Compositions and methods for membrane protein structure determination
12624092 ยท 2026-05-12
Assignee
Inventors
Cpc classification
C07K2317/34
CHEMISTRY; METALLURGY
C07K16/1145
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
International classification
C07K16/00
CHEMISTRY; METALLURGY
Abstract
Disclosed herein are compositions and methods for determining the structure of a membrane protein. An epitope from a membrane-proximal external region (MPER) from a viral envelope protein can be grafted on to a variety of diverse membrane proteins to allow for binding structurally characterized antibody fragments, which can aid structural studies. ##STR00001##
Claims
1. A complex comprising: (a) a MPER peptide fusion protein comprising formula A-B, wherein: A is a peptide having consisting of the sequence of SEQ ID NO: 1; and B is membrane protein; and (b) an antibody fragment that binds to the peptide A.
2. The complex of claim 1, wherein B is a membrane protein having a molecular weight of less than 200 kDa.
3. The complex of claim 1, wherein A is attached to the N-terminus of the membrane protein B.
4. The complex of claim 1, wherein the antibody fragment is a Fab fragment from an antibody selected from the group consisting of 10E8, LN01, DH511, VRC42, PGZL1, and 4E10.
5. The complex of claim 4, wherein the antibody fragment is a Fab fragment from an antibody selected from the group consisting of 10E8 and VRC42.
6. A method of determining the structure of a membrane protein, comprising: (a) providing a complex of claim 1; and (b) determining the structure of the complex by X-ray crystallography or electron microscopy, to thereby determine the structure of the membrane protein.
7. The method of claim 6, wherein the structure of the complex is determined by X-ray crystallography.
8. The method of claim 7, further comprising a step of forming a crystal of the complex.
9. The method of claim 6, wherein the structure of the complex is determined by electron microscopy.
10. The method of claim 9, wherein the electron microscopy is cryo-electron microscopy.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
DETAILED DESCRIPTION
(10) The present disclosure relates to compositions and methods for determining the structure of a membrane protein, such as a small membrane protein (e.g., less than 200 kDa). To harness the utility of Fab fragments to aid membrane protein structure determination, while minimizing limitations, an epitope from a membrane-proximal external region (MPER) of a viral envelope protein is grafted on to a variety of diverse membrane proteins. This allows for binding of publicly available, structurally characterized antibody fragments to aid structural studies.
(11) The MPER of a viral envelope protein is a hotspot for recognition by broadly neutralizing antibodies. For example, in the human immunodeficiency virus 1 (HIV-1) viral envelope protein gp41, the MPER includes about 20 amino acids forming two short helical segments, one more distal and the other more proximal to the membrane (Uniprot ID: Q70626). The more proximal helix extends relatively perpendicular from the plane of the membrane (
(12) Disclosed herein are complexes comprising a fusion protein and an antibody fragment. In the fusion protein, a membrane protein is fused to a peptide having a sequence corresponding to that of an MPER of a viral envelope protein (or a variant thereof). Grafting of the MPER peptide onto the membrane protein provides a defined docking site for an MPER-targeting antibody fragment, which can aid in structural studies of the membrane protein, either by X-ray crystallography or by electron microscopy.
(13) This strategy is particularly useful for proteins that are among the most difficult to study using current structural biology techniques: small helical bundles that are almost entirely embedded within the membrane. N-terminal signal peptides or membrane localization sequences should be compatible with this approach, as long as they are proteolytically cleaved prior to Fab binding, as has been done with the N-terminal purification tags in the present experiments. In case shown in the Examples, MPER tags did not appear to influence protein stability.
(14) There are several other contemplated advantages to this approach. First, the biochemical properties of the MPER/antibody combinations described herein are particularly felicitous for structural biology of membrane proteins. As a contiguous extension of the N-terminal transmembrane helix of a target protein, the epitope is a structurally defined and rigid docking site for the antibody fragments. Negative stain 2-D class averages of the MPER-Fluc/10E8v4 construct, described in the Examples, highlight the rigidity of the complex: although the two Fab binding sites are at opposite ends of the elongated complex, both target-bound Fab fragments align well, with notably well-defined holes between the constant and variable domains of the Fab fragments.
(15) Second, the helical epitope is entirely discrete from the target protein and requires no alteration of native protein sequence, aside from the N-terminus. Thus, introducing this epitope is a milder maneuver than other strategies that depend on, for example, replacement of one of the helices of the target protein with a transmembrane epitope (Kim 2019; Mukherjee 2020). Moreover, the substrate occupancy of the binding site, as well as co-transported ions should not influence the complexing of protein to antibody fragments, introducing the ability to explore multiple protein conformations and ion-occupied states with the same target-protein construct and antibody Fab fragment.
(16) Third, a number of different antibodies have been identified that bind to the MPER epitope in varying orientations. Many known and characterized antibody fragments can be screened for target binding and effect on oligomerization, behavior in vitreous ice, and ability to form stable crystal contacts. In addition, the Fab fragments could be further engineered to improve their characteristics for structural biology applications, for example by introducing mutations to lock the elbow hinge region of the Fab fragment (Koide 2019). In addition, other viral spike proteins possess sequences analogous to the HIV-1 gp41 MPER that are hotspots for antibody recognition (Giang et al. Proc. Natl. Acad. Sci. U.S.A, 109 (2012), pp. 6205-6210; Dreyfus et al. Science, 337 (2012), pp. 1343-1348; Lee et al. Proc. Natl. Acad. Sci. U.S.A, 114 (2017), pp. E7987-E7996; Murin et al. Nat. Microbiol., 4 (2019), pp. 734-747). While examples herein focus on the HIV-1 MPER epitope because its interactions with multiple Fab fragments have been well-characterized, similar helical epitopes from other viral spike proteins should be similarly useful as transplantable epitopes for Fab recognition.
(17) Fourth, the antibodies that recognize the MPER epitope have innate affinity for the membrane, and this approach is therefore compatibleand even improvedwhen membrane mimetics like nanodiscs are used. The antibodies that recognize the MPER epitope also engage the membrane via specific interactions (Irimia 2017; Krebs 2019; Pinto 2019; Irimia 2016), thus reconstitution of the membrane protein into nanodiscs might expand the recognition surface and further improve the rigidity of the Fab-membrane protein complex.
