Methods and compositions for the detection of host protein cleavage by group IV viral proteases
12607633 ยท 2026-04-21
Assignee
Inventors
- Patricia M. Legler (Derwood, MD, US)
- Elaine Morazzani (Leesburg, VA, US)
- Pamela Glass (Frederick, MD, US)
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N2770/36131
CHEMISTRY; METALLURGY
Y02A50/30
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
G01N2333/181
PHYSICS
C12N2770/36111
CHEMISTRY; METALLURGY
International classification
C12N15/00
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12N15/90
CHEMISTRY; METALLURGY
C12N7/00
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N9/96
CHEMISTRY; METALLURGY
Abstract
Proteases of Group IV (+)ssRNA viruses were found to act on a human sequences in addition to the viral sequences. The identity of the cleavable human sequences is disclosed. Detection of these sequences can act as a diagnostic of infection. It is contemplated that these findings could be employed to facilitate post-translational silencing at the level of protein (e.g., removal of existing proteins), thus serving as a protein analog to CRISPR/Cas9 and RNAi/RISC, and further to enable sequence-specific silencing of host functions without the modification of the host genome.
Claims
1. A method of post-translational silencing and transient loss of function of a target protein, consisting of: expressing a viral protease of a Venezuelan equine encephalitis virus (VEEV) in a mammalian host cell within a living organism by infecting the organism via administering an attenuated VEEV virus encoding the viral protease, wherein the viral protease recognizes and cleaves a target protein sequence endogenous to the host, thereby causing transient loss of function of a target protein that comprises the target protein sequence, and halting protease activity by introducing a protease inhibitor to the host cell.
2. The method of claim 1, wherein the viral protease comprises VEEV nsP2 protease, and the target protein comprises human TRIM14 protein, such that the nsP2 protease cleaves the human TRIM14 protein.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
DETAILED DESCRIPTION
Definitions
(11) Before describing the present invention in detail, it is to be understood that the terminology used in the specification is for the purpose of describing particular embodiments, and is not necessarily intended to be limiting. Although many methods, structures and materials similar, modified, or equivalent to those described herein can be used in the practice of the present invention without undue experimentation, the preferred methods, structures and materials are described herein. In describing and claiming the present invention, the following terminology will be used in accordance with the definitions set out below.
(12) As used herein, the singular forms a, an, and the do not preclude plural referents, unless the content clearly dictates otherwise.
(13) As used herein, the term and/or includes any and all combinations of one or more of the associated listed items.
(14) As used herein, the term about when used in conjunction with a stated numerical value or range denotes somewhat more or somewhat less than the stated value or range, to within a range of 10% of that stated.
(15) As used herein, suspected of being infected is meant to be interpreted very broadly to compass instances where an infection is virtually certain to those where it is not believed that an infection exists.
(16) Overview
(17) Described herein are a novel bioinformatic method and recombinant fluorescence resonance energy transfer (FRET) substrates for proteases of Group IV viruses (cleavage of which can be detected in several ways). The substrates containing the cleavable human sequences can be produced in E. coli and used in a plate reader to monitor cleavage in real time (continuous assay), in a mass spectrometer, or in an SDS-PAGE gel (discontinuous assay) for the identification of protease inhibitors that are capable of effectively competing with these host-relevant substrates. The substrates represent new techniques for the detecting viral protease activity in a specific host (e.g. human), and can further serve to help discover inhibitors of the proteases for therapeutic use.
(18) Alphaviruses are (+)ssRNA viruses and belong to the Togaviridae family of Group IV. Group IV contains 33 families and includes the Coronaviridae, Picornaviridae, and Flaviviridae among others. Venezuelan equine encephalitis virus (VEEV) is a New World alphavirus that belongs to Group IV. The other New World alphaviruses, eastern (EEEV) and western (WEEV) equine encephalitis viruses, share high sequence identity (68%) with VEEV, but are significantly more lethal in humans, with mortality rates of 36% and 10%, respectively (2; 4; 8; 10; 11). The Old World alphaviruses such as Chikungunya (CHIKV), Sindbis (SINV), and Semliki Forest (SFV) viruses are more commonly associated with fever, arthralgia, skin rashes, and malaise (12). What accounts for the differences in virulence and pathogenicity is not well delineated.
(19) During alphaviral replication, recognition of double stranded RNA replication intermediates in the cytoplasm by RIG-I or MDA-5 triggers the mitochondrial antiviral signalosome (MAVS) and results in the rapid production of type I interferons (IFN) and proinflammatory cytokines (17; 18). IFN plays an important role in limiting acute alphaviral infections (17-19). IFN can protect uninfected cells from infection and create an antiviral state to prevent further alphaviral replication (20). IFN-stimulated genes (ISG) can inhibit the replication of CHIKV, SINV, and VEEV and other viruses (21-24). Alphaviruses utilize multiple redundant mechanisms to antagonize the IFN response (25). To evade the innate immune responses alphaviruses shut off host cell transcription and translation, typically within hours post-infection (14; 23), to prevent the expression of ISG.
(20) VEEV viral particles are highly resistant to desiccation and can be stably lyophilized and aerosolized (1) which has implications for its use as a potential bioweapon. Inhaled virus can disseminate into the brain via the olfactory neurons (2-4), and symptoms can occur within 28-33 hours in humans (5-8). Acute alphaviral infections are typically resolved by the innate and adaptive immune responses. Only 1% of human VEEV infections result in lethal encephalitis; however, neurological symptoms occur in approximately 14% (5; 8; 9).
(21) Alphaviruses are known to utilize their nonstructural and structural proteins to transiently suppress the innate immune responses in order to replicate, and the mechanisms of suppression differ among alphaviruses (13; 14). Some similarities in virulence may have arisen from genetic recombination events (e.g. WEEV which has EEEV-like encephalogenic properties is thought to have arisen from a SINV-like and EEEV-like ancestor (15)). Virulence differs in host species, as the name suggests the mortality rates of EEV infections are significantly higher for equine than humans and can range from 40-90% (16).
(22) The nonstructural proteins (nsPs) play essential roles in replication, but can also play secondary roles in IFN-antagonism. The role of the nsPs in IFN-antagonism can be either enzymatic or non-enzymatic (e.g. binding). The nsP2 of alphaviruses contains an N-terminal domain, a helicase, a papain-like protease, and an S-adenosyl-L-methionine-dependent RNA methyltransferase (SAM MTase) domain (
(23) Viral proteases may also be partially responsible for the virus-induced phenotypes (95) as some of the identified cleavable human sequences were found in proteins that have not been previously implicated in antiviral responses, e.g. a human cardiac myosin sequence found in MYH6 and MYH7 was cut by the SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2) papain-like protease (PLpro) (95). Moreover, sarcomere fragmentation associated with SAES-CoV-2 infection was observed in infected human heart cells (100), likely due to viral protease activity.
(24) As described below, the VEEV nsP2 protease was found by the inventors to cleave human TRIM14 and is likely to antagonize the production of interferon. The inventors also demonstrated the cleavage of other host proteins by the Group IV viral proteases of Zika virus (ZIKV, Flaviviridae), SARS-CoV-2 and MERS (Middle Eastern respiratory syndrome, Coronaviridae). The PLpro of SARS-CoV-2 was able to cleave a sequence in human Protein S (PROS1), an anti-coagulant protein that prevents blood clots, a sequence in human FOXP3 (forkhead protein P3), a transcription factor in T.sub.regulatory (T.sub.reg) cells, a sequence in the human cardiac myosins MYH6 and MYH7, and a sequence in human epidermal growth factor receptor 4, erbB4 (HER4). The preferred substrates of the SARS-CoV-2 PLpro were those containing the cardiac myosin sequences [SEQ ID NOs: 7, 8]. The MERS PLpro showed minor cleavage of the cardiac myosin sequences, but similar levels of cleavage of Protein S, FOXP3 and erbB4 (HER4) substrates. These substrates were systematically identified using the new bioinformatics method developed by the inventors and their cleavage by the viral proteases was confirmed in vitro (
(25) Prior methods to reduce protein concentrations in a cell include CRISPR/Cas9 and RNAi/RISC. Because these methods work at the level of DNA and RNA, respectively, they must be applied prior to protein expression and thus cannot alter the concentrations of proteins that have already been expressed in a cell or have entered into a cell (e.g. protein toxin). The method of post-translational silencing using a viral protease enables transient silencing.
(26) The alphaviral nonstructural protein 2 (nsP2) cysteine proteases (EC 3.4.22.-) are involved in the proteolytic processing of the nonstructural (ns) polyprotein. After examining the substrate specificities of the VEEV nsP2 cysteine protease, a new host substrate of the VEEV nsP2 protease, human TRIM14, was identified. The TRIM14 protein is a component of the mitochondrial antiviral-signaling protein (MAVS) signalosome (
(27) It is contemplated that these findings could be employed to facilitate post-translational silencing at the level of protein (removal of existing proteins) as a protein analog to CRISPR/Cas9 and RNAi/RISC. The natural or recombinant viral proteases could be expressed in cells or in animals to sequence-specifically cut their identified host protein substrates (Table 2). These viral enzymes (natural or recombinant) could be used therapeutically similar to the Botulinum neurotoxins. Alternatively, the identified cleavage site sequences in these human proteins could be introduced into transgenic animals or into cell lines to recapitulate the effects of the viral protease in an animal model or cells. This system relies on the identification of the SSHHP sequences using bioinformatics methods and an appropriate recombinant or natural viral protease (as opposed to a nuclease) that cleaves them. It is further contemplated that the presence or absence of a viral infection could be detected by analysis of the cleavage products of the viral proteases, or the consequent downstream effects produced from silencing using the appropriate viral nsP protease.
(28) Also described herein (see Table 2) are a number of peptide sequences operable as recognition sites of a Group IV viral protease (SEQ ID NOs: 2-22) or as uncleavable control sequences (SEQ ID NO: 23, 24), optionally with a FRET pair of fluorophores at either end thereof. These are useful in detecting activity of the proteases, with a readout available optically, or via a separation method such as SDS-PAGE or mass spectroscopy. In various aspects, the FRET pair of fluorophores are EDANS (5-((2-Aminoethyl)amino)naphthalene-1-sulfonic acid) and DABCYL (4-(dimethylaminoazo)benzene-4-carboxylic acid); or yellow fluorescent protein (YFP) and a cyan fluorescent protein (CFP), or other variants of green fluorescent protein.
(29) Using the peptides operable as recognition sequences to detect enzyme activity enables the diagnosis and subsequent treatment of infection by these viruses, and furthermore allows for in vitro screening of small molecule inhibitors of the viral proteases for drug discovery.
