into the EM map (
(132) BG18 was evaluated for neutralization against a panel of HIV-1 pseudoviruses with deletions of specific N-linked glycosylation sites. The results indicated that none of the glycans at the base of V3 loop, with the exception of the Asn332gp120, had an impact on neutralization activity (Table 12). Consistent with these data, BG18 bound preferentially to synthetic V3 glycopeptides containing oligomannose N-glycans at position Asn332gp120 and not to glycopeptides containing complex-type N-glycans attached to this position or to other potential N-linked glycosylation sites within gp120 (
(133) TABLE-US-00014 TABLE 12 IC50 and IC80 values in TZM-bl assay of BG18, BG8 PGT121 and control mAb 12A12 against selected V3 enelope mutants. BG8 BG18 PGT121 12A12 BG505 (T332N) 0.007 0.001 0.012 0.030 N137A 0.003 0.001 0.002 0.027 N156A 0.008 0.001 0.007 0.024 N295A 0.009 0.001 0.014 0.044 N301A 0.004 0.001 0.011 0.027 N339A 0.007 0.001 0.016 ND N386A 0.004 0.001 0.015 0.030 N392A 0.005 0.001 0.006 0.012 JR-CSF 0.009 0.001 0.011 0.233 N295A 0.006 0.001 0.016 0.203 N301A 0.006 0.001 0.011 0.010 N332A >50 >50 >50 0.240 N339A 0.010 0.001 0.007 0.028 N362A 0.008 0.001 0.018 0.267 N386A 0.012 0.001 0.024 0.332 N392A 0.014 0.002 0.017 0.230 G324A 0.005 0.001 0.044 0.236 D325A 0.005 0.001 0.079 0.203 I326A 0.005 0.001 0.024 0.278 R327A 0.005 0.001 0.018 0.131 Q328A 0.023 0.001 0.057 0.038 H330A 0.050 0.001 0.017 0.288 92BR020 0.015 0.001 0.004 0.050 N136A 0.005 0.001 0.002 0.027 N156A 0.011 0.001 0.003 0.035 N301A 0.009 0.001 0.003 0.011 N332A >50 >50 0.080 0.039 N386A 0.012 0.003 0.006 0.055 N392A 0.023 0.001 0.007 0.105 D325A 0.006 0.001 0.006 0.050 I326A 0.006 0.001 0.002 0.011 R327A 0.011 0.001 0.001 0.022 Q328A 0.018 0.001 0.002 0.028 H330A 0.018 0.001 0.003 0.073 N136A + N332A >50 >50 >1 0.025 N156A + N332A >50 >50 >1 0.023 N301A + N332A >50 >50 >1 0.007 N136A + N156A + N301A 0.001 0.001 0.001 0.013
NC37
(134) A 2.7 resolution crystal structure of NC37 Fab (
(135) NC37 was isolated in 2010, whereas BG1 and BG18 were isolated from PBMCs collected in 2014. Available PBMCs were examined from 2010 and 2013 using PCR primers specific for BG1 and BG18. Whereas BG1 transcripts were detected at both time points, BG18 was first detected in 2013. This indicates that BG18 emerged between 2010 and 2013, while BG1 and NC37 developed earlier.