(18) Fifth, this approach allows one to choose between the larger, more featureful Fabs or the smaller, easily produced short chain variable fragments (scFvs). The utility of the scFvs for X-ray crystallography and as a visible marker for negative stain electron microscopy is demonstrated herein. In addition, despite the absence of the hole between the constant and variable domains of the antibody fragment, scFvs also find use as an electron microscopy label for interpreting low-resolution EM density maps. Whereas X-ray crystallography has the advantage of labeling with heavy atoms, EM benefits from the introduction of protein labels to unambiguously localize regions of the protein (Bubellini et al. Labeling of Membrane Complexes for Electron Microscopy in Membrane Protein Structure and Function Characterization 125-138 (Springer, 2017)) and map macromolecule topology (Flemming et al. Nat. Struct. Mol. Biol. 17, 775-778 (2010)). scFvs will be especially useful for X-ray crystallography applications, since they do not suffer from flexibility in the hinge region. scFvs are recombinantly expressed in bacteria, significantly reducing the time and costs associated with using MPER-binding antibody fragments as crystallization chaperones, cryo-EM fiducial markers, or localization tags.
(19) Accordingly, in some embodiments, the disclosure provides a complex comprising: (a) a fusion protein having formula A-B, wherein: A is a peptide having at least 80% identity to a membrane-proximal external region (MPER) sequence from a viral envelope protein; and B is membrane protein; and (b) an antibody fragment that binds to the peptide A.
(20) As used herein, the term membrane-proximal external region or MPER refers to a conserved peptide sequence in a viral envelope protein, located near the viral envelope surface.
(21) In some embodiments, A is a peptide having 14, 15, 16, 17, 18, 19, or 20 amino acids. In some embodiments, A is a peptide having 17 amino acids.
(22) In some embodiments, A is a peptide having at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to an MPER sequence from a viral envelope protein.
(23) In some embodiments, the viral envelope protein is the human immunodeficiency virus (HIV-1) viral envelope protein gp41. The HIV-1 gp41 MPER is a 17-residue -helical extension of the N-terminal transmembrane helix (SEQ ID NO: 1). Accordingly, in some embodiments, A has at least 80% identity to SEQ ID NO: 1. In some embodiments, A is a peptide having SEQ ID NO: 1, or a variant thereof having 1, 2, or 3 amino acid substitutions compared to SEQ ID NO: 1. In some embodiments, one or more of the amino acid substitutions is a conservative substitution. As used herein, a conservative amino acid substitution refers to the substitution of an amino acid in a peptide or polypeptide with another amino acid having similar chemical properties, such as size or charge. For purposes of the present disclosure, each of the following eight groups contains amino acids that are conservative substitutions for one another: 1) Alanine (A) and Glycine (G); 2) Aspartic acid (D) and Glutamic acid (E); 3) Asparagine (N) and Glutamine (Q); 4) Arginine (R) and Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), and Valine (V); 6) Phenylalanine (F), Tyrosine (Y), and Tryptophan (W); 7) Serine(S) and Threonine (T); and 8) Cysteine (C) and Methionine (M).
(24) In some embodiments, A is a peptide of SEQ ID NO: 1.
(25) In some embodiments, the viral envelope protein is the GP2 subunit of the Ebola virus surface transmembrane glycoprotein (EboV GP2), and the MPER has a sequence set forth in SEQ ID NO: 2 (see, e.g., Scz-Cirin et al. FEBS Lett. 533 (1), 47-53 (2003)). In some embodiments, the viral envelope protein is hemagglutinin (HA) from the influenza B virus, and the MPER has a sequence set forth in SEQ ID NO: 3 (see, e.g., Giang et al. Proc. Natl. Acad. Sci. 109 (16), 6205-6210 (2012)). In some embodiments, the viral envelope protein is glycoprotein complex E1/E2 from the hepatitis C virus; in some such embodiments, the MPER has a sequence set forth in SEQ ID NO: 4. In some embodiments, the viral envelope protein is gp36 from the feline immunodeficiency virus (FIV), and the MPER has a sequence set forth in SEQ ID NO: 5 (see, e.g., Giannecchini et al. Virology 320 (1), 156-166 (2004)). In some embodiments, the viral envelope protein is gp41 from the simian immunodeficiency virus (SIV), and the MPER has a sequence set forth in SEQ ID NO: 6. In some embodiments, the viral envelope protein is HR2 from the SARS coronavirus (SARS-CoV) or the SARS coronavirus 2 (SARS-CoV-2), and the MPER has a sequence set forth in SEQ ID NO: 7 (see, e.g., Liao et al. Biochemistry 54 (9), 1819-1830 (2015)). Accordingly, in some embodiments, A has at least 80% identity to SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or SEQ ID NO: 7. In some embodiments, A is a peptide having SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or SEQ ID NO: 7, or a variant of any thereof having 1, 2, or 3 amino acid substitutions. In some embodiments, one or more of the amino acid substitutions is a conservative substitution.
(26) B is a membrane protein. As used herein, the term membrane protein refers to a protein having at least one segment that that spans a biological membrane (e.g., a cell membrane). A membrane protein may have one or more -helical transmembrane sequences, or may have a -barrel structure spanning the membrane. The term membrane protein also includes sequences in which one or more amino acids, such as terminal amino acids (e.g., N-terminal amino acids) are removed from the native protein sequence (e.g., to provide for optimal attachment of the MPER peptide A, as described herein). In particular embodiments, the membrane protein comprises one or more transmembrane -helices.