DESCRIPTION
(30) The present inventors hypothesized that the alphaviral protease cleavage sites may share homology with regions of human proteins and that the virus may use these short stretches of host sequences to recognize host proteins and then cut them as another mechanism of IFN-antagonism. The viral proteases not only recognize proteins involved in generating the innate immune responses, but other proteins that have not been implicated in immune responses. These other protein targets may represent the off-targets of these viral proteases. These off-target cleavages had relationships to the observed symptoms of the virus. The VEEV nsP2 substrate specificities were previously characterized by the inventors using kinetic, mutational and structural studies (30. The inventors examined potential host protein targets of the nsP2 protease by searching the human proteome for proteins sharing sequence identity with the nsP12, nsP23, and nsP34 cleavage site sequence motifs. One human protein, TRIM14 (also known as Pub (31)), sharing six identical residues to an alphaviral nsP12 cleavage site, was identified as a substrate of the VEEV nsP2 viral protease. Consistent with in vitro assay resultsTRIM14 cleavage could be detected in immunoblots of VEEV-infected cell lysates.
(31) Other recombinant viral proteases appropriate for drug discovery (SARS-CoV-2 PLpro, ZIKV ns2B/ns3, and MERS PLpro) were analyzed by the inventors [SEQ ID NO: 25, 26, 27, 28, 29] and the corresponding host substrates were created [SEQ ID NO: 7-22] (
(32) TRIM14 is a tripartite motif protein (TRIM) and was recently shown to function as an adaptor protein in the MAVS signalosome (32; 33). Stable overexpression of TRIM14 has been shown to inhibit alphaviral replication by 34 logs 24 h post-infection using SINV (34). TRIM14 overexpression also increased the transcription of IFNs and interferon stimulated genes (33). The viral proteases' ability to cleave a protein involved in the production of IFN appears to be a common antagonistic mechanism used by this and other Group IV viral proteases. We discuss the similarities of this silencing mechanism with those of CRISPR/Cas9 and RNAi/RISC.
(33) At least eight other Group IV (+)ssRNA viral proteases have been shown to cleave components of the MAVS signalosome to antagonize IFN production suggesting that the assimilation of these short cleavage site motif sequences to host protein sequences may represent an embedded mechanism of IFN antagonism. This interference mechanism shows several parallels with those of CRISPR/Cas9 and RNAi/RISC, but with a protease recognizing a protein sequence common to both the host and pathogen.
(34) The other viral proteases tested, SARS-CoV-2 PLpro, MERS PLpro, and ZIKV ns2B/ns3 protease cut a variety of host substrates, including proteins that have not been previously implicated in immune response generation. For example, MYH6, MYH7, and PROS1 were cut by the SARS-CoV-2 PLpro; PROS1 was also cut by the MERS PLpro. Immune response related protein substrates were also identified such as FOXP3 and ErbB4 (HER4). These proteins were cut by the SARS-CoV-2 and MERS PLpro enzymes (
EXAMPLES
Example 1: Monitoring Cleavage of Human TRIM14 by the VEEV nsP2 Protease In Vitro and in Virus-Infected Cells
(35) The sequences N- and C-terminal to the scissile bond that were recognized by the VEEV nsP2 cysteine protease were previously identified using a set of peptide substrates. The 25-residue substrates containing P19-P6 (Schechter and Berger nomenclature (35)) produced the lowest K.sub.m values (30). A BLAST search (36) using the nsP2 cleavage sites and the human proteome uncovered one protein, TRIM14, which had a high level of sequence identity to the VEEV nsP12 cleavage site. The nsP12 cleavage site QEAGAG (SEQ ID NO: 1) is highly conserved among the more virulent New World alphaviruses, VEEV/EEEV/WEEV, but not in the Old World alphaviruses such as SINV, SFV, and CHIKV (
(36) Using a cyan and yellow fluorescent protein (CFP-YFP) substrate containing 25-amino acids of the human TRIM14 protein, the purified VEEV nsP2 protease was found to cleave the TRIM14 substrate [SEQ ID NO: 4] (
(37) For the recombinant VEEV nsP2 protease [SEQ ID NO: 25], the cleavage site in the CFP-TRIM14-YFP substrate was confirmed by tandem mass spectrometry (
(38) Steady state kinetic parameters were measured to determine if the K.sub.m and V.sub.max measured with the CFP-TRIM14-YFP 25-residue substrate [SEQ ID NO: 4] and recombinant VEEV nsP2 protease [SEQ ID NO: 25] and were similar to those obtained with substrates containing the viral cleavage sites found in the polyprotein [SEQ ID NO: 2 and 3] (
(39) To determine if the cleavage was specific to the VEEV nsP2 protease, the recombinant proteases of VEEV, EEEV, WEEV and CHIKV were expressed and purified. With the 25-residue TRIM14 substrate, complete cleavage of the substrate (50 M) by the VEEV protease (5 M) was visible after 24 h at 233 C. by SDS-PAGE (
(40) TABLE-US-00001 TABLE1 SteadystatekineticparametersfortheVEEVnsP2cysteineproteasemeasuredin 50mMHEPESpH7.0atroomtemperature(R.T.)andtheFRETsubstrates. V.sub.max K.sub.m Substrate Length (U/mg) (M) CFP-V12-YFP VEEPTLEADVDLMLQEAGAGSVETP 25 0.0590.003 123 (SEQIDNO:2) CFP-V34-YFP TREEFEAFVAQQQRFDAGAYIFSSD 25 0.0890.005 214 (SEQIDNO:3) CFP-TRIM14-YFP DCFATGRHYWEVDVQEAGAGWWVGA 25 0.0560.002 212 (SEQIDNO:4) ATGRHYWEVDVQEAGAGWWVGA 22 0.00800.0003 264 (SEQIDNO:5) RHYWEVDVQEAGAGWWVGA 19 0.0120.002 5020 (SEQIDNO:6)
(41) A computer model was created of the binding interactions of TRIM14 with the VEEV nsP2 cysteine protease in order to gain insight into the structural basis of substrate specificity. Like the New World alphaviral substrates, TRIM14 contains a Glu at position P4 which may explain why no cleavage of TRIM14 was observed with the Old World CHIKV nsP2 protease. The CHIKV nsP2 protease contains an Arg at position P4. In the nsP12 cleavage site, the P1-P6 residues are identical in sequence for VEEV/EEEV/WEEV, as are the P1-P5 residues (amino acid residues in a substrate undergoing cleavage are designated P1, P2, P3, P4 etc. in the N-terminal direction from the cleaved bond, while the residues in C-terminal direction are designated P1, P2, P3, P4. etc.). This suggests that residues beyond P5 are important for recognition of the TRIM14 substrate. To understand why the 25-amino acid substrate led to the lowest K.sub.m and highest k.sub.cat, the inventors examined their previously determined crystal structure of the free VEEV nsP2 protease, PDB SEZQ (30). The crystal structure contains the C-terminal P2-P19 residues (Leu-776-Ala-792) of the VEEV nsP23 cleavage site; the P10-P19 residues are helical and are packed against the protease domain in the crystal. The P8-P9 residues are directed into the cleft formed by the protease and SAM MTase domains (data not shown). Chou-Fasman secondary structure predictions suggest that the nsP12 and nsP34 substrates may contain helical regions within the P1-P19 residues.
(42) Regions beyond P5 were examined to understand why the recombinant EEEV and WEEV nsP2 proteases cut CFP-TRIM14-YFP poorly. Based on the K.sub.m values (Table 1) the P13-P19 residues of the substrate appear to make additional contacts to the enzyme. In PDB SEZQ the P17 residue (Ser-778) within the helix of the symmetry related molecule is within hydrogen bonding distance to the backbone NH and CO of the papain-like protease domain residue Met-555. Met-555 is conserved in the VEEV/EEEV/WEEV nsP2 cysteine proteases. The P19-P16 residues of the substrates differ in charge and flexibility in the New World polyproteins and may be recognized differently by these closely related proteases: VEEP in VEEV nsP12; VDKE in EEEV nsP12; and IEKE in WEEV nsP12. The homologous residues in TRIM14 are DCFA. Alternatively, the recombinant EEEV and WEEV proteases may require an additional region of the nsP to attain full activity similar to the ZIKV ns2B-ns3 protease.
(43) Cleavage of the CFP-TRIM14-YFP substrate by mutants of the protease was examined to confirm the models of the VEEV nsP2 cysteine protease (
(44) Sequence alignment analysis showed that full length TRIM14 (442 amino acids, 49.8 kDa) and the TRIM14-a isoform (406 amino acids, 45.1 kDa) contain the cleavage site while the TRIM14- isoform (28.3 kDa) does not. TRIM14 was shown to be poly-ubiquitinated at K48 and K63 (32), and multiple bands were detected in immunoblots (
(45) The calculated molecular weights of unmodified TRIM14 cleavage products are 37.2 kDa and 12.6 kDa (or 7.9 for the TRIM14 isoform) (
(46) TRIM14 cleavage in VEEV-infected cells was monitored over time, and cell lysates were collected at 6, 12, 24, 36, 48, 72, and 96 hours. The band intensities varied over time; however, only the VEEV- and WEEV-infected cell lysates contained a new 37 kDa cleavage product that was not found in the uninfected controls (
(47) CA074 methyl ester (CA074me) was previously shown to inhibit the alphaviral VEEV nsP2 cysteine protease (42). CA074me is a Cathepsin B inhibitor; however, no other host enzymes have been shown to cleave the nonstructural polyprotein (37). CA074 is a peptide-like irreversible covalent inhibitor that specifically reacts with the nucleophilic Cys of the proteases. CA074me is the membrane permeable form of the inhibitor (prodrug). CA074me was added to cells that were infected with VEEV, and cell lysates were collected and subjected to immunoblotting. The TRIM14 cleavage product was no longer present in the CA074me-treated cells consistent with inhibition of the VEEV nsP2 cysteine protease (
(48) TRIM14 expression can be detected in the absence of virus (32) indicating that this protein is an intrinsic immune response effector protein. TRIM14 expression can also be further induced by IFNs and can also be considered as an innate immune response effector (41). Upon viral infection Lys-63-linked polyubiquitination of TRIM14 at Lys-365 occurs and was shown to be important for the assembly of the MAVS signalosome (32). Thus, cleavage of the unmodified TRIM14 may interfere with the assembly of the MAVS signalosome (
(49) For acute viral infections, species-specific anti-viral enzymes and proteins that interfere with and counteract viral replication (sometimes referred to as viral restriction factors) exist. One domain within TRIM14 appears to be important to its anti-viral functions and may account for species-specific anti-alphaviral responses (40. Human VEEV infections rarely result in lethal encephalitis (1% of infected humans), whereas mortality rates in equine are significantly higher (e.g., EEEV's mortality rate can be as high as 90%) suggesting an inherent difference between the innate immune responses of equid vs. humans. Comparison of TRIM14 homologues from various species showed strong conservation of the full length TRIM14 sequence in humans, monkeys, rodents, pigs, cows, and chickens. The C-terminal region of equine TRIM14 is notably different, indicating that equines may harbor a different TRIM14 homologue or isoforms. The C-terminal region of TRIM14 that is cut by the viral protease was predicted to form a PRY/SPRY domain. The VEEV nsP2 cysteine protease cleavage site is within this predicted domain. The SPRY domain is a -stranded protein interaction module commonly found in human proteins that regulate innate and adaptive immunity (43); the PRY motif consists of 3 additional -strands N-terminal to the SPRY domain. PRY/SPRY domains contain hypervariable loop regions and a conserved core similar to a variable domain of an antibody (44). The binding specificity of the SPRY domain determines the function of the TRIM protein, and mutations within this domain have been associated with disease susceptibility (44). This domain appears to be important for mounting an effective immune response against alphaviruses, as well as HCV (40). The transient proteolytic cleavage of the PRY/SPRY domain during infection, or a difference in this domain as in the case of equine TRIM14, may impair a species' ability to mount an effective antiviral immune response to alphaviruses.