(136) Autologous Neutralization
(137) To examine the effects of the 3 bNAbs on autologous viruses, individual env genes from circulating plasma viruses were cloned by single-genome sequencing (SGS) from five different time points during 2006-2015 (2006, 2010, 2013, 2014 and 2015). Only 37 functional in-frame transcripts were recovered, in part due to viral load values below 400 copies/mL at all time points. Moreover, all sequences recovered from 2015 were non-functional (
(138) All 3 sequences in Cluster C contained mutations altering the N-linked glycosylation site at Asn332.sub.gp120, whereas the other 34 sequences had an intact N-linked glycosylation site at Asn332.sub.gp120 (
(139) To determine the sensitivity of the functional Envs to the 3 autologous bNAbs, pseudoviruses were produced and tested in TZM-bl assays. Out of 35 pseudoviruses that were successfully produced, only 4 were resistant to all 3 bNAbs. These were Envs from Cluster C, found in the plasma from 2014, and one from 2013 (
(140) BG18- and NC37-sensitive viruses, as well as viruses sensitive to the concurrent IgG, were found at all time points analyzed including the times when BG18 and NC37 were isolated (
(141) Although it was not possible to obtain viral sequences from plasma samples from 2015, it was possible to grow virus from two out of five EB354 CD4+ viral outgrowth cultures (VOCs). In both cases the cultures took over five weeks to become positive for the virus as measured by p24 ELISA. SGS sequences from both 2015 outgrowth cultures clustered closely with sequences from Cluster C and lacked the N-linked glycosylation site at Asn332.sub.gp120 (
(142) In Vivo Efficacy of BG18, NC37 and BG1
(143) To determine whether BG18 or NC37 can independently exert selective pressure on HIV-1 in vivo, humanized mice (hu-mice) were infected with HIV-1.sub.YU2 and the established infection was treated. BG1 showed poor activity against HIV-1YU2 (IC.sub.50=15.8 g/mL) and therefore was used only in subsequent combination treatment experiments and not in monotherapy experiments. Similar to 10-1074, administration of BG18 or BG8, a less potent but still effective clonal variant, was associated with a rapid decrease (average 1.5 log.sub.10) in viral load, followed by rebound viremia (
(144) Combinations of antibodies can control HIV-1.sub.YU2 infection in hu-mice. To determine whether the combination of BG18, NC37 and BG1 can control viremia 5 HIV-1.sub.YU2-infected hu-mice were treated with a 1:1:1 combination of the 3 bNAbs (BG18, NC37 and BG1). Shortly after administration of the 3 bNAbs, viral loads were reduced in all animals by an average of 1.74 Log.sub.10, and, surprisingly, 4/5 mice showed virtually undetectable viral loads after 3 weeks (
(145) TABLE-US-00015 TABLE13 NeutralizingClones.Geneticcharacteristic ofthe13antibodies,representative variantsfromeachofthethreeclonesthat showedneutralizingactivity.TheV.sub.H,V.sub.Land levelofmutations,aswellasthesequence oftheCDRH3(basedonIMGTdefinition) areindicated. Somatic Mutations An- Clos- inV(nt) ti- est Closest % body VH VL VH VL CDRH3Sequence NC37 1-2/ K3-20 28.8 27.9 DNFGTRPVPGRGY YYGMDV 1-46 (SEQIDNO:105) NC133 1-46 K3-20 28 23.2 DNRGDRNVPGRGY YYGMDV (SEQIDNO:106) NC102 1-2 K3-20 27.1 22.2 DNFGTRPVPGRGY YYGMDV (SEQIDNO:107) AC40 1-46 K3-20 33.5 21.1 DNFGESHKGYT YGMDA (SEQIDNO:108) AC41 1-46 K3-20 30.1 21.5 DNFGESHKGYTY GMDA (SEQIDNO:109) AC72 1-46 K3-20 29.8 20.8 DNFGESHKGYT YGMDA (SEQIDNO:110) BG8 4-4 L3-25 25.4 20.5 NVIRVFGVISLG EWFHYGM DV(SEQIDNO:4) BG18 4-4 L3-25 21.2 17.7 NAIRIYGVVALGE WFHYGM DV(SEQIDNO:12) BG33 4-4 L3-25 25 18.4 NVIRVFGVISLGE WFHYGMDV (SEQIDNO:28) BG42 4-4 L3-25 23.7 19.4 NVIRVFGVISLGE WFHYGMDV (SEQIDNO:20) BG1 3-49 K1-39 27.2 19.9 EQRNKDYRYGQEG FGYSYGMDV (SEQIDNO:76) BG22 3-49 K1-39 26.8 23.4 EQRGGDGRYSGD GFGYPYGMDV (SEQIDNO:84) BG47 3-49 K1-39 27.1 22 EQRGANGRYGGD GFGYSYGMDV (SEQIDNO:92)
T
(146) The foregoing examples and description of the preferred embodiments should be taken as illustrating, rather than as limiting the present invention as defined by the claims. As will be readily appreciated, numerous variations and combinations of the features set forth above can be utilized without departing from the present invention as set forth in the claims. Such variations are not regarded as a departure from the scope of the invention, and all such variations are intended to be included within the scope of the following claims. All references cited herein are incorporated by reference in their entireties.