(27) The MPER peptide A can be fused to the terminus of any membrane protein that is of interest for structural studies. In some embodiments, B is a membrane protein having a molecular weight of less than about 200 kDa, or a molecular weight of less than about 100 kDa. For example, B may be a membrane protein having a molecular weight of less than about 200 kDa, less than about 195 kDa, less than about 190 kDa, less than about 185 kDa, less than about 180 kDa, less than about 175 kDa, less than about 170 kDa, less than about 165 kDa, less than about 160 kDa, less than about 155 kDa, less than about 150 kDa, less than about 145 kDa, less than about 140 kDa, less than about 135 kDa, less than about 130 kDa, less than about 125 kDa, less than about 120 kDa, less than about 115 kDa, less than about 110 kDa, less than about 105 kDa, less than about 100 kDa, less than about 95 kDa, less than about 90 kDa, less than about 85 kDa, less than about 80 kDa, less than about 75 kDa, less than about 70 kDa, less than about 65 kDa, less than about 60 kDa, less than about 55 kDa, less than about 50 kDa, less than about 45 kDa, less than about 40 kDa, less than about 35 kDa, less than about 30 kDa, less than about 25 kDa, less than about 20 kDa, less than about 15 kDa, less than about 10 kDa, less than about 5 kDa, or less than about 2.5 kDa.
(28) In some embodiments, A is attached to the N-terminus of the membrane protein B. The positioning of the peptide A on the membrane protein B is an important experimental consideration. One skilled in the art will appreciate that the antibody binding surface will rotate by about 100 for each amino acid shift along the membrane protein transmembrane helix 1. Accordingly, in some embodiments, A is directly attached to the N-terminus of the membrane protein B. In other embodiments, A is attached to the membrane protein B at the n+1, n+2, n+3, n+4, or the n+5 position, or the like. Optimal positioning of the MPER peptide A on any given membrane protein B can be experimentally determined by systematically shifting the register of the fusion (see, e.g.,
(29) A variety of different antibody fragments can be used to form the complex. MPER sequences are known to be targets for broadly neutralizing antibodies, and numerous antibody fragments that bind to MPERs are known. For example, antibody fragments that bind to the HIV-1 gp41 MPER include 10E8, LNO1, DH511, VRC42, PGZL1, and 4E10. Antibodies that bind to the EboV Gp2 MPER include ADI-16061 (Wec et al. Cell 169, 878-890 (2017)). Antibodies that bind to influenza B HA include CR9114 (Dreyfus et al. Science 337, 1343-1348 (2012)). Antibodies that bind to the hepatitis C glycoprotein subunit E1 include IGH526 (Kong et al. J. Mol. Biol. 427, 2617-2628 (2015)). Antibodies that bind to the hepatitis C glycoprotein E2 include AR4A (Giang et al. Proc. Natl. Acad. Sci. 109 (16), 6205-6210 (2012)). Other antibodies and antibody fragments that bind to MPERs have been described (Molinos-Albert et al. Front Immunol. 8, 1154 (2017). Each of these references is herein incorporated by reference in its entirety. In some embodiments, the antibody fragment is selected from 10E8, LNO1, DH511, VRC42, PGZL1, and 4E10, or a variant of any thereof.
(30) The antibody fragment may also be a single chain variable fragment based on a known antibody fragment that binds to an MPER sequence. As only the variable domain is responsible for antigen binding, the heavy and light chains of the variable domain can be concatenated by a linker of about 10-25 amino acids. The linker may be rich in glycine residues for flexibility, as well as serine and/or threonine residues for solubility. The linker may connect the N-terminus of the heavy chain to the C-terminus of the light chain, or may connect the C-terminus of the heavy chain to the N-terminus of the light chain. For example, disclosed herein is a single-chain variable domain fragment based on the 10E8 Fab fragment, with the heavy and light chains concatenated via a (Gly.sub.3Ser).sub.4 linker. This scFv was periplasmically expressed in E. coli and has the sequence set forth in SEQ ID NO: 12. Accordingly, in one aspect, the disclosure provides a short chain variable fragment having at least 95% identity to SEQ ID NO: 12, e.g., at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity to SEQ ID NO: 12. In some embodiments, the short chain variable fragment has a sequence set forth in SEQ ID NO: 12.
(31) In another aspect, the disclosure provides a method of determining the structure of a membrane protein. In one embodiment, the method comprises: (a) providing a complex as described herein; and (b) determining the structure of the complex, to thereby determine the structure of the membrane protein.
(32) The structure of the complex can be determined by X-ray crystallography. In such embodiments, the method may further comprise forming a crystal of the complex.
(33) General methods for the preparation and analysis of protein crystals have been disclosed. For example, see: Alexander McPherson, Preparation and Analysis of Protein Crystals (Kreiger Publishing, 1989); Jan Drenth, Principles of Protein X-Ray Crystallography, 3.sup.rd Ed. (Springer-Verlag, 2007). Briefly, crystal formation can be encouraged by bringing a solution of a protein or complex to supersaturation in a controlled manner; examples of such methods include sitting drop and hanging drop methods. Regulated temperature control may be desirable to improve crystal stability and quality. Temperatures from about 4 to 25 C. can be used during crystal formation, depending on the temperature which is optimal for protein stability over the period of crystal growth. A typical method of determining the three-dimensional structure from the diffraction pattern in X-ray crystallography typically involves multi-wavelength anomalous diffraction (MAD) or multiple isomorphous replacement (MIR) analysis. The X-rays used typically have wavelengths between about 0.9 to 1.7 , and are typically produced by synchrotron radiation or with a copper anode X-ray generator.
(34) The structure of the complex can also be determined by electron microscopy. One particular electron microscopy technique useful for protein structure determination is cryo-electron microscopy, in which a protein or complex is flash-frozen in a thin layer, which is then irradiated with low-energy electrons to produce 2D images of individual particles on the detector. General methods for conducting single-particle cryo-electron microscopy have been disclosed. For example, see: Cheng et al. Cell 161, 438-449 (2015).