(50) PRY/SPRY domains can be identified by 3 highly conserved sequence motifs (LDP, WEVD/E, LDYE/D). These three motifs are present in the human TRIM14 homologue, but are absent from some of the equine TRIM14 homologues. Interestingly, the donkey homologue contains the LDYE motif, but lacks the other two motifs. The presence or absence of the PRY/SPRY domain of TRIM14 was not sufficient to predict the virulence or pathogenicity of VEEV in other species; e.g., VEEV infections can be lethal in mice and the murine TRIM14 contains the PRY/SPRY domain. The role of TRIM14 and the downstream effectors (e.g, IFN-stimulated genes, ISG) of this pathway have not been examined across species and may differ. Species-specific differences in the Jak/STAT pathway, a pathway triggered by type I IFN, also cannot be excluded.
(51) The PRY/SPRY domain is thought to mediate the association of TRIM14 to the C-terminal domain (residues 360-540) of MAVS (32) (
Example 2: Monitoring the Cleavage of Human Sequences by the SARS-CoV-2 Papain-Like Protease In Vitro
(52) The vast majority of host proteins cleaved by Group IV viral proteases have been shown to be involved in generating the innate immune responses (94). The cleavage of host proteins by viral proteases is a type of transient post-translational or co-translational silencing (
(53) A novel bioinformatic method developed by the inventors revealed other potential host substrates in humans (
(54) Bovine heart lysates made from the left ventricle (LV) were then treated with the SARS-CoV-2 and MERS PLpro enzymes [SEQ ID NOs: 26, 27] and cleavage of MYH6 was detected in immunoblots probed with an anti-MYH6 antibody (
(55) Recombinant FOXP3 protein (1-260 amino acids) was also shown to be cut by the SARS-CoV-2 and MERS PLpro enzymes. The cleavage site was N-terminal to the DNA binding domain and the scissile bond was confirmed by mass spectrometry. FOXP3 is a key transcription factor in Treg cells, the cells that tamp down immune responses at the end of an infection to prevent damage of tissues. ErbB4 (HER4) and the anti-coagulation protein Protein S (PROS1) were also cut. Knockout of ErbB4 in mice produces a phenotype similar to bronchopulmonary dysplasia. Deficiencies of PROS1 lead to a variety of blood clots (e.g. pulmonary embolisms, strokes, deep vein thrombosis). Heart failure, excessive lung inflammation and blood clots were observed in COVID-19 infections.
Example 3: Monitoring the Cleavage of Human Sequences by the ZIKV ns2B-Ns3 Protease In Vitro
(56) Human host protein substrates were predicted for the ns2B-ns3 protease of Zika virus. CFP-YFP substrates were: FOXG1, SFRP1, NT5M and Gs, alpha. In animal models, the cleavability of a host protein called STING correlated with the appearance of Dengue virus symptoms and pathology (96). Animals with uncleavable sequences showed little to no pathology. The uncleavable sequences could be made cleavable by single amino acid substitutions.
(57) Thus, the identity of cleavable sequences [SEQ ID NO: 4, 5, 6, 7-22] may enable the production of transgenic animals carrying these sequences. The recapitulation of the disease pathology, or aspects of the pathology is necessary for testing drugs and vaccines that prevent the pathology. Virus-infected mice and rats often do not display the same pathology as seen in humans. The SFRP1 cleavage site sequence [SEQ ID NO: 21] was the same in humans and chickens; these two species develop microcephaly when infected with ZIKV. Rats and mice had a different SFRP1 sequence in this region and do not develop the microcephaly (94).
(58) Disease severity can also differ between species. The cleavable sequences identified using the methods described herein, can be searched for in BLAST and any species carrying the cleavable sequence can be identified and tested with live virus to determine if other species can be used as animal models for the virus being examined. Badorff, et al (97) demonstrated that proteases from enteroviruses that cause cardiomyopathy can cut dystrophin and that the cleavage was linked with the cardiomyopathy. A cleavage-resistant knock-in mouse carrying a mutated dystrophin sequence had a decrease in the cardiomyopathy caused by coxsackievirus B2, linking the proteolytic cleavage of dytrophin with the cardiomyopathy (98).
(59) Discussion
(60) The proteolytic cleavage of components of the MAVS signalosome by viral proteases appears to be a common mechanism for innate immune response evasion by Group IV (+)ssRNA viruses (
(61) The characteristic cleavage products of viral proteases may also produce valuable biomarkers of viral infection and could be useful in the evaluation of the therapeutic efficacy of antiviral protease inhibitors in vivo. For example, MAVS cleavage products were observed in humans with chronic HCV infections, but not in controls, and the cleavage of MAVS by the HCV ns3-4A protease was associated with higher viral loads (73). Since biomarkers for alphaviral infections are relatively uncharacterized, the cleavage of TRIM14 or the downstream effects of cleavage, or both, may be useful indicators of VEEV infection. In SARS-CoV-2 infected cardiomyocytes, the cleavage of sarcomeres is evident and consistent with the cleavage of the cardiac myosins and other predicted sarcomeric proteins (99). Reductions in PROS1 were also observed in 3 studies on humans infected with SARS-CoV-2 (95).
(62) The cleavage of human host proteins by viral proteases has been previously recognized by others (56;65;66;69;78-83) and may reflect a general antagonistic strategy akin to CRISPR/Cas9 and RNAi/RISC (
(63) A protein version of CRISPR/Cas9 and RNAi/RISC has not been previously described, but could rely on short stretches of homologous host-pathogen protein sequences (SSHHPS) and a protease that cleaves them (
(64) What is common among these three mechanisms of silencing is that they each rely on a short sequence to identify a larger target sequence to destroy; they are analogous to search and delete algorithms that utilize a keyword to identify a file to delete (
Materials and Methods
(65) Materials. RIPA buffer, Halt Protease Inhibitor Cocktail (100 solution of six protease inhibitors that prevents proteolytic degradation) and all general chemicals were purchased from Fisher Scientific (Waltham, MA). Plasmid constructs were synthesized by Genscript USA, Inc. (Piscataway, NJ). BugBuster (gentle disruptor of E. coli cell wall) and IPTG (420291) (inducer of -D-galactosidase) were purchased from EMD Millipore (Billerica, MA). Column resins and PD-10 gel filtration columns were purchased from G. E. Healthcare (Marlborough, MA). EDTA-free Protease inhibitor tablets were from Roche, Inc. Black half-area Corning 3993 non-binding surface 96-well plates were from Corning Inc. (Corning, NY). SDS-PAGE acrylamide gels (8-16% gradient) and running buffers were from Thermo Scientific (Rockford, IL) or Abcam (Waltham, MA). The anti-TRIM14 antibody (HPA053217), the anti-actin antibody (A1978) and secondary HRP-conjugated antibodies were from Sigma (St. Louis, MO). The anti-MYH7 mouse mAb primary antibody (ab11083) and anti-MYH6 (ab207926) were from Abcam Inc. (Waltham, MA). Anti--actin C4 antibody (MAB1501R) was from Millipore, Inc. (Burlington, MA).
(66) Bioinformatics. PHI-BLAST was used to search the human proteome. The viral protease cleavage sites from the polyprotein were identified based upon sequence similarity to a known cleavage site for a related virus. The 15-25 amino acid stretch was used in PHI-BLAST (searcher of protein sequences using a combination of pattern matching and local alignment) with a short pattern of 4 amino acids derived from the cleavage sites in the viral polyprotein. The pattern typically contains P1 and P1. This pattern sequence limits the number of proteins in the output to those that are most likely to be substrates. The PHI-BLAST output files contain the percent identity, percent positives, alignment length, bit score, and other parameters. These numerical values were plotted. The graphs showing the alignment length vs. percent positives show a trend (
(67) Plasmid Constructs of FRET Substrates. A pET-15b plasmid (Ampicillin.sup.R) encoding cyan fluorescent protein (CFP), an nsP viral protease cleavage site motif (e.g. AG(A/C)(G/Y/A)) and yellow fluorescent protein (YFP) in between the NdeI and XhoI cut sites were synthesized. An N-terminal hexa-histidine tag preceded a thrombin cleavage site. Six CFP-YFP constructs were used for the alphaviral substrates: V12 which contains 25-residues of the VEEV nsP12 cleavage site [SEQ ID NO: 2]; V34 which contains 25-residues of the VEEV nsP34 cleavage site [SEQ ID NO: 3]; S12 which contains 25-residues of the SFV nsP12 cleavage site [SEQ ID NO: 17]; and ones containing 25-, 22-, or 19-residues of human TRIM14 [SEQ ID NO: 4, 5, 6]. Similar constructs were made for the coronaviral substrates [SEQ ID NO: 7, 8, 9, 10, 11, 12] and Zika substrates [SEQ ID NO: 19, 20, 21, 22] and uncleavable controls [SEQ ID NO: 23, 24].
(68) The nsP2 cysteine protease-SAM MTase of CHIKV in a modified pMCSG9 vector (84) was provided by Dr. Jonah Cheung at the New York Structural Biology Center. The CHIKV protease/SAM MTase were fused to a decahistidine-tagged maltose-binding-protein at the N-terminus that could be cleaved using TEV protease. The pet15 plasmid encoding the ZIKV ns2B/ns3 protease was provided by Dr. Rolf Hilgenfeld and Dr. Jian Lei at Univ. Lbeck, Germany. Constructs of the CoV papain-like proteases were provided by Dr. Scott Pegan at University of Georgia.