(35) In another aspect, the disclosure provides a use of a peptide having at least 80% identity to a membrane-proximal external region (MPER) sequence from a viral envelope protein for protein structure analysis by fusing the peptide to the terminus of a membrane protein sequence. In some embodiments, the peptide has 14, 15, 16, 17, 18, 19, or 20 amino acids. In some embodiments, the peptide has 17 amino acids. In some embodiments, the peptide has at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to an MPER sequence from a viral envelope protein. In some embodiments, the viral envelope protein is the human immunodeficiency virus (HIV-1) viral envelope protein gp41, and the MPER has a sequence set forth in SEQ ID NO: 1. In some embodiments, the viral envelope protein is the GP2 subunit of the Ebola virus surface transmembrane glycoprotein (EboV GP2), and the MPER has a sequence set forth in SEQ ID NO: 2. In some embodiments, the viral envelope protein is hemagglutinin (HA) from the influenza B virus, and the MPER has a sequence set forth in SEQ ID NO: 3. In some embodiments, the viral envelope protein is glycoprotein complex E1/E2 from the hepatitis C virus; in some such embodiments, the MPER has a sequence set forth in SEQ ID NO: 4. In some embodiments, the viral envelope protein is gp36 from the feline immunodeficiency virus (FIV), and the MPER has a sequence set forth in SEQ ID NO: 5. In some embodiments, the viral envelope protein is gp41 from the simian immunodeficiency virus (SIV), and the MPER has a sequence set forth in SEQ ID NO: 6. In some embodiments, the viral envelope protein is HR2 from the SARS coronavirus (SARS-CoV) or the SARS coronavirus 2 (SARS-CoV-2), and the MPER has a sequence set forth in SEQ ID NO: 7. Accordingly, in some embodiments, the peptide has at least 80% identity to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or SEQ ID NO: 7. In some embodiments, the peptide has a sequence set forth in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, or SEQ ID NO: 7, or a variant of any thereof having 1, 2, or 3 amino acid substitutions. In some embodiments, one or more of the amino acid substitutions is a conservative substitution. In some embodiments, the peptide is fused to the N-terminus of the membrane protein.
(36) In some embodiments, kits are provided that contain one or more or all of the components necessary, sufficient, or useful for practicing the methods described herein. In some embodiments, the kits comprise one or more expression vectors that encode a viral envelope protein in trans with a cloning site to allow a user to insert a gene of interest encoding a membrane protein into the vector so that a fusion of the membrane protein and viral envelope protein is expressed. In some embodiments, the kit comprises one or more antibody fragments or other molecules that specifically bind the viral envelope protein. In some embodiments, the kits comprise positive and/or negative control reagents. In some embodiments, the kits comprise instructions, which may be written instructions or embodied in a computer readable media. Reagents within the kits may be housed in one or more containers (e.g., tubes) and the collection of kit components may be packaged in one or more boxes or other containers that facilitate shipment and storage of the kit.
(37) The following examples further illustrate aspects of the disclosure but, of course, should not be construed as in any way limiting its scope.
EXAMPLES
(38) In the examples described herein, epitope placement was aided by high resolution structures of the target protein. For the analysis of novel proteins, one skilled in the art will appreciate that additional experimental troubleshooting may be required to determine the proper positioning of the MPER epitope (e.g., along the native TM1 helix). For targets with homology to structurally characterized proteins, or for small membrane proteins with straightforward hydrophobicity profiles, transmembrane helices can be predicted with high accuracy. Thus, epitope placement can be initially predicted, and then experimentally confirmed by shifting the epitope along the TMH1 sequence and testing binding using gel filtration chromatography. Alternatively, for proteins with extracellular N-termini, the extramembrane location of the MPER epitope and membrane compatibility of Fab fragment binding could facilitate rapid in vivo screening of membrane protein expression and testing of MPER fusion registers via cell surface antibody staining. This approach could also be used to increase the mass or improve particle orientation for small, soluble proteins for cryo-EM. For soluble proteins of unknown structure, initial prediction of the fusion site could be less straightforward than for membrane proteins.
(39) Antibody preparation. 10E8v4 antibody expression vector DNA (heavy chain and light chain) was obtained from the NIH AIDS Reagent Program (cat. No. 12866 and 12877). VRC42 and 10E8v4 were prepared according to the same protocol. Heavy and light chain DNA was used to transfect Expi293 HEK cells. Antibodies were harvested from media 5 days post-transfection using Protein A agarose (Pierce). Antibodies were processed to antibody fragments by papain digestion (1:200 antibody: papain), followed by filtration on an immobilized Protein A agarose column (Pierce) to separate Fc domain from Fab fragments. Fab fragments were further purified by gel filtration chromatography.
(40) Negative stain electron microscopy. The target/antibody fragment samples were applied to a glow-discharged, carbon-coated copper grid for 1 minute before removal by blotting. A 0.75% solution of uranyl formate was applied to the grid for 1 minute, followed by removal by blotting and air drying, as previously described (Ohi et al. Biol. Proced. Online 6, 23-34 (2004)). Residual stain was removed using a vacuum apparatus. The negatively-stained samples were imaged with a FEI Tecnai T12 microscope operated at 120 keV (MPER-Fluc-Ec2/10E8v4, MPER-Fluc-BPE/VRC42, MPER-AdiC/10E8v4, MPER-GlpF/10E8v4) or a FEI Tecnai T20 microscope operated at 200 keV (MPER-Fluc-Ec2/scFv). Images were acquired with Leginon and SerialEM (Suloway et al. J. Struct. Biol. 151, 41-60 (2005); Mastronarde J. Struct. Biol. 152, 36-51 (2005)). Images were recorded at a pixel size of 2.34 A/px (MPER-Fluc-Ec2/10E8v4, MPER-GlpF/10E8v4), 1.45 A/px (MPER-Fluc-Bpc/VRC42, MPER-AdiC/10E8v4), or 1.37 A/px (MPER-Fluc-Ec2/10E8v4 scFv). CTF estimation was performed on the images using CTFFIND4 (Rohou et al. J. Struct. Biol. 192, 216-221 (2015)) and gCTF (Zhang J. Struct. Biol. 193, 1-12 (2016)). Particles were picked using the crYOLO general model (Wagner et al. Commun. Biol. 2, 1-13 (2019)). Particle extraction and initial 2D classification was performed using RELION (Zivanov et al. Elife 7, e42166 (2018)). Extracted particles were then imported into cryoSparc for 2-D class averaging (Punjani et al. Nat. Methods 14, 290 (2017)). Averages were generated using 9,582 (MPER-Fluc-Ec2/10E8v4), 35,096 (MPER-Fluc-BPE/VRC42), 15,290 (PMER-AdiC/10E8v4), 7,594 (MPER-GlpF/10E8v4), and 6,781 (MPER-Fluc-Ec2/10E8v4 scFv) particles. Ab initio models and subsequent 3-D refinements were generated in cryoSPARC (id.). Figures were prepared with UCSF ChimeraX (Goddard et al. Protein Sci. 27, 14-25 (2018)).
Example 1
(41) Bioinformatic Evaluation of Membrane Proteins
(42) To assess the suitability of the most membrane-proximal helix of the MPER as a helical tag, small membrane proteins in the protein data bank (PDB) were bioinformatically evaluated for their ability to accept the MPER epitope tag as graft for the N-terminus of the first transmembrane helix (TMH1) in order to create a chimera between the epitope tag and membrane protein.
(43) -helical transmembrane proteins from the non-redundant PDB-TM database, excluding theoretical models, were obtained from the RCSB Protein Data Bank (934 proteins). Transmembrane biological units were reconstructed from -helical transmembrane chains identified in biological unit information from REMARK 350 of the PDB file. For complexes with a molecular weight of 100 kDa (457 proteins), the membrane was modelled using the PPM2.0 method (see the Orientations of Proteins in Membranes (OPM) database, https://opm.phar.umich.edu), implemented using a known program (Lomize et al. Nucleic Acids Res., 40 (2012), pp. D370-D376). Based on the estimated membrane boundaries, the dataset was further filtered to include only complexes with two or more transmembrane helices and with more than 50% of residues inside the membrane. The proteins in this set (304 proteins) were analyzed for steric compatibility with the MPER epitope tag according to two criteria: a tilt angle for the first transmembrane helix of 45 relative to the plane of the membrane (294 proteins), and no clashes between the MPER epitope tag and the target protein. To assess clashes between the target protein and MPER, the last 8 residues of the -helical MPER peptide (LWNWFDITNWLWYIKSLAAAA) were aligned in PyMol with the first TM helix of the target protein in four registers: n (the first eight residues of the first transmembrane helix of the target), n+1, n+2, and n+3. Each of these four models was assessed for clashes (C3 ) between the MPER epitope tag and the biological unit. Models with an acceptable tilt angle for TM helix 1, and with no clashes between MPER and the target protein (1069 models representing 290 proteins) were further assessed for complexation by antibody fragments 10E8 Fab, 10E8 scFv, 4E10 Fab, and 4E10 scFv. For each model, the antibody fragment was positioned relative to the MPER epitope based on structures of antibody-MPER complexes (PDB: 1TZG (Cardoso et al. Immunity, 22 (2005), pp. 163-173) and PDB: 5JNY (Soto et al. PLoS ONE, 11 (2016) e0157409) and assessed for clashes (C5 ) with the target protein, the membrane, or, for targets with oligomeric construction, other antibody fragments. For these calculations, the residues N-terminal to the twelfth residue of the target's first transmembrane helix were not considered. To assess membrane clashes, the membrane boundary was extended to the length of the antibody complex, and the membrane-penetrating CDR loops of the antibody fragments were excluded from the calculation. Different cutoffs for MPER and antibody clashes calculations were chosen because the MPER clash reflects intra-protein interactions, whereas the antibody clash reflects inter-protein interactions. All models that could accommodate at least one of the four antibody fragments with <10 clashes were manually inspected. A workflow and examples of models that do and do not satisfy each condition is available in
(44) TABLE-US-00001 TABLE 1 Models for MPER-membrane protein fusions and antibody binding analyzed according to the sequence position of the first residue of TM helix 1 TMH1 start at residue position Step 1-25 26-50 >50 50% protein inside membrane 280 20 4 Tilt of TMH1 <=45 270 20 4 Can accept MPER tag 266 20 4 Tolerate 4e10 or 10e8 Fv/Fab 87 9 1 Tolerate 4e10 or 10e8 Fv/Fab 61 4 0 (minor clash)
(45) Small membrane proteins that lack extracellular domains were a focus of evaluation, since these are particularly difficult to characterize using standard structural techniques. 304 unique structures of membrane proteins smaller than 100 kDa were identified, with at least two transmembrane helices and at least half of all residues embedded in the membrane. Of these proteins, 89% were found to be sterically compatible with such an N-terminal helix graft. For those membrane proteins structurally compatible with the MPER epitope tag, antibody fragments 10E8 and 4E10 were analyzed for whether they could bind to the tag in one of several registers without clashing with the target protein or the membrane. The analysis suggests that over half of unique small membrane proteins in the PDB, representing diverse folds, are likely to be structurally compatible with the N-terminal helix tag and its recognition by an MPER-binding antibody fragment (
Example 2
Fusion Protein Preparation
(46) Sequences encoding the fluoride channel from E. coli (Fluc-Ec2), the fluoride channel from Bordetella pertussis (Fluc-Bpe), the arginine/agmatine antiporter from S. entericus (AdiC), and the aqua-glycerol channel from E. coli (GlpF) were cloned into a protein expression vector (pET21a), C-terminal to an N-terminal hexahistidine tag, a thrombin cleavage site, and a sequence encoding the HIV-1 gp41 MPER epitope (LWNWFDITNWLWYIKNLSEQ ID NO: 1). The constructs were designed so that the MPER sequence was positioned at the membrane boundary. E. coli C41 cells transformed with this plasmid were grown at 37 C. to an O.D.sub.600 of 1 before induction with isopropyl -1-thiogalactopyranoside (IPTG) at 37 C. for 1-3 hours. The Fluc-Ec2 and Fluc-Bpe variants were induced for 1 h with 4 mM isopropyl -1-thiogalactopyranoside (IPTG); the GlpF variant was induced for 2 h with 1 mM IPTG; the AdiC variant was induced for 1 h with 0.2 mM IPTG. Cells were harvested by centrifugation, resuspended in cell breaking buffer (100 mM NaCl, 20 mM Tris pH 8.0) with lysozyme (1 mg/mL), protease inhibitor cocktail (Roche), PMSF (200 mM), and lysed by sonication on ice. After detergent extraction with 2% n-Decyl--D-Maltoside (DM) for 2 hours, cell debris were removed by centrifugation, and His-tagged proteins were isolated using cobalt affinity resin (Takara). Bound protein was eluted with 400 mM imidazole, and applied to a desalting column to remove imidazole. His tags were cleaved with overnight thrombin digestion (1.58 U thrombin per mg protein, 4 C.).