(69) Expression & Purcation of the nsP2 Cysteine Proteases. To ensure purification of the reduced state of the VEEV nsP2 cysteine protease (85), we used an nsP2-thioredoxin (Trx) fusion protein containing the protease and SAM MTase domains (residues 457-792). The EEEV and WEEV nsP2 cysteine proteases were expressed and purified using a similar protocol with an additional Q-Sepharose column purification step prior to the SP-Sepharose column. BL-21(DE3) pLysS E. coli were transformed with the Trx-VEEV-nsP2 plasmid. Luria Bertani (LB) media (3-6 L) containing 50 g/mL ampicillin and 25 g/mL chloramphenicol was inoculated and grown to an OD.sub.600 of approximately 1.0 and induced with 0.5 mM IPTG overnight at 17 C. Cells were pelleted and lysed with lysis buffer (50 mM Tris pH 7.6, 500 mM NaCl, 35% BugBuster, 5% glycerol, 2 mM -mercaptoethanol (BME), 25 U of DNase 0.3 mg/mL lysozyme) and sonicated ten times for 15 second intervals in an ice bath. Lysates were clarified by centrifugation at 20,000g for 30 minutes and loaded onto a nickel column equilibrated with 50 mM Tris pH 7.6, 500 mM NaCl, 2 mM BME, 5% glycerol. The column was washed with the same buffer containing 60 mM imidazole. Protein was eluted using the same buffer containing 300 mM imidazole. Protein was dialyzed with thrombin (overnight at 4 C.) against 50 mM Tris pH 7.6, 250 mM NaCl, 5 mM DTT, 1 mM EDTA, 5% glycerol, and then diluted 1:3 with Buffer A (50 mM Tris pH 7.6, 5% glycerol, 5 mM DTT) and loaded onto an SP-Sepharose column equilibrated with Buffer A. Protein was eluted using a salt gradient (0-1.25 M NaCl) and then concentrated, flash frozen in liquid nitrogen, and stored at 80 C. or stored at 20 C. in buffer containing 50% glycerol. The buffer was exchanged to the corresponding assay buffer (50 mM HEPES pH 7.0) prior to all kinetic experiments using PD-10 columns. The CHIKV nsP2 protease was expressed from a construct produced by Chung et al. (86) and was purified using a similar method; the His-tag and MBP were removed. The ZIKV and CoV viral proteases were purified using similar methods.
(70) Expression & Purcation of FRET Protein Substrates. BL-21(DE3) E. coli were transformed with the plasmids encoding the substrates. LB/Amp (1.5 to 3.0 L) was inoculated and grown to an OD.sub.600 of approximately 1.0 and induced with 0.5 mM IPTG overnight with shaking at 17 C. Cells were pelleted by centrifugation, lysed with lysis buffer (50 mM Tris pH 7.6, 500 mM NaCl, 35% BugBuster, 2 mM BME, 0.3 mg/mL lysozyme, 1 EDTA-free protease inhibitor tablet), and briefly sonicated for 1 minute in an ice bath. Lysates were clarified by centrifugation (20,500g for 30 minutes at 4 C.) and loaded onto a nickel column equilibrated with 50 mM Tris pH 7.6, 500 mM NaCl, 2 mM BME. The column was washed with the same buffer after loading and with 10-20 column volumes of buffer containing 60 mM imidazole until the A280 returned to baseline. The protein was eluted with the same buffer containing 300 mM imidazole. The protein was dialyzed against 50 mM Tris pH 7.6, 150 mM NaCl overnight at 4 C. with 50 U thrombin. The His-tag was removed by re-running the protein on a nickel column and collecting the flow-through. The protein was then dialyzed against 50 mM Tris pH 7.6, 5 mM EDTA, 250 mM NaCl (overnight at 4 C.), followed by dialysis against 50 mM Tris pH 7.6 (2 hours). Protein was loaded onto a Q-Sepharose column equilibrated with 50 mM Tris pH 7.6 and eluted with a salt gradient (0 to 1 M NaCl). All substrates were produced in high yield (typical yields were 60-80 mg per liter of media) and could be readily concentrated to 9.0-10.5 mg/mL. The substrates were used for continuous and discontinuous assays. Similar substrates have been used to study other proteases (87;88).
(71) TABLE-US-00002 TABLE2 CFP-YFPsubstrates Substrate Sequence Length Proteasescuttingthesubstrate CFP-MYH6/7- EAEQIALKGGKKQLQK(SEQIDNO:7) 16 SARS-CoV-2,MERSPLpro YFP CFP-MYH6/7- GGPHRLDEAEQIALKGGKKQLQK 23 SARS-CoV-2,MERSPLpro YFP (SEQIDNO:8) CFP-PROS1-YFP IYHSAWLLIALPGGKIEVQL(SEQIDNO:9) 20 SARS-CoV-2,MERSPLpro CFP- LKNLTRILNGGVYVDQ(SEQIDNO:10) 16 SARS-CoV-2PLpro ErbB4(HER4)- YFP CFP-FOXP3-YFP GGTFQGPDLRGGAHASSS(SEQIDNO:11) 18 SARS-CoV-2,MERSPLpro CFP-FOXP3-YFP LLSARGPGGTFQGRDLPGGAHASSS 25 SARS-CoV-2,MERSPLpro (SEQIDNO:12) CFP-TRIM14-YFP RHYWEVDVQEAGAGWWVGA(SEQIDNO:13) 19 VEEVnsP2cysteineprotease CFP-TRIM14-YFP ATGRHYWEVDVQEAGAGWWVGA 22 VEEVnsP2cysteineprotease (SEQIDNO:14) CFP-TRIM14-YFP DCFATGRHYWEVDVQEAGAGWWVGA 25 VEEVnsP2cysteineprotease (SEQIDNO:15) CFP-SFVp12-YFP DVEELEYHAGAGVVETP 17 CHIKVandVEEVnsP2 11:6 (SEQIDNO:16) cysteineprotease CFP-SFVp12-YFP AETGVVDVDVEELEYHAGAGVVETP 25 CHIKVandVEEVnsP2 19:6 SEQIDNO:17) cysteineprotease CFP-VEEVnsP12- VEEPTLEADVDLMLQEAGAGSVETP 25 VEEVnsP2cysteineprotease YFP (SEQIDNO:2) CFP-VEEVnsP23- LSSTLTNIYTGSRLHEAGCAPSYHV 25 VEEVnsP2cysteineprotease YFP (SEQIDNO:18) CFP-VEEVnsP34- TREEFEAFVAQQQRFDAGAYIFSSD 25 VEEVnsP2cysteineprotease YFP (SEQIDNO:3) CFP-SFRP1-YFP MGIGRSEGGRRGAALGVLLALGAAL 25 ZIKVns2B-ns3protease (SEQIDNO:19) CFP-GsGTPalpha- PVRSSAPRRGHSVASAPRSGLRQVAGRRGAALPCS 35 ZIKVns2B-ns3protease YFP (SEQIDNO:20) CFP-NT5M-YFP MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGR 34 ZIKVns2B-ns3protease (SEQIDNO:21) CFP-FOXG1-YFP RSTTSRAKLAFKRGARLTSTG(SEQIDNO:22) 21 ZIKVns2B-ns3protease CFP-SFRP2-YFP MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFS 34 Control,notcleavedbyZIKV (SEQIDNO:23) ns2B-ns3protease CFP-SFRP4-YFP MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRH 34 Control,notcleavedbyZIKV (SEQIDNO:24) ns2B-ns3protease
(72) In the practical examples described herein, the sequences in Table 2 above were typically used with a cyan fluorescent protein (CFP) and yellow fluorescent protein (YFP) at their N-terminus and C-terminus, respectively. However, one could use alternative fluorophores to facilitate detection of substrate cleavage, preferably a FRET pair of fluorophores. Moreover, one could use the substrates without fluorophores and instead detect cleavage by other means, such as immunohistochemistry (IHC), enzyme linked-immunosorbent assay (ELISA), SDS-PAGE, mass spectrometry, and/or flow cytometry.
(73) TABLE-US-00003 TABLE3 RecombinantProteases Protease Sequence Length RecombinantVEEV MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNI 467 nsP2-thioredoxin DQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHH Proteasecontaining SSGLVPR*GSMRHILERPDPTDVFQNKANVCWAKALVPVLKTAGIDMTTEQWNTVDYFETD residues457-792 KAHSAEIVLNQLCVRFFGLDLDSGLFSAPTVPLSIRNNHWDNSPSPNMYGLNKEVVRQLSR RYPQLPRAVATGRVYDMNTGTLRNYDPRINLVPVNRRLPHALVLHHNEHPQSDFSSFVSKL KGRTVLVVGEKLSVPGKMVDWLSDRPEATFRARLDLGIPGDVPKYDIIFVNVRTPYKYHHY QQCEDHAIKLSMLTKKACLHLNPGGTCVSIGYGYADRASESIIGAIARQFKFSRVCKPKSS LEETEVLFVFIGYDRKARTHNPYKLSSTLTNIYTGSRLHEA[SEQIDNO:25) Recombinant MGSSHHHHHHSSGLVPRGSHMEVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGAD 336 SARS-CoV-2 VTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL Papain-like TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGEL Protease GDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIP CTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYC IDGALLTKSSEYKGPITDVFYKENSYTTTIK[SEQIDNO:26] Recombinant MGSSHHHHHHSSGLVPRGSHMGSSHHHHHHSSGLVPRGSQLTIEVLVTVDGVNFRTVVLNN 361 MERS-CoV-2 KNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRF Papain-like YSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKEVIPALQHAFMKHKGGD Protease STDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLK ACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAF NVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCN [SEQIDNO:27] RecombinantZIKV MGSSHHHHHHSSGLVPRGSHMVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVE 247 ns2B/ns3Protease DDGPPMAGGGGSGGGGSGALWDVPAPKEVKKGETTDGVYRVMTRGLLGSTQVGVGVMQEGV FHTMWHVTKGSALRSGEGRLDPYWGDVKQDLVSYSGPWKLDAAWDGHSEVQLLAVPPGERA RNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKSGRVIGLYGNGVVIKNGSYVSAITQ GRR[SEQIDNO:28] Recombinant SNAFQNKANVCWAKSLVPILETAGIKLNDRQWSQIIQAFKEDKAYSPEVALNEICTRMYGV 324 CHIKVnsP2 DLDSGLFSKPLVSVYYADNHWDNRPGGKMFGFNPEAASILERKYPFTKGKWNINKQICVTT protease RRIEDFNPTTNIIPVNRRLPHSLVAEHRPVKGERMEWLVNKINGHHVLLVSGYNLALPTKR VTWVAPLGVRGADYTYNLELGLPATLGRYDLVVINIHTPFRIHHYQQCVDHAMKLQMLGGD SLRLLKPGGSLLIRAYGYADRTSERVICVLGRKFRSSRALKPPCVTSNTEMFFLFSNFDNG RRNFTTHVMNNQLNAAFVG [SEQIDNO:29]
(74) Continuous FRET Assay. For measurement of steady state kinetic parameters the method described by Ruge et al. was followed (88). Cleavage of the YFP/CFP FRET substrates was monitored continuously at room temperature (233 C.) using excitation/emission wavelengths of 434/470 nm and 434/527 nm to calculate emission ratios and a SpectraMax M5 plate reader from Molecular Devices. The substrate was buffer-exchanged into 50 mM HEPES pH 7.0. Enzyme concentrations of 1 M and a substrate concentration range of 10-140 M (8 different concentrations) were used to measure Steady State kinetic parameters. Data were collected in triplicate (50 L reaction volumes) in half-area black low binding surface 96-well plates from Corning, Inc. After the reads were completed the plates were sealed with film and allowed to digest overnight at room temperature 233 C. Final emission ratios were read the next day. The fraction of substrate cleaved, f, was calculated from the emission ratios at each time point using the following equation:
(75)
The nmols of substrate cleaved at each time point was calculated by multiplying f by the nmols of substrate at t=0 (S.sub.o). The value of r.sub.uncut corresponds to the emission ratio measured in the absence of enzyme, and the value of r.sub.cut is the emission ratio measured when the substrate was fully cleaved. Initial velocities were calculated at each [S] concentration from the linear range (f20%). Plots of time vs. nmols were linearly fit for each [S] concentration, and v.sub.o was obtained from the slopes of the lines. Rates of spontaneous hydrolysis were measured in the absence of enzyme and were subtracted from the enzyme catalyzed rates. Data were fit to the Michaelis-Menten equation, v.sub.o=(V.sub.max*[S])/(K.sub.m+[S]), using Grafit (Erithricus Software Ltd., Surrey, UK).
(76) Discontinuous Gel-Based Assay. Reaction mixtures (5 M nsP2-Trx, 50 M FRET substrate [SEQ ID NOs: 2-24], 50 mM HEPES pH 7.0, 150 mM NaCl) were incubated overnight (18 h) at room temperature (233 C.). The reactions were run until >90% of the substrate was cleaved by the enzyme. Reactions were stopped by mixing with Laemelli buffer (1:1) and heating the samples for 3 minutes at 70 C. Cleavage products (10 L) were separated by SDS-PAGE in 12-well 8-16% gradient gels in BupH running buffer (100 mM Tris, 100 mM HEPES, 3 mM SDS, pH 80.5) at 110 V for 50 minutes. The calculated molecular weight of the uncut TRIM14 FRET substrate containing a 25 amino acid cleavage sequence was 56.7 kDa, and 29.2 kDa and 27.5 kDa for the cut CFP and YFP products, respectively. The molecular weight of the enzyme for the thioredoxin-His-tagged enzyme was 52.208 kDa, and 38.29 kDa for the Tag-free enzyme. The bands were well separated in 8-16% gradient gels, and boiling of the samples was required to achieve the sharp banding pattern. Densitometry was done using the BioRad Gel Dock Imager software (BioRad Inc., Hercules, CA).
(77) Mass Spectrometry. Gel bands were washed with 250 mM ammonium bicarbonate in 50% acetonitrile (ACN) until completely destained. Bands were then cut into small cubes and dehydrated by 100% (ACN). Modified porcine trypsin solution (Promega, product no. V511) in 50 mM ammonium bicarbonate was added to the gel cubes, and proteins were in gel digested overnight. The resulting peptides were extracted from the gel pieces by sonication in 2% formic acid (FA) in 60% ACN. The extracts were then collected, and this step was repeated three more times. A final gel dehydration step (i.e., sonication with 100% ACN) was used to minimize peptide loss. Peptide digests corresponding to the same band were combined and concentrated via speed-vac.
(78) Concentrated in-gel digests were reconstituted in 0.1% FA and 5% ACN and injected onto a reverse phase column (C18, Michrom MagicC18AQ-5 200 0.1150 mm) using a Tempo MDLC system (AB Sciex, Foster City, CA) coupled to a quadrupole-time of flight MS/MS Q-Star Elite mass spectrometer (AB Sciex). Peptides were loaded onto the column using 98% solvent A (5% ACN, 0.1% FA in water) and 2% solvent B (95% ACN, 0.1% FA in water) for 30 min and separated by a 130 min linear gradient of increasing solvent B by 0.37%/min to a final concentration of 50%. MS and MS/MS peptide spectra were acquired using information dependent acquisition (IDA). A mass range of 350-1600 Da was monitored in TOF MS scan. The three most abundant precursor ions from TOF MS scans with an intensity >20 counts per second were submitted for MS/MS analyses. Former target ions were excluded from MS/MS submission for 15 s. MS data were acquired using Analyst QS (AB Sciex), and tandem mass spectra were extracted by mascot.dll and analyzed using Mascot (Matrix Science, London, UK; Mascot Server version 2.4.1). Mascot was set up to search three in house databases: 1: contaminants 20120713 (247 sequences; 128,130 residues), 2: cRAP 20121128 (112 sequences; 37,418 residues), and 3: VEEV database (6 sequences; 1,980 residues). Common contaminants were included in the first two databases while the complete VEEV protease, thioredoxin, complete sequence of CFP-TRIM14-YFP, as well as its predicted N-terminal and C-terminal sequences as produced by VEEV. Assuming the digestion was semitryptic (at least one peptide terminal was R or K) and allowing for 3 miscleavages. Fragment ion mass tolerance was set to 0.20 Da and a parent ion tolerance to 0.20 Da. Deamidation of asparagine and glutamine, oxidation of methionine were set as variable modifications. After identification by Mascot, the spectra of resulting N-terminal and C-terminal peptides of CFP-TRIM14-YFP [SEQ ID NO: 4] products from VEEV proteolysis: were inspected manually in the raw acquired data, and the resulting singly charged fragments were manually annotated. MS confirmation of CoV PLpro cleavage was also performed for [SEQ ID NOs: 8, 9, 11] (94).
(79) Western Blotting. Cells were lysed in RIPA buffer containing Halt Protease Inhibitor Cocktail at a 2 final concentration. Lysates were separated in a 10% NuPAGE Bis-Tris gel and electroblotted onto a nitrocellulose membrane using the iBlot system (Invitrogen). Following protein transfer, blots were blocked in 1PBS containing 0.05% Tween-20 and 5% dry milk and incubated at 4 C. overnight. Protein-specific primary antibodies were diluted in blocking buffer and incubated at RT for 2 hrs. Following incubation, blots were washed 3 times with PBS containing 0.05% Tween-20 (PBST). After washing blots were incubated with corresponding secondary antibody at RT for 1 hr then washed 3 times with PBST. For protein detection, blots were treated with SuperSignal West Pico Chemiluminescent Substrate and imaged using BioRad imaging software. Trim14 protein was detected using a polyclonal anti-Trim14 Ab (1:500, HPA053217) followed by goat anti-rabbit Horseradish peroxidase (HRP, 1:500) secondary Ab. Actin protein was detected using anti-actin Ab (1:5000) followed by goat anti-mouse HRP (1:5000) secondary Ab. The VEEV nsP2 protein was detected using goat anti-VEEV nsP2 Ab (kind gift from AlphaVax, Research Triangle Park, NC, 1:1000) followed by rabbit anti-goat HRP (1:5000) secondary Ab.
(80) A549 cells (adenocarcinoma human alveolar basal epithelial cells) were used. Infected A549 cell lysates collected at 6 and 24 h post-infection (10 g/lane) were separated in a 10% NuPAGE Bis-Tris gel and transferred onto a nitrocellulose membrane. Trim14-, Trim14- cleavage product (CP), and -actin were detected by Western blot analysis using protein specific antibodies. Recombinant Human Trim 14 protein was used as control. The VEEV Trinidad, EEEV FL93-939, WEEV CBA87, and CHIKV AF15561 viruses were used.
(81) To test the effects of a previously identified VEEV nsP2 cysteine protease inhibitor (42), CA074 methylester (CA074me), A549 cells were treated with CA074me and infected at a multiplicity of infection equal to 10 with VEEV or CHIKV. After incubation of virus with cells for 1 h, cell monolayers were washed twice with medium to remove residual virus. Complete medium containing CA074me (50, 100, 200 M) was added, and the cells were incubated at 37 C., 5% CO.sub.2. At 18-24 h post-infection, supernatants and cell lysates were collected for analysis by western blot.
(82) The specificity of the polyclonal rabbit Sigma Prestige anti-TRIM14 antibody (HPA053217) has already been analyzed and is available online (38). The HPA053217 antibody had been raised using an N-terminal sequence is common to full-length TRIM and the - and -isoforms of TRIM14. The sequence precedes the ubiquitination site
(83) Modeling of Substrate binding interaction. The binding models of substrates including VEEV P12, P23, P34 and TRIM14 were predicted with an ensemble-docking protocol using the AutoDock program (89). Multiple conformations of the VEEV nsP2 structure (PDB 2HWK) and the CHIKV nsP2 (PDB 3TRK) were obtained from MD simulations and cluster analysis. The active site of the protein was defined by a grid of 707070 points with a grid spacing of 0.375 centered at the catalytic residue Cys-477. The Lamarckian Genetic Algorithm (LGA) was applied with 50 runs, and the best pose with the most favorable binding free energy was selected. MD simulations were performed for the predicted substrate binding models using the AMBER 12 package and the ff99SB force field. The solvated systems were subjected to a thorough energy minimization prior to MD simulations. Periodic boundary conditions were applied to simulate a continuous system. The particle mesh Ewald (PME) method was employed to calculate the long-range electrostatic interactions. The simulated system was first subjected to a gradual temperature increase from 0 K to 300 K over 100 ps, and then equilibrated for 500 ps at 300 K, followed by production runs of 2-ns length in total. The binding free energies were calculated using the MM-PBSA method. Decomposition of the calculated binding free energies was performed using the same MM-PBSA module in AMBER 12 package.
(84) Detection and Treatment of Infection
(85) Cleavage products of the proteases listed in Table 2 could be used diagnostically. For example, material (such as blood or tissue) from an individual could be assayed for the possible presence of a product to determine whether or not the patient might be infected with a particular virus. This can involve the detection of one or more cleavage products of any one or more of VEEV nsP2-thioredoxin protease, SARS-CoV-2 papain-like protease, MERS-CoV papain-like protease, ZIKV ns2B/ns3 protease, and CHIKV nsP2 protease, among others. Such an assay can be performed using any suitable technique, for example immunohistochemistry (IHC), enzyme linked-immunosorbent assay (ELISA), mass spectrometry, and/or flow cytometry.
(86) At least eight other Group IV (+)ssRNA viral proteases have been shown to cleave components of the MAVS signalosome to antagonize IFN production, suggesting that the recombination or assimilation of these short cleavage site motif sequences to host protein sequences may represent an embedded mechanism of IFN antagonism. Thus, it is expected that the technique could be used to detect host-pathogen interactions during infection by other members of this viral family.
(87) Such a technique could be incorporated into a diagnostic assay or predictive software program.
(88) If a viral infection is detected in a patient, then that patient should be provided with a treatment suitable for the treatment. In various aspects, this could include the administration of a therapeutic antibody effective against the detected virus, and/or other suitable medicament.
(89) Post-Translational Silencing
(90) Also contemplated is a protein analog to CRISPR/Cas9 and RNAi/RISC. This system relies on the short stretches of homologous host-pathogen sequences (SSHHPS) and a sequence-specific protease (as opposed to a nuclease) that cleaves them.