(47) Sequences of the three fusion proteins are set forth in SEQ ID NO: 8 (MPER-Fluc-Ec2), SEQ ID NO: 9 (MPER-Fluc-Bpe), SEQ ID NO: 10 (MPER-GlpF), and SEQ ID NO: 11 (MPER-AdiC).
(48) For antibody complexation, protein and 10E8v4 Fab were combined in a 1:1 stoichiometric ratio 2 hours at room temperature prior to gel filtration (Superdex200 equilibrated in 100 mM NaCl, 10 mM HEPES pH 7.5, 4 mM DM). Fractions corresponding to the protein: 10E8v4 Fab complex were isolated and used for further studies.
Example 3
MPER-Fluc-Bpe Fusion Protein Complexation
(49) The fluoride channels from the Fluc family are small (30-kDa) structurally characterized membrane proteins involved in bacterial resistance to fluoride ions. Homologues from Bordetella pertussis (Fluc-Bpe) and E. coli (Fluc-Ec2) have been structurally characterized (Stockbridge et al. Nature 525, 548-551 (2015); McIlwain et al. Structure 26, 635-639 e1 (2018), each of which is herein incorporated by reference in its entirety). The channels are assembled as antiparallel dimers, with each monomer comprised of four transmembrane helices. Based on the known structure of the Fluc channels, the MPER epitope was genetically fused to the N-terminal end.
(50) The MPER-Fluc-Bpe fusion protein (
(51) Additional MPER-Fluc-Bpe constructs were expressed and purified, with the sequence for the MPER epitope shifted along the TMH1 sequence (n+1, n+2, n+3). When purified individually, these MPER-Fluc-Bpe fusion proteins were monodisperse. However, when these MPER fusion proteins were complexed with 10E8v4 Fab fragments, the protein did not elute as a single peak, indicating that these constructs would not be suitable for further structural work (
Example 4
MPER-Fluc/10E8v4 Antibody Fragment Crystallography
(52) For structural analysis, SEC-purified complexes of MPER-Fluc-BPE or MPER-Fluc-Ec2 and 10E8v4 were prepared for vapor diffusion crystallography. Samples containing stable MPER-Fluc-Ec2/10E8v4 complex were concentrated to 10 mg/mL and mixed with an equal volume of crystallization solution in 24-well sitting-drop vapor diffusion trays. After optimization of initial hits, MPER-Fluc-Ec2/10E8v4 crystals grew in 100 mM NaCl, 34-39% PEG 300, 100 mM MES pH 6.2-7.0. For MPER-Fluc-Ec2/scFv crystallization, the stable complex was formed as for MPER-Fluc-Ec2/10E8v4, and protein samples were mixed with an equal volume of crystallization solution from commercial screening blocks (MemGold and MemGold2, Molecular Dimensions) in 96 well plates. The best-diffracting crystals were grown in 100 mM calcium acetate, 100 mM HEPES pH 7.5, 33.8% PEG 600. Crystals were frozen in liquid nitrogen prior to data collection at the Life Sciences Collaborative Access Team beamline 21-ID-D at the Advanced Photon Source, Argonne National Laboratory. Data were somewhat anisotropic, but ellipsoidal truncation did not improve the maps, so the data were spherically truncated so that data completeness was maximized (99%) in the highest resolution shell. Phases were calculated by molecular replacement with Phaser (McCoy et al. J. Appl. Crystallogr., 40 (2007), pp. 658-674) using Fluc-Ec2 (pdb: 5A43) (Stockbridge 2015) and the constant and variable domains of 10E8v4 (pdb: 5IQ9) (Kwon 2016) as search models. The MPER peptide was built into the Fo-Fc difference density map, followed by iterative rounds of refinement with Refmac (Murshudov et al. Acta Crystallogr. D Biol. Crystallogr., 67 (2011), pp. 355-367) or Phenix (Liebschner et al. Acta Crystallogr. D Struct. Biol., 75 (2019), pp. 861-877) and model building in real space with Coot (Emsley et al. Acta Crystallogr. D Biol. Crystallogr., 66 (2010), pp. 486-501). Models were validated using Molprobity (Williams et al. Protein Sci., 27 (2018), pp. 293-315) and by preparing composite omit maps, with 5% of the atoms omitted from the model at a time using Phenix (Terwilliger et al. Acta Crystallogr. D Biol. Crystallogr., 64 (2008), pp. 515-524). Figures were prepared with PyMol.