(91) The viral genome provides a delivery vehicle for the RNA encoding a wild type or mutated nsP2 protease directly into the cytoplasm (as opposed to endosomal vesicles). Other gene delivery methods could be used to transiently express the nsP2 protease locally, such as mRNA. The catalytic nature of the protease may allow it to turnover many substrates within a cell. Replication of mutant or wild type viruses would offer a mechanism to transiently propagate the effects. This type of proteome editing method has not been exploited previously, and has the potential for therapeutic application since specific targets of the viral proteases were identified (Tables 1, 2).
(92) In one embodiment, a host cell or organism expresses a recombinant viral nonstructural polyprotein that incorporates the sequence acted upon by the viral nsP protease such as a transgenic animal model harboring mutation(s) that convert a host protein from an uncleavable sequence to a cleavable sequence. Introduction of the virus to the cell or organism results in cleavage of the sequence in the polyprotein and host protein which can lead to loss of function of the protein that is cleaved.
(93) As described above, in vitro trials using CFP/YFP substrates as described above found that viral proteases can cleave specific host protein sequences (14-25 amino acids). Cleavage sites were confirmed via mass spectrometry.
(94) Experiments found that the endogenous TRIM14 protein in human A549 cells could be cleaved using the VEEV nsP2 protease. This process could be halted by treating the cells with the protease inhibitor CA074me. Such treatment also halted viral replication, since the virus could no longer suppress the innate immune responses. This showed that the post-translational silencing of TRIM14 by the viral protease could be controlled with the use of a protease inhibitor
(95) A further aspect involves identifying targets for proteome editing in silico. The targets have relationships to the observed symptoms caused by the virus. Computer hardware and software (including, for example, virtual machines) can be used to compare viral protease recognition sequences against a list of proteins in a host to find potential matches. Suitable software can include, for example, the pattern-hit initiated basic local alignment search tool (PHI-BLAST) and the bioinformatics methods described. Potential targets can then be tested in vitro to confirm or reject the findings made in silico.
(96) Protease expression could be induced in any number of ways, such as by introducing mRNA to cells, introducing DNA for the development of transgenic animal models, or infection with a suitable virus. Optionally, the virus is attenuated and/or genetically modified. Recombinant forms protease could also be used to cleave extracellular proteins in some cases.
(97) Proteases from bacterial pathogens that recognize human proteins such as botulinum neurotoxin have been utilized for a variety of clinical applications. The SARS-CoV-2 PLpro specifically cleaved a sequence within the human anticoagulation protein (Protein S, PROS1), cardiac myosins (MYH6, MYH7), FOXP3, and erbB4(HER4). The Zika virus protease cleaved sequences in human FOXG1, SFRP1, NT5M, and Gs,alpha (GAS).
(98) In a further embodiment, a viral protease is mutated to act upon an amino acid sequence of interest (different from the homologous host-pathogen protein sequence), so that the introduction of a virus carrying the mutated protease results in proteolysis of the desired target.
Advantages and New Features
(99) Viral proteases could be mutated or used as-is to recognize other host protein sequences to proteolytically shut-off cascades that lead to gene expression or to proteolyze a single protein. Embodiments can include introducing a wild type or modified protease into cells in vitro or in vivo (the cells including, for example, cell culture, tissue culture, and/or living animals optionally including humans) using techniques available in the art such as transfection, transgenics, infection with wild-type or genetically engineered virus, etc. Optionally, one or more genetically engineered or wild-type targets for the protease can be introduced as well. This strategy may be useful to kill tumor cells where oncogene expression has already taken place or for removing protein toxins. Other applications can include therapy to treat or prevent various disease, research into viral infection, and other situations where it can be desirable to cleave proteins within cells.
(100) Alphaviruses can infect a variety of cell types and are pantropic. These viruses cause transient acute viral infections, and attenuated alphaviruses are currently in use for vaccination. The mutations that attenuate the TC-83 vaccine strain do not affect protease activity of the nsP2 cysteine protease. Some alphaviruses like VEEV are also able to cross the blood-brain barrier. The virion may serve as a useful delivery vehicle for RNA and for proteases to the brain.
(101) The substrates sequences identified herein [SEQ ID NOs: 2-22] may be useful for examining competitive inhibitors. These substrates mimic proteins that are present in high concentration in certain cell types (e.g. cardiac myosins) which could interfere with inhibitor binding.
CONCLUDING REMARKS
(102) All documents mentioned herein are hereby incorporated by reference for the purpose of disclosing and describing the particular materials and methodologies for which the document was cited.
(103) Although the present invention has been described in connection with preferred embodiments thereof, it will be appreciated by those skilled in the art that additions, deletions, modifications, and substitutions not specifically described may be made without departing from the spirit and scope of the invention. Terminology used herein should not be construed as being means-plus-function language unless the term means is expressly used in association therewith.
REFERENCES
(104) 1. Steele, K. E., Reed, D., Glass, P. J., Hart, M. K., Ludwig, G. V., Pratt, W. D., Parker, M. D., and Smith, J. F. (2007) Alphavirus Encephalitides, in Medical Aspects of Biological Warfare (Dembek, Z. F., Ed.) pp 241-270, Office of the Surgeon General, Falls Church. 2. Schafer, A., Brooke, C. B., Whitmore, A. C., and Johnston, R. E. (2011) The role of the blood-brain barrier during Venezuelan equine encephalitis virus infection, J Virol. 85, 10682-10690. 3. Ryzhikov, A. B., Tkacheva, N. V., Sergeev, A. N., and Ryabchikova, E. I. (1991) Venezuelan equine encephalitis virus propagation in the olfactory tract of normal and immunized mice, Biomed. Sci. 2, 607-614. 4. Steele, K. E. and Twenhafel, N. A. (2010) REVIEW PAPER: pathology of animal models of alphavirus encephalitis, Vet. Pathol. 47, 790-805. 5. Steele, K. E., Reed, D., Glass, P. J., Hart, M. K., Ludwig, G. V., Pratt, W. D., Parker, M. D., and Smith, J. F. (2007) Alphavirus Encephalitides, in Medical Aspects of Biological Warfare (Dembek, Z. F., Ed.) pp 241-270, Office of the Surgeon General, Falls Church. 6. Hanson, R. P., Sulkin, S. E., Beuscher, E. L., Hammon, W M., MCKINNEY, R. W, and Work, T. H. (1967) Arbovirus infections of laboratory workers. Extent of problem emphasizes the need for more effective measures to reduce hazards, Science 158, 1283-1286. 7. Ehrlich, R. and Miller, S. (1971) Effect of relative humidity and temperature on airborne Venezuelan equine encephalitis virus, Appl. Microbiol. 22, 194-199. 8. Zacks, M. A. and Paessler, S. (2010) Encephalitic alphaviruses, Vet. Microbiol. 140, 281-286. 9. Johnson, K. M. and Martin, D. H. (1974) Venezuelan equine encephalitis, Adv. Vet. Sci. Comp Med 18, 79-116. 10. Deresiewicz, R. L., Thaler, S. J., Hsu, L., and Zamani, A. A. (1997) Clinical and neuroradiographic manifestations of eastern equine encephalitis, N Engl J Med 336, 1867-1874. 11. (2009) Encyclopedia of microbiology Elsevier, New York. 12. Fields, B. N., Knipe, D. M., and Howley, P. M. (2007) Fields' virology Wolters Kluwer Health/Lippincott Williams & Wilkins, Philadelphia. 13. Yin, J., Gardner, C. L., Burke, C. W, Ryman, K. D., and Klimstra, W B. (2009) Similarities and differences in antagonism of neuron alpha/beta interferon responses by Venezuelan equine encephalitis and Sindbis alphaviruses, J Virol. 83, 10036-10047. 14. Garmashova, N., Gorchakov, R., Volkova, E., Paessler, S., Frolova, E., and Frolov, I. (2007) The Old World and New World alphaviruses use different virus-specific proteins for induction of transcriptional shutoff, J Virol. 81, 2472-2484. 15. Hahn, C. S., Lustig, S., Strauss, E. G., and Strauss, J. H. (1988) Western equine encephalitis virus is a recombinant virus, Proc Natl Acad Sci USA 85, 5997-6001. 16. Furr, M. and Reed, S. (2015) Equine Neurology Wiley, Somerset. 17. Akhrymuk, I., Frolov, I., and Frolova, E. I. (2016) Both RIG-I and MDAS detect alphavirus replication in concentration-dependent mode, Virology 487, 230-241. 18. Nikonov, A., Molder, T., Sikut, R., Kiiver, K., Mannik, A., Toots, U., Lulla, A., Lulla, V., Utt, A., Merits, A., and Ustav, M. (2013) RIG-I and MDA-5 detection of viral RNA-dependent RNA polymerase activity restricts positive-strand RNA virus replication, PLoS Pathog. 9, e1003610. 19. Kell, A. M. and Gale, M., Jr. (2015) RIG-I in RNA virus recognition, Virology 479-480, 110-121. 20. Frolova, E. I., Fayzulin, R. Z., Cook, S. H., Griffin, D. E., Rice, C. M., and Frolov, I. (2002) Roles of nonstructural protein nsP2 and Alpha/Beta interferons in determining the outcome of Sindbis virus infection, J Virol. 76, 11254-11264. 21. Zhang, Y, Burke, C. W, Ryman, K. D., and Klimstra, W B. (2007) Identification and characterization of interferon-induced proteins that inhibit alphavirus replication, J Virol. 81, 11246-11255. 22. Schoggins, J. W. and Rice, C. M. (2011) Interferon-stimulated genes and their antiviral effector functions, Curr. Opin. Virol. 1, 519-525. 23. Simmons, J. D., White L J FAUMorrison, T., Morrison T E FAUMontgomery, S., Montgomery S A FAUWhitmore, A., Whitmore A C FAUJohnston, R., Johnston R E FAUHeise, M., and Heise, M. T. Venezuelan equine encephalitis virus disrupts STAT1 signaling by distinct mechanisms independent of host shutoff. 24. Schoggins, J. W. (2014) Interferon-stimulated genes: roles in viral pathogenesis, Curr. Opin. Virol. 6, 40-46. 25. Hollidge, B. S., Weiss, S. R., and Soldan, S. S. (2011) The role of interferon antagonist, non-structural proteins in the pathogenesis and emergence of arboviruses, Viruses. 3, 629-658. 26. Akhrymuk, I., Kulemzin, S. V., and Frolova, E. I. (2012) Evasion of the innate immune response: the Old World alphavirus nsP2 protein induces rapid degradation of Rpb1, a catalytic subunit of RNA polymerase II, J Virol. 86, 7180-7191. 27. Garmashova, N., Gorchakov, R., Volkova, E., Paessler, S., Frolova, E., and Frolov, I. (2007) The Old World and New World alphaviruses use different virus-specific proteins for induction of transcriptional shutoff, J Virol. 81, 2472-2484. 28. Garmashova, N., Atasheva, S., Kang, W, Weaver, S. C., Frolova, E., and Frolov, I. (2007) Analysis of Venezuelan equine encephalitis virus capsid protein function in the inhibition of cellular transcription, J Virol. 81, 13552-13565. 29. Atasheva, S., Fish, A., Fornerod, M., and Frolova, E. I. (2010) Venezuelan equine Encephalitis virus capsid protein forms a tetrameric complex with CRM1 and importin alpha/beta that obstructs nuclear pore complex function, J Virol. 84, 4158-4171. 30. Hu, X., Compton, J. R., Leary, D. H., Olson, M. A., Lee, M. S., Cheung, J., Ye, W, Ferrer, M., Southall, N., Jadhav, A., Morazzani, E. M., Glass, P. J., Marugan, J., and Legler, P. M. (2016) Kinetic, Mutational, and Structural Studies of the Venezuelan Equine Encephalitis Virus Nonstructural Protein 2 Cysteine Protease, Biochemistry 55, 3007-3019. 31. Hirose, S., Nishizumi, H., and Sakano, H. (2003) Pub, a novel PU.1 binding protein, regulates the transcriptional activity of PU.1, Biochem Biophys Res. Commun. 311, 351-360. 32. Zhou, Z., Jia, X., Xue, Q., Dou, Z., Ma, Y, Zhao, Z., Jiang, Z., He, B., Jin, Q., and Wang, J. (2014) TRIM14 is a mitochondrial adaptor that facilitates retinoic acid-inducible gene-I-like receptor-mediated innate immune response, Proc. Natl. Acad. Sci. U.S.A 111, E245-E254. 33. Nenasheva, V. V., Kovaleva G V, F. A. U., Uryvaev L V, F. A. U., Ionova K S, F. A. U., dova A V, F. A. U., Vorkunova G K, F. A. U., Chernyshenko S V, F. A. U., Khaidarova N V, F. A. U., and Tarantul, V. Z. Enhanced expression of trim14 gene suppressed Sindbis virus reproduction and modulated the transcription of a large number of genes of innate immunity. 34. Balistreri, G., Caldentey, J., Kaariainen, L., and Ahola, T. (2007) Enzymatic defects of the nsP2 proteins of Semliki Forest virus temperature-sensitive mutants, J Virol. 81, 2849-2860. 35. Schechter, I. and Berger, A. (1967) On the size of the active site in proteases. I. Papain., Biochem. Biophys. Res. Commun. 27, 157-162. 36. Altschul, S. F., Gish, W, Miller, W, Myers, E. W, and Lipman, D. J. (1990) Basic local alignment search tool, J Mol. Biol. 215, 403410. 37. Strauss, E. G., De Groot, R. J., Levinson, R., and Strauss, J. H. (1992) Identification of the active site residues in the nsP2 proteinase of Sindbis virus, Virology 191, 932-940. 38. Uhlen, M., Fagerberg, L., Hallstrom, B. M., Lindskog, C., Oksvold, P., Mardinoglu, A., Sivertsson, A., Kampf, C., Sjostedt, E., Asplund, A., Olsson, I., Edlund, K., Lundberg, E., Navani, S., Szigyarto, C. A., Odeberg, J., Djureinovic, D., Takanen, J. O., Hober, S., Alm, T., Edqvist, P. H., Berling, H., Tegel, H., Mulder, J., Rockberg, J., Nilsson, P., Schwenk, J. M., Hamsten, M., von, F. K., Forsberg, M., Persson, L., Johansson, F., Zwahlen, M., von, H. G., Nielsen, J., and Ponten, F. (2015) Proteomics. Tissue-based map of the human proteome, Science 347, 1260419. 39. Jia, X., Zhou, H., Wu, C., Wu, Q., Ma, S., Wei, C., Cao, Y, Song, J., Zhong, H., Zhou, Z., and Wang, J. (2017) The Ubiquitin Ligase RNF125 Targets Innate Immune Adaptor Protein TRIM14 for Ubiquitination and Degradation, J Immunol 198, 4652-4658. 40. Wang, S., Chen, Y, Li, C., Wu, Y, Guo, L., Peng, C., Huang, Y., Cheng, G., and Qin, F. X. TRIM14 inhibits hepatitis C virus infection by SPRY domain-dependent targeted degradation of the viral NSSA protein. 41. Carthagena, L., Bergamaschi, A., Luna, J. M., David, A., Uchil, P. D., Margottin-Goguet, F., Mothes, W, Hazan, U., Transy, C., Pancino, G., and Nisole, S. A. (2009) Human TRIM Gene Expression in Response to Interferons, PLoS One 4, e4894. 42. Campos-Gomez, J., Ahmad, F., Rodriguez, E., and Saeed, M. F. (2016) A novel cell-based assay to measure activity of Venezuelan equine encephalitis virus nsP2 protease, Virology 496, 77-89. 43. D'Cruz, A. A., Babon, J. J., Norton, R. S., Nicola, N. A., and Nicholson, S. E. (2013) Structure and function of the SPRY/B30.2 domain proteins involved in innate immunity, Protein Sci 22, 1-10. 44. James, L. C., Keeble, A. H., Khan, Z., Rhodes, D. A., and Trowsdale, J. (2007) Structural basis for PRYSPRY-mediated tripartite motif (TRIM) protein function, Proc Natl Acad Sci USA 104, 6200-6205. 45. Ozato, K., Shin, D. M., Chang, T. H., and Morse, H. C., III (2008) TRIM family proteins and their emerging roles in innate immunity, Nat Rev Immunol 8, 849-860. 46. Vaysburd, M., Watkinson, R. E., Cooper, H., Reed, M., O'Connell, K., Smith, J., Cruickshanks, J., and James, L. C. (2013) Intracellular antibody receptor TRIM21 prevents fatal viral infection, Proc Natl Acad Sci USA 110, 12397-12401. 47. Di, P. A., Kajaste-Rudnitski, A., Oteiza, A., Nicora, L., Towers, G. J., Mechti, N., and Vicenzi, E. (2013) TRIM22 inhibits influenza A virus infection by targeting the viral nucleoprotein for degradation, J Virol. 87, 4523-4533. 48. Everett, R. D. and Chelbi-Alix, M. K. (2007) PML and PML nuclear bodies: implications in antiviral defence, Biochimie 89, 819-830. 49. Ozato, K., Shin, D. M., Chang, T. H., and Morse, H. C., III (2008) TRIM family proteins and their emerging roles in innate immunity, Nat Rev Immunol 8, 849-860. 50. James, L. C., Keeble, A. H., Khan, Z., Rhodes, D. A., and Trowsdale, J. (2007) Structural basis for PRYSPRY-mediated tripartite motif (TRIM) protein function, Proceedings of the National Academy of Sciences 104, 6200-6205. 51. Malim, M. H. and Bieniasz, P. D. (2012) HIV Restriction Factors and Mechanisms of Evasion, Cold Spring Harb. Perspect Med 2, a006940. 52. Nisole, S., Stoye, J. P., and Saib, A. (2005) TRIM family proteins: retroviral restriction and antiviral defence, Nat Rev Microbiol. 3, 799-808. 53. Carthagena, L., Bergamaschi, A., Luna, J. M., David, A., Uchil, P. D., Margottin-Goguet, F., Mothes, W, Hazan, U., Transy, C., Pancino, G., and Nisole, S. (2009) Human TRIM gene expression in response to interferons, PLoS One 4, e4894. 54. Bhoj, V. G., Sun, Q., Bhoj, E. J., Somers, C., Chen, X., Tones, J. P., Mejias, A., Gomez, A. M., Jafri, H., Ramilo, O., and Chen, Z. J. (2008) MAVS and MyD88 are essential for innate immunity but not cytotoxic T lymphocyte response against respiratory syncytial virus, Proc Natl Acad Sci USA 105, 14046-14051. 55. Mibayashi, M., Martinez-Sobrido, L. F., Loo Y M FAUCardenas, W, Cardenas W B FAUGale, M. J., Gale, M., Jr., and Garcia-Sastre, A. Inhibition of retinoic acid-inducible gene I-mediated induction of beta interferon by the NS1 protein of influenza A virus. 56. Kundu, P., Raychaudhuri, S., Tsai, W, and Dasgupta, A. (2005) Shutoff of RNA polymerase II transcription by poliovirus involves 3C protease-mediated cleavage of the TATA-binding protein at an alternative site: incomplete shutoff of transcription interferes with efficient viral replication, J Virol. 79, 9702-9713. 57. Das, S. and Dasgupta, A. (1993) Identification of the cleavage site and determinants required for poliovirus 3CPro-catalyzed cleavage of human TATA-binding transcription factor TBP, J Virol. 67, 3326-3331. 58. Weidman, M. K., Sharma, R., Raychaudhuri, S., Kundu, P., Tsai, W, and Dasgupta, A. (2003) The interaction of cytoplasmic RNA viruses with the nucleus, Virus Res. 95, 75-85. 59. Kuyumcu-Martinez, N. M., Van Eden, M. E., Younan, P., and Lloyd, R. E. (2004) Cleavage of poly(A)-binding protein by poliovirus 3C protease inhibits host cell translation: a novel mechanism for host translation shutoff, Mol Cell Biol 24, 1779-1790. 60. Kuyumcu-Martinez, N. M., Joachims, M., and Lloyd, R. E. (2002) Efficient cleavage of ribosome-associated poly(A)-binding protein by enterovirus 3C protease, J Virol. 76, 2062-2074. 61. de, B. S., Bonderoff, J. M., Chumakov, K. M., Lloyd, R. E., and Hellen, C. U. (2008) Cleavage of eukaryotic initiation factor eIF5B by enterovirus 3C proteases, Virology 378, 118-122. 