(53) For Fluc-Ec2 and Fluc-Bpe, previous structure determination had required complexation with soluble crystallography chaperones called monobodies. They diffracted to resolutions of 2.2-3.5 , depending on the monobody chaperone (McIlwain et al. Structure, 26 (2018) 635-9 e1; Stockbridge et al. Nature 525, 548-551 (2015). Alone, the channels, which are almost entirely membrane-embedded, do not even form crystals, despite extensive screening (Stockbridge 2015). In contrast, in trays set with the MPER-Fluc-Ec2/10E8v4 complex, crystals began to form within 24-hours and reached a maximum size of 200 m in approximately one week (
(54) TABLE-US-00002 TABLE 2 X-ray crystallography data collection and refinement statistics. MPER-Fluc-Ec2/10E8v4 Data collection Space group P3.sub.2 Cell dimensions a, b, c () 99.1, 99.1, 167.6 , , () 90, 90, 120 Resolution () 38.18-3.26 (3.46-3.26) Data Completeness 98.6 (98.4) R.sub.merge 0.135 (2.44) R.sub.meas 0.141 (2.56) Mn I/I 10.3 (1.0) CC.sub.1/2 0.999 (0.765) Multiplicity 10.8 (11.2) Refinement Resolution () 34.0-3.26 No. reflections 26, 788 R.sub.work/R.sub.free 25.1/29.5 Ramachandran Favored 90.3 Ramachandran Outliers 2.0 Clashscore 10.1 R.m.s. deviations Bond lengths () 0.003 Bond angles () 0.72
Example 5
Negative Stain EM Analysis of MPER-Fluc in Complex with Antibody Fragments
(55) MPER-Fluc-Ec2/10E8v4 sample was applied to a carbon-coated grid and negatively stained, as described above (Ohi 2004). The raw micrographs of MPER-Fluc-Ec2 bound to 10E8v4 antibody fragments showed elongated particles that measured approximately 180 in the longest dimension (
(56) When MPER-Fluc-Ec2 was complexed with 10E8v4-scFv instead, negative stain electron microscopy revealed discrete 3-unit particles that appeared shorter than the MPER-Fluc-Ec2/10E8v4 Fab particles observed previously, in agreement with the expected architecture of the MPER-Fluc-Ec2 dimer bound to two molecules of scFv (
Example 6
Single Particle Cryo-EM of MPER-Fluc in Complex with VRC42 Fab
(57) VRC42 Fab and MPER-Fluc-Bpe, at 0.5 mg/mL, in a buffer of 100 mM NaCl, 10 mM HEPES pH 7.5, 4 mM DM, were combined in a molar ratio 0.3:1. 3.5 L of 0.5 mg/mL solution of the complex was applied to glow discharged (5 mA 30 s) Quantifoil R1.2/1.3 200 mesh copper grids (Electron Microscopy Sciences). The sample was blotted 1 time for 2 s with blot force 1 and then plunged into liquid ethane using a Vitrobot Mark IV (Thermo Fisher Scientific) set at 100% humidity/4 C. Samples were clipped and loaded into a Talos Arctica transmission electron microscope (Thermo Fisher Scientific) operating at 200 kV with a gun lens of 6, a spot size of 6, 70 m C2 aperture, and 100 m objective aperture. Frames were collected on a K2 direct electron detector (Gatan) in counting mode at 45,000 kx corresponding to a pixel size of 0.91 /px. Leginon was used for automated data acquisition. Each movie had a total dose of approximately 65-70 e/.sup.2 with a defocus range of 1.0 m to 3.0 m.
(58) 3911 movies were aligned using MotionCor2 (Zheng et al. Nat. Methods, 14 (2017), pp. 331-332). CTFFIND4 was used to estimate CTF values for aligned micrographs (Rohou 2015). Micrographs with poor CTF fits were discarded. Two datasets (1965 movies total) were collected and combined in downstream processing steps. For Dataset 1, 30,899 particles were picked manually and 2D classification was performed on extracted particles using cryoSPARC v2.15.0 (Punjani et al. Nat. Methods, 14 (2017), p. 290). The resulting 2-D class averages were used as templates for template-based picking in cryoSPARC v2.15.0 (Punjani 2017) and the best 2-D class averages (22,699 particles) were used to generate 3 ab initio reconstructions. 232,123 particles were picked with template-based picking and extracted for 2D classification. After selecting particles from the best 2-D classes, 191,230 particles were used for heterogeneous refinement into 3 classes using the 3 ab initio reconstructions generated previously as reference volumes. 1 class with 65,654 particles (34% of particles) with strong density for VRC42 protruding from MPER-Fluc-Bpe in DM. For Dataset 2, 963,331 particles were picked with template-based picking and extracted for 2D classification. After selecting particles from the best 2-D classes, 65,882 particles were then combined with the 65,654 particles from Dataset 1 and underwent 2 rounds of multi-reference ab initio reconstruction to isolate MPER-Fluc-Bpe bound to a single VRC42 Fab fragment. This resulted in a particle stack with 35,655 particles that was used for 3D homogeneous refinement. The final map was deposited into the Electron Microscopy Data Bank under accession number EMD-23247.
(59) The Fluc channels are unusual among membrane proteins in that the antiparallel subunits present epitopes on both sides of the membrane, so that the doubly-Fab-bound particles are disproportionately long and thin. This doubly-bound species might require thicker, contrast-poor ice or adopt a preferred orientation in the vitrified ice layer. The stoichiometric ratio of membrane protein and antibody fragment was therefore also varied. Some samples included equal molar ratios of membrane protein and Fab so that the MPER epitopes were fully occupied. In other samples, a dimer was used: Fab molar ratio of 1:0.3. At this ratio, assuming that MPER occupancy by Fab follows random statistical capture, only 3% of Fluc channels are expected to be doubly occupied, with the singly occupied species 10-fold more prevalent. The substantial portion of unoccupied, 30 kDa Fluc particles were anticipated to be difficult to visualize and behave as background. Negative stain EM of one of these sub-stoichiometric preparations, MPER-Fluc-Bpe/VRC42, was conducted as described above. It confirmed the expected distribution of singly- and doubly bound particles (
(60) Out of these various combinations of Fluc homologue, Fab identity, and Fab occupancy, initial screening experiments showed that the preparation of MPER-Fluc-Bpe/VRC42 with predominately singly bound particles was well-behaved in vitreous ice (
(61) TABLE-US-00003 TABLE 3 Cryo-EM data collection and processing MPER-Fluc-Bpe/VRC42 Dataset 1 2 Sample MPER-Fluc-Bpe/VRC42 (0.3:1 molar ratio) Grid Type Quantifoil 1.2/1.3 200 mesh Microscope Thermo Fischer Talos Arctica Camera Gatan K2 Voltage .sup.200 kV Total electron exposure 65 e-/.sup.2 Defocus range 1.5-3.5 m Pixel Size .sup.0.91 /pix Micrographs 2,131 1780 Micrographs Used 1076 889 Refined Particles 35,655 (masked monomer) Resolution ~10
Example 7
MPER-GlpF Complexation and Characterization
(62) To test whether membrane proteins with disparate folds could host the MPER epitope tag and bind Fab in the predicted orientation, MPER fusions for two additional structurally characterized, biochemically tractable targets representing different protein folds were designed: AdiC, a bacterial arginine/agmatine exchanger that possesses the LeuT-fold (Fang et al. Nature, 460 (2009), pp. 1040-1043), and GlpF, a bacterial glycerol channel that possesses the aquaporin fold (Fu et al. Science 290, 481-6 (2000)). Negative stain EM (conducted as described above) was used to determine whether Fab could bind to these MPER-tagged proteins, and to assess the homogeneity of the resulting complex formation (
(63) The AdiC protein from Salmonella enterica is a biological dimer with ten TMHs per subunit. Each subunit is approximately 47-kDa in size. Based on the crystal structure (Fang 2009), the placement of the helical MPER epitope was modeled so that Fab fragment binding to this epitope would not clash with the extracellular portions of the transporter (
(64) GlpF is a 28-kDa aquaglycoporin that permits diffusion of glycerol and some linear polyalcohols in E. coli, and is composed of six membrane-spanning TMHs and two re-entrant haripins. GlpF alone crystallized as a tetramer (id.), but biochemical studies have suggested that the oligomer is weakly associated and that monomeric proteins are both frequently observed (Manley et al. Biochemistry 39, 12303-11 (2000); Borgnia et al. Proc. Natl. Acad. Sci. USA 98, 2888-93 (2001)) and functional (Trefz et al. Biochim. Biophys. Acta Biomembr. 1860, 887-894 (2018); Cymer et al. Biochemistry 49, 279-86 (2010)). As with MPER-Fluc-Ec2 and MPER-AdiC, modelling suggested that MPER-GLPF would bind to 10E8v4 without steric clashes (
(65) GlpF was mixed with a sub-stoichiometric concentration of 10E8v4 Fab. The resultant MPER-GlpF/10E8v4 complex elutes from the size exclusion column as a single monodisperse peak that contains both protein components at an elution volume approximately 1 mL earlier than GlpF alone (
Example 8
Design and Purification of a Single-Chain Variable-Domain Antibody Fragment (scFv)
(66) Design of scFv (
(67) The protein was expressed (
(68) TABLE-US-00004 SEQUENCES HIV-1gp41MPER(SEQIDNO:1):LWNWFDITNWLWYIKNL EbolavirusGP2MPER(SEQIDNO:2):DNDNWWTGWRQWIIAGIG InfluenzaBvirusMPER(SEQIDNO:3):TQ(Q/S/K)AIDQI(T/N)GKLNR HepatitisCvirusMPER(SEQIDNO:4):TGLIHLHQNIVDVQYLY FelineimmunodeficiencyvirusMPER(SEQIDNO:5):WEDWVGWIGNIIQY SimianimmunodeficiencyvirusMPER(SEQIDNO:6): KLNSWDVFGNWFDLASWIKYIQ SARScoronavirus/coronavirus-2MPER(SEQIDNO:7): Y(V/I)KWPW(W/Y)VWLGF MPER-Fluc-Ec2fusionprotein(SEQIDNO:8): GHHHHHHGGLVPRGSASLWNWFDITNWLWYIKNLIAVIIGGSVGCTLRWLLSTRFNSLF PNLPPGTLVVNLLAGLIIGTALAYFLRQPHLDPFWKLMITTGLCGGLSTFSTFSVEVFALL QAGNYIWALTSVLVHVIGSLIMTALGFFIITILFA MPER-Fluc-Bpefusionprotein(SEQIDNO:9): GHHHHHHGGLVPRGSASLWNWFDITNWLWYIKNLIAIGIGATLGAWLRWVLGLRLNG AGWPWGTLTANLVGGYLIGVMVALIASHPEWPAWIRLAAVTGFLGGLTTFSTFSAETV DMLERGVYATAAAYAGASLAGSLAMTGLGLATVRLLLR MPER-GlpFfusionprotein(SEQIDNo:10): GHHHHHHGGLVPRGSASLWNWFDITNWLWYIKNLIAEFLGTGLLIFFGVGCVAALKVA GASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQV AGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEM VITAILMGLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDFGPKVF AWLAGWGNVAFTGGRDIPYFLVPLFGPIVGAIVGAFAYRKLIGRHLPCDICVVEEKETTT PSEQKASL MPER-AdiCfusionprotein(SEQIDNO:11): GHHHHHHSGGLVPRGSGSLWNWFDITNWLWYIKNLIALIIVTLMVSGNIMGSGVFLLPA NLAATGGIAIYGWLVTIIGALALSMVYAKMSSLDPSPGGSYAYARRCFGPFLGYQTNVL YWLACWIGNIAMVVIGVGYLSYFFPILKDPLVLTLTCVAVLWIFVLLNIVGPKMITRVQA VATVLALVPIVGIAVFGWFWFKGETYMAAWNVSGMNTFGAIQSTLNVTLWSFIGVESA SVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMA LGDTAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTPVAGL LIVGVLMTIFQFSSMSPNAAKEFGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKARPLY LLITFVAFVYCIWAVIGSGAKEVMWSFVTLMVITALYALNYNRIHKNPYPLDAPVKQD scFvproteinsequence(SEQIDNO:12): GWSCIILFLVATATGVHSEVRLVESGGGLVKPGGSLRLSCSASGFDFDNAWMTWVRQP PGKGLEWVGRITGPGEGWSVDYAESVKGRFTISRDNTKNTLYLEMNNVRTEDTGYYFC ARTGKYYDFWSGYPPGEEYFQDWGQGTLVIVSSASGGGGSGGGGSGGGGSGGSGWSCI ILFLVATATGSVTASELTQDPAVSVALKQTVTITCRGDSLRSHYASWYQKKPGQAPVLL FYGKNNRPSGIPDRFSGSASGNRASLTITGAQAEDEADYYCSSRDKSGSRLSVFGGGTKL TVLSQPKAAENLYFQSHHHHHH Fluc-BPETransmembraneHelix1(SEQIDNO:13):LTIAPLIAIGIGATL EngineeredMPER-Fluc-BPEsequence(SEQIDNO:14): LWNWFDITNWLWYIKNLIAIGIGATL EngineeredMPER-Fluc-BPEsequence(n+1)(SEQIDNO:15): LWNWFDITNWLWYIKNLLIAIGIGATL EngineeredMPER-Fluc-BPEsequence(n+2)(SEQIDNO:16): LWNWFDITNWLWYIKNLILIAIGIGATL EngineeredMPER-Fluc-BPEsequence(n+3)(SEQIDNO:17): LWNWFDITNWLWYIKNLAILIAIGIGATL