62. Li, W, Ross-Smith, N., Proud, C. G., and Belsham, G. J. (2001) Cleavage of translation initiation factor 4AI (eIF4AI) but not eIF4AII by foot-and-mouth disease virus 3C protease: identification of the eIF4AI cleavage site, FEBS Lett 507, 1-5. 63. Foeger, N., Glaser, W, and Skern, T. (2002) Recognition of eukaryotic initiation factor 4G isoforms by picornaviral proteinases, J Biol Chem 277, 4430044309. 64. Qu, L., Feng, Z., Yamane, D., Liang, Y, Lanford, R. E., Li, K., and Lemon, S. M. (2011) Disruption of TLR3 signaling due to cleavage of TRIF by the hepatitis A virus protease-polymerase processing intermediate, 3CD, PLoS Pathog. 7, e1002169. 65. Banal, P. M., Sarkar, D., Fisher, P. B., and Racaniello, V. R. (2009) RIG-I is cleaved during picornavirus infection, Virology 391, 171-176. 66. Banal, P. M., Morrison, J. M., Drahos, J., Gupta, P., Sarkar, D., Fisher, P. B., and Racaniello, V. R. (2007) MDA-5 is cleaved in poliovirus-infected cells, J Virol. 81, 3677-3684. 67. Yang, Y., Liang, Y., Qu, L., Chen, Z., Yi, M., Li, K., and Lemon, S. M. (2007) Disruption of innate immunity due to mitochondrial targeting of a picornaviral protease precursor, Proc Natl Acad Sci USA 104, 7253-7258. 68. Neznanov, N., Chumakov, K. M., Neznanova, L., Almasan, A., Banerjee, A. K., and Gudkov, A. V. (2005) Proteolytic cleavage of the p65-RelA subunit of NF-kappaB during poliovirus infection, J Biol Chem 280, 24153-24158. 69. Wang, D., Fang, L., Li, K., Zhong, H., Fan, J., Ouyang, C., Zhang, H., Duan, E., Luo, R., Zhang, Z., Liu, X., Chen, H., and Xiao, S. (2012) Foot-and-mouth disease virus 3C protease cleaves NEMO to impair innate immune signaling, J Virol. 86, 9311-9322. 70. Wang, D., Fang, L., Wei, D., Zhang, H., Luo, R., Chen, H., Li, K., and Xiao, S. (2014) Hepatitis A virus 3C protease cleaves NEMO to impair induction of beta interferon, J Virol. 88, 10252-10258. 71. Lin, R., Lacoste, J., Nakhaei, P., Sun, Q., Yang, L., Paz, S., Wilkinson, P., Julkunen, I., Vitour, D., Meurs, E., and Hiscott, J. (2006) Dissociation of a MAVS/IPS-1/VISA/Cardif-IKKepsilon molecular complex from the mitochondrial outer membrane by hepatitis C virus NS3-4A proteolytic cleavage, J Virol. 80, 6072-6083. 72. Hiscott, J., Lacoste, J., and Lin, R. (2006) Recruitment of an interferon molecular signaling complex to the mitochondrial membrane: disruption by hepatitis C virus NS3-4A protease, Biochem. Pharmacol. 72, 1477-1484. 73. Bellecave, P., Sarasin-Filipowicz, M., Donze, O., Kennel, A., Gouttenoire, J., Meylan, E., Terracciano, L., Tschopp, J., Sarrazin, C., Berg, T., Moradpour, D., and Heim, M. H. (2010) Cleavage of mitochondrial antiviral signaling protein in the liver of patients with chronic hepatitis C correlates with a reduced activation of the endogenous interferon system, Hepatology 51, 1127-1136. 74. Meylan, E., Curran, J., Hofmann, K., Moradpour, D., Binder, M., Bartenschlager, R., and Tschopp, J. (2005) Cardif is an adaptor protein in the RIG-I antiviral pathway and is targeted by hepatitis C virus, Nature 437, 1167-1172. 75. Yu, C. Y, Chang, T. H., Liang, J. J., Chiang, R. L., Lee, Y L., Liao, C. L., and Lin, Y. L. (2012) Dengue Virus Targets the Adaptor Protein MITA to Subvert Host Innate Immunity, PLoS Pathog 8, e1002780. 76. Aguirre, S., Maestre, A. M., Pagni, S., Patel, J. R., Savage, T., Gutman, D., Maringer, K., Bernal-Rubio, D., Shabman, R. S., Simon, V., Rodriguez-Madoz, J. R., Mulder, L. C. F., Barber, G. N., and Fernandez-Sesma, A. (2012) DENV Inhibits Type I IFN Production in Infected Cells by Cleaving Human STING, PLoS Pathog 8, e1002934. 77. Li, J., Lim S P FAUBeer, D., Beer, D. F., Patel, V. F., Wen, D. F., Tumanut, C. F., Tully D C FAUWilliams, J., Williams J A FAUJiricek, J., Jiricek, J. F., Priestle J P FAUHarris, J., Harris J L FAUVasudevan, S., and Vasudevan, S. G. Functional profiling of recombinant NS3 proteases from all four serotypes of dengue virus using tetrapeptide and octapeptide substrate libraries. 78. Blom, N., Hansen, J., Blaas, D., and Brunak, S. (1996) Cleavage site analysis in picornaviral polyproteins: discovering cellular targets by neural networks, Protein Sci 5, 2203-2216. 79. Mukherjee, A., Morosky, S. A., orme-Axford, E., Dybdahl-Sissoko, N., Oberste, M. S., Wang, T., and Coyne, C. B. (2011) The coxsackievirus B 3C protease cleaves MAVS and TRIF to attenuate host type I interferon and apoptotic signaling, PLoS Pathog. 7, e1001311. 80. Badorff, C., Berkely, N., Mehrotra, S., Talhouk, J. W, Rhoads, R. E., and Knowlton, K. U. (2000) Enteroviral protease 2A directly cleaves dystrophin and is inhibited by a dystrophin-based substrate analogue, J Biol Chem 275, 11191-11197. 81. Weidman, M. K., Sharma, R., Raychaudhuri, S., Kundu, P., Tsai, W, and Dasgupta, A. (2003) The interaction of cytoplasmic RNA viruses with the nucleus, Virus Res. 95, 75-85. 82. Falk, M. M., Grigera, P. R., Bergmann, I. E., Zibert, A., Multhaup, G., and Beck, E. (1990) Foot-and-mouth disease virus protease 3C induces specific proteolytic cleavage of host cell histone H3, J Virol 64, 748-756. 83. Yalamanchili, P., Banerjee, R., and Dasgupta, A. (1997) Poliovirus-encoded protease 2APro cleaves the TATA-binding protein but does not inhibit host cell RNA polymerase II transcription in vitro, J Virol 71, 6881-6886. 84. Donnelly, M. I., Zhou, M., Millard, C. S., Clancy, S., Stols, L., Eschenfeldt, W H., Collart, F. R., and Joachimiak, A. (2006) An expression vector tailored for large-scale, high-throughput purification of recombinant proteins, Protein Expr. Purif. 47, 446454. 85. Legler, P. M., Cai, M., Peterkofsky, A., and Clore, G. M. (2004) Three-dimensional solution structure of the cytoplasmic B domain of the mannitol transporter IImannitol of the Escherichia coli phosphotransferase system, J. Biol. Chem. 279, 39115-39121. 86. Cheung, J., Franklin, M., Mancia, F., Rudolph, M., Cassidy, M., Gary, E., Burshteyn, F., and Love, J. (2011) Structure of the Chikungunya virus nsP2 protease. 87. Dong, M., Tepp, W. H., Johnson, E. A., and Chapman, E. R. (2004) Using fluorescent sensors to detect botulinum neurotoxin activity in vitro and in living cells, Proc. Natl. Acad. Sci. U.S.A 101, 14701-14706. 88. Ruge, D. R., Dunning, F. M., Piazza, T. M., Molles, B. E., Adler, M., Zeytin, F. N., and Tucker, W. C. (2011) Detection of six serotypes of botulinum neurotoxin using fluorogenic reporters, Anal. Biochem. 411, 200-209. 89. Morris, G. M., Huey, R., Lindstrom, W, Sanner, M. F., Belew, R. K., Goodsell, D. S., and Olson, A. J. (2009) AutoDock4 and AutoDockTools4: Automated docking with selective receptor flexibility, J Comput. Chem. 30, 2785-2791. 90. Shin, G., Yost, S. A., Miller, M. T., Elrod, E. J., Grakoui, A., and Marcotrigiano, J. (2012) Structural and functional insights into alphavirus polyprotein processing and pathogenesis, Proc. Natl. Acad. Sci. U.S.A 109, 16534-16539. 91. James, L. C., Keeble, A. H., Khan, Z., Rhodes, D. A., and Trowsdale, J. (2007) Structural basis for PRYSPRY-mediated tripartite motif (TRIM) protein function, Proceedings of the National Academy of Sciences 104, 6200-6205. 92. (2017) Introduction to CRISPR and Cas9. 93. Hartig, J. S. (2017) Mechanism of siRNA silencing. 94. Morazzani E M, Compton J R, Leary D H, Berry A V, Hu X, Marugan J J, Glass P J, Legler P M. Proteolytic cleavage of host proteins by the Group IV viral proteases of Venezuelan equine encephalitis virus and Zika virus. Antiviral Res. 2019 April; 164:106-122. doi: 10.1016/j.antiviral.2019.02.001 95. Nathanael D. Reynolds, Nathalie M. Aceves, Jinny L. Liu, Jaimee R. Compton, Dagmar H. Leary, Brendan T. Freitas, Scott D. Pegan, Katarina Z. Doctor, Fred Y. Wu, Xin Hu, and Patricia M. Legler, The SARS-CoV-2 SSHHPS Recognized by the Papain-like Protease ACS Infect. Dis. 2021, 7, 6, 1483-1502, published May 21, 2021 96. Stabell A C, Meyerson N R, Gullberg R C, Gilchrist A R, Webb K J, Old W M, Perera R, Sawyer S L. Dengue viruses cleave STING in humans but not in nonhuman primates, their presumed natural reservoir. Elife. 2018 Mar. 20; 7:e31919. doi: 10.7554/eLife.31919. PMID: 29557779; PMCID: PMC5860865. 97. Badorff C, Knowlton K U. Dystrophin disruption in enterovirus-induced myocarditis and dilated cardiomyopathy: from bench to bedside. Med Microbiol Immunol. 2004 May; 193(2-3):121-6. doi: 10.1007/s00430-003-0189-7. Epub 2003 Aug. 12. PMID: 12920582. 98. Lim B K, Peter A K, Xiong D, Narezkina A, Yung A, Dalton N D, Hwang K K, Yajima T, Chen J, Knowlton K U. Inhibition of Coxsackievirus-associated dystrophin cleavage prevents cardiomyopathy. J Clin Invest. 2013 December; 123(12):5146-51. doi: 10.1172/JCI66271. Epub 2013 Nov. 8. PMID: 24200690; PMCID: PMC3859391. 99. Perez-Bermejo J A, Kang S, Rockwood S J, Simoneau C R, Joy D A, Silva A C, Ramadoss G N, Flanigan W R, Fozouni P, Li H, Chen P Y, Nakamura K, Whitman J D, Hanson P J, McManus B M, Ott M, Conklin B R, McDevitt T C. SARS-CoV-2 infection of human iPSC-derived cardiac cells reflects cytopathic features in hearts of patients with COVID-19. Sci Transl Med. 2021 Apr. 21; 13(590):eabf7872. doi: 10.1126/scitranslmed.abf7872. Epub 2021 Mar. 15. PMID: 33723017; PMCID: PMC8128284. 100. Perez-Bermejo et al., SARS-CoV-2 infection of human iPSC-derived cardiac cells reflects cytopathic features in hearts of patients with COVID-19 Sci. Transl. Med. 13, eabf7872 (2021) 21 Apr. 2021. 101. Li H, Saucedo-Cuevas L, Yuan L, et al. Zika Virus Protease Cleavage of Host Protein Septin-2 Mediates Mitotic Defects in Neural Progenitors. Neuron. 2019; 101(6):1089-1098.e4. doi:10.1016/j.neuron.2019.01